| Basic Information | |
|---|---|
| Family ID | F039103 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LEAVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.66 % |
| % of genes near scaffold ends (potentially truncated) | 93.90 % |
| % of genes from short scaffolds (< 2000 bps) | 85.98 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.244 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (18.902 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.049 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.024 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.96% β-sheet: 23.29% Coil/Unstructured: 65.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 4.27 |
| PF16363 | GDP_Man_Dehyd | 0.61 |
| PF05257 | CHAP | 0.61 |
| PF01210 | NAD_Gly3P_dh_N | 0.61 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.61 |
| PF00085 | Thioredoxin | 0.61 |
| PF00082 | Peptidase_S8 | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.24 % |
| All Organisms | root | All Organisms | 34.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002195|metazooDRAFT_1212384 | Not Available | 561 | Open in IMG/M |
| 3300002350|B570J29583_1004953 | Not Available | 1015 | Open in IMG/M |
| 3300002835|B570J40625_100247061 | All Organisms → Viruses → Predicted Viral | 1865 | Open in IMG/M |
| 3300003499|JGI25930J51415_1041951 | Not Available | 801 | Open in IMG/M |
| 3300005581|Ga0049081_10038501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1817 | Open in IMG/M |
| 3300005581|Ga0049081_10308056 | Not Available | 544 | Open in IMG/M |
| 3300005581|Ga0049081_10344424 | Not Available | 506 | Open in IMG/M |
| 3300005582|Ga0049080_10300803 | Not Available | 517 | Open in IMG/M |
| 3300005582|Ga0049080_10305732 | Not Available | 512 | Open in IMG/M |
| 3300006639|Ga0079301_1059480 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300006802|Ga0070749_10411937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 744 | Open in IMG/M |
| 3300007234|Ga0075460_10317551 | Not Available | 509 | Open in IMG/M |
| 3300007523|Ga0105052_10147678 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300007542|Ga0099846_1076815 | Not Available | 1244 | Open in IMG/M |
| 3300007861|Ga0105736_1060376 | Not Available | 774 | Open in IMG/M |
| 3300007973|Ga0105746_1203644 | Not Available | 676 | Open in IMG/M |
| 3300007974|Ga0105747_1195246 | Not Available | 666 | Open in IMG/M |
| 3300008107|Ga0114340_1000305 | Not Available | 35323 | Open in IMG/M |
| 3300008108|Ga0114341_10003288 | Not Available | 19351 | Open in IMG/M |
| 3300008108|Ga0114341_10470255 | Not Available | 578 | Open in IMG/M |
| 3300008108|Ga0114341_10488740 | Not Available | 560 | Open in IMG/M |
| 3300008113|Ga0114346_1176482 | Not Available | 881 | Open in IMG/M |
| 3300008114|Ga0114347_1085793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1249 | Open in IMG/M |
| 3300008116|Ga0114350_1035942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2851 | Open in IMG/M |
| 3300008116|Ga0114350_1047268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1587 | Open in IMG/M |
| 3300008116|Ga0114350_1150768 | Not Available | 648 | Open in IMG/M |
| 3300008119|Ga0114354_1104007 | Not Available | 1121 | Open in IMG/M |
| 3300008120|Ga0114355_1018492 | All Organisms → Viruses → Predicted Viral | 3722 | Open in IMG/M |
| 3300008120|Ga0114355_1153184 | Not Available | 814 | Open in IMG/M |
| 3300008120|Ga0114355_1167015 | Not Available | 757 | Open in IMG/M |
| 3300008120|Ga0114355_1239047 | Not Available | 544 | Open in IMG/M |
| 3300008259|Ga0114841_1230654 | Not Available | 630 | Open in IMG/M |
| 3300008265|Ga0114361_1239116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 561 | Open in IMG/M |
| 3300008266|Ga0114363_1000542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 32169 | Open in IMG/M |
| 3300008266|Ga0114363_1076603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1257 | Open in IMG/M |
| 3300008266|Ga0114363_1122027 | Not Available | 904 | Open in IMG/M |
| 3300008999|Ga0102816_1247538 | Not Available | 561 | Open in IMG/M |
| 3300009068|Ga0114973_10043401 | All Organisms → Viruses → Predicted Viral | 2676 | Open in IMG/M |
| 3300009159|Ga0114978_10287143 | Not Available | 1011 | Open in IMG/M |
| 3300010354|Ga0129333_10009741 | Not Available | 9072 | Open in IMG/M |
| 3300010354|Ga0129333_10161575 | All Organisms → Viruses → Predicted Viral | 2053 | Open in IMG/M |
| 3300010354|Ga0129333_10240887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1634 | Open in IMG/M |
| 3300010354|Ga0129333_10344581 | Not Available | 1326 | Open in IMG/M |
| 3300010354|Ga0129333_11062603 | Not Available | 678 | Open in IMG/M |
| 3300010354|Ga0129333_11139175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 650 | Open in IMG/M |
| 3300010370|Ga0129336_10409639 | Not Available | 740 | Open in IMG/M |
| 3300010370|Ga0129336_10494606 | Not Available | 660 | Open in IMG/M |
| 3300010370|Ga0129336_10740632 | Not Available | 519 | Open in IMG/M |
| 3300010885|Ga0133913_11235650 | Not Available | 1913 | Open in IMG/M |
| 3300012779|Ga0138284_1211561 | Not Available | 697 | Open in IMG/M |
| 3300013005|Ga0164292_10866173 | Not Available | 568 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10590685 | Not Available | 525 | Open in IMG/M |
| 3300013372|Ga0177922_10530554 | Not Available | 519 | Open in IMG/M |
| 3300013372|Ga0177922_10962206 | Not Available | 560 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10164256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1459 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10512335 | Not Available | 669 | Open in IMG/M |
| 3300017722|Ga0181347_1193747 | Not Available | 537 | Open in IMG/M |
| 3300020083|Ga0194111_10318851 | Not Available | 1061 | Open in IMG/M |
| 3300020151|Ga0211736_10063048 | Not Available | 1349 | Open in IMG/M |
| 3300020151|Ga0211736_10880177 | Not Available | 1474 | Open in IMG/M |
| 3300020172|Ga0211729_11348154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 814 | Open in IMG/M |
| 3300020190|Ga0194118_10020450 | Not Available | 5051 | Open in IMG/M |
| 3300020197|Ga0194128_10143256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1376 | Open in IMG/M |
| 3300020200|Ga0194121_10209834 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300020204|Ga0194116_10415039 | Not Available | 660 | Open in IMG/M |
| 3300020204|Ga0194116_10420025 | Not Available | 654 | Open in IMG/M |
| 3300020498|Ga0208050_1018193 | Not Available | 739 | Open in IMG/M |
| 3300020513|Ga0208090_1045790 | Not Available | 563 | Open in IMG/M |
| 3300020515|Ga0208234_1026969 | Not Available | 656 | Open in IMG/M |
| 3300020524|Ga0208858_1020341 | Not Available | 1021 | Open in IMG/M |
| 3300020527|Ga0208232_1034729 | Not Available | 678 | Open in IMG/M |
| 3300020533|Ga0208364_1016875 | Not Available | 1052 | Open in IMG/M |
| 3300020542|Ga0208857_1032449 | Not Available | 835 | Open in IMG/M |
| 3300020554|Ga0208599_1012643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1420 | Open in IMG/M |
| 3300020556|Ga0208486_1003999 | All Organisms → Viruses → Predicted Viral | 2466 | Open in IMG/M |
| 3300020603|Ga0194126_10394184 | Not Available | 885 | Open in IMG/M |
| 3300021091|Ga0194133_10130510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1841 | Open in IMG/M |
| 3300021092|Ga0194122_10125977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1395 | Open in IMG/M |
| 3300021093|Ga0194123_10078702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1989 | Open in IMG/M |
| 3300021961|Ga0222714_10203693 | Not Available | 1141 | Open in IMG/M |
| 3300023174|Ga0214921_10496177 | Not Available | 582 | Open in IMG/M |
| 3300023179|Ga0214923_10576587 | Not Available | 537 | Open in IMG/M |
| 3300024306|Ga0255148_1016287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1451 | Open in IMG/M |
| 3300024306|Ga0255148_1049621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 746 | Open in IMG/M |
| 3300024306|Ga0255148_1051599 | Not Available | 728 | Open in IMG/M |
| 3300024351|Ga0255141_1031736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 792 | Open in IMG/M |
| 3300024352|Ga0255142_1068076 | Not Available | 539 | Open in IMG/M |
| 3300024354|Ga0255171_1018600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1399 | Open in IMG/M |
| 3300024354|Ga0255171_1042339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 869 | Open in IMG/M |
| 3300024484|Ga0256332_1035485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1072 | Open in IMG/M |
| 3300024496|Ga0255151_1063751 | Not Available | 593 | Open in IMG/M |
| 3300024500|Ga0255143_1058726 | Not Available | 624 | Open in IMG/M |
| 3300024503|Ga0255152_1002576 | All Organisms → Viruses → Predicted Viral | 3839 | Open in IMG/M |
| 3300024513|Ga0255144_1003496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2820 | Open in IMG/M |
| 3300024557|Ga0255283_1109827 | Not Available | 590 | Open in IMG/M |
| 3300024864|Ga0255271_1139738 | Not Available | 529 | Open in IMG/M |
| 3300025646|Ga0208161_1110966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 740 | Open in IMG/M |
| 3300026473|Ga0255166_1000041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 106957 | Open in IMG/M |
| 3300026478|Ga0255156_1003784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3193 | Open in IMG/M |
| 3300026478|Ga0255156_1006729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2363 | Open in IMG/M |
| 3300026573|Ga0255269_1018605 | Not Available | 1898 | Open in IMG/M |
| 3300027114|Ga0208009_1082736 | Not Available | 533 | Open in IMG/M |
| 3300027396|Ga0255146_1003015 | Not Available | 3544 | Open in IMG/M |
| 3300027499|Ga0208788_1062833 | Not Available | 955 | Open in IMG/M |
| 3300027508|Ga0255072_1089476 | Not Available | 613 | Open in IMG/M |
| 3300027608|Ga0208974_1127037 | Not Available | 662 | Open in IMG/M |
| 3300027608|Ga0208974_1163969 | Not Available | 556 | Open in IMG/M |
| 3300027644|Ga0209356_1165456 | Not Available | 611 | Open in IMG/M |
| 3300027644|Ga0209356_1201687 | Not Available | 536 | Open in IMG/M |
| 3300027659|Ga0208975_1187340 | Not Available | 559 | Open in IMG/M |
| 3300027697|Ga0209033_1167160 | Not Available | 675 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1049037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2307 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1281444 | Not Available | 572 | Open in IMG/M |
| 3300027763|Ga0209088_10215503 | Not Available | 814 | Open in IMG/M |
| 3300027769|Ga0209770_10180981 | Not Available | 839 | Open in IMG/M |
| 3300027793|Ga0209972_10163134 | Not Available | 1059 | Open in IMG/M |
| 3300027798|Ga0209353_10382611 | Not Available | 581 | Open in IMG/M |
| 3300027805|Ga0209229_10035710 | Not Available | 2189 | Open in IMG/M |
| 3300027892|Ga0209550_10246019 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300027892|Ga0209550_10479256 | Not Available | 752 | Open in IMG/M |
| 3300027974|Ga0209299_1173499 | Not Available | 802 | Open in IMG/M |
| 3300028025|Ga0247723_1000432 | Not Available | 29057 | Open in IMG/M |
| 3300028025|Ga0247723_1160394 | Not Available | 520 | Open in IMG/M |
| 3300028027|Ga0247722_10093476 | Not Available | 1118 | Open in IMG/M |
| 3300028027|Ga0247722_10318026 | Not Available | 530 | Open in IMG/M |
| 3300028103|Ga0255172_1040814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 863 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1103616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1103 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1224995 | Not Available | 675 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1318788 | Not Available | 510 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10671811 | Not Available | 509 | Open in IMG/M |
| 3300029930|Ga0119944_1021850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 864 | Open in IMG/M |
| 3300031566|Ga0307378_10747836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 832 | Open in IMG/M |
| 3300031758|Ga0315907_10370798 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
| 3300031758|Ga0315907_10585779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 868 | Open in IMG/M |
| 3300031758|Ga0315907_11213244 | Not Available | 527 | Open in IMG/M |
| 3300031787|Ga0315900_10526149 | Not Available | 888 | Open in IMG/M |
| 3300031857|Ga0315909_10150573 | Not Available | 1917 | Open in IMG/M |
| 3300031857|Ga0315909_10283401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1250 | Open in IMG/M |
| 3300031951|Ga0315904_10300263 | Not Available | 1505 | Open in IMG/M |
| 3300031951|Ga0315904_11243293 | Not Available | 568 | Open in IMG/M |
| 3300031963|Ga0315901_10180726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1847 | Open in IMG/M |
| 3300032050|Ga0315906_10012919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9627 | Open in IMG/M |
| 3300032050|Ga0315906_10462753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1084 | Open in IMG/M |
| 3300032050|Ga0315906_11077823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frigoribacterium → unclassified Frigoribacterium → Frigoribacterium sp. CG_9.8 | 596 | Open in IMG/M |
| 3300032116|Ga0315903_10415219 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300033992|Ga0334992_0309839 | Not Available | 737 | Open in IMG/M |
| 3300033996|Ga0334979_0186475 | All Organisms → Viruses → Predicted Viral | 1232 | Open in IMG/M |
| 3300034012|Ga0334986_0632164 | Not Available | 505 | Open in IMG/M |
| 3300034022|Ga0335005_0471793 | Not Available | 704 | Open in IMG/M |
| 3300034063|Ga0335000_0692146 | Not Available | 561 | Open in IMG/M |
| 3300034071|Ga0335028_0108908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1806 | Open in IMG/M |
| 3300034071|Ga0335028_0115706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1741 | Open in IMG/M |
| 3300034082|Ga0335020_0011584 | Not Available | 5277 | Open in IMG/M |
| 3300034093|Ga0335012_0371593 | Not Available | 706 | Open in IMG/M |
| 3300034093|Ga0335012_0526794 | Not Available | 556 | Open in IMG/M |
| 3300034095|Ga0335022_0110316 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300034103|Ga0335030_0058130 | Not Available | 2884 | Open in IMG/M |
| 3300034105|Ga0335035_0479455 | Not Available | 685 | Open in IMG/M |
| 3300034116|Ga0335068_0298610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 803 | Open in IMG/M |
| 3300034117|Ga0335033_0085202 | Not Available | 1850 | Open in IMG/M |
| 3300034117|Ga0335033_0347870 | Not Available | 745 | Open in IMG/M |
| 3300034121|Ga0335058_0530149 | Not Available | 665 | Open in IMG/M |
| 3300034283|Ga0335007_0088133 | All Organisms → Viruses → Predicted Viral | 2321 | Open in IMG/M |
| 3300034284|Ga0335013_0550317 | Not Available | 682 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.90% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 12.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.49% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.49% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.05% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.44% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.44% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.83% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.22% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.61% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.61% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.61% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300002350 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_12123843 | 3300002195 | Lake | LEAVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK* |
| B570J29583_10049535 | 3300002350 | Freshwater | MLEAVSAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK* |
| B570J40625_1002470611 | 3300002835 | Freshwater | SDMLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| JGI25930J51415_10419511 | 3300003499 | Freshwater Lake | TAVDAWNKCVDYGFAKEYATYNLSDPTGKMYTKTFYANGKVSIK* |
| Ga0049081_100385016 | 3300005581 | Freshwater Lentic | AVSAWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0049081_103080563 | 3300005581 | Freshwater Lentic | EAVSAWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0049081_103444241 | 3300005581 | Freshwater Lentic | RVSDMLEAVSAWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0049080_103008033 | 3300005582 | Freshwater Lentic | MLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0049080_103057321 | 3300005582 | Freshwater Lentic | DYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0079301_10594801 | 3300006639 | Deep Subsurface | LEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0070749_104119374 | 3300006802 | Aqueous | SDMLEAVDAWYKCVDHGNAKEYATYNLSDPTGKMYTKTFYANGAVAIK* |
| Ga0075460_103175511 | 3300007234 | Aqueous | VNTLRVSDMLEAVDAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIR* |
| Ga0105052_101476781 | 3300007523 | Freshwater | DMLTAAEAWEKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGKVDVR* |
| Ga0099846_10768153 | 3300007542 | Aqueous | MLEAVDAWTKCVDHGNAKEYATYNLSDPTGKMYTKTFYANGAVAIK* |
| Ga0105736_10603764 | 3300007861 | Estuary Water | VSDLLEIVDAWNKCVDYGTAKEYATYNLSDPTGKMFTKTFHRNGTVGVK* |
| Ga0105746_12036443 | 3300007973 | Estuary Water | AWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0105747_11952461 | 3300007974 | Estuary Water | DMLEAVNAWTKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0114340_10003053 | 3300008107 | Freshwater, Plankton | MTAVDAWTKCVDCGDAKEYATYNLSDPTGKMYTKTFYRNGEVVVR* |
| Ga0114341_1000328858 | 3300008108 | Freshwater, Plankton | HTLRVSDLLEVVNAWNNCVDFGDAKEYATYNLSDPTGKVYTKTFYRNGNVSVK* |
| Ga0114341_104702551 | 3300008108 | Freshwater, Plankton | LVNTLRSADLLEIVDAWNKCVDHGDANEHATYNLSDPSGKMFTKIFFRDGEVSVK* |
| Ga0114341_104887401 | 3300008108 | Freshwater, Plankton | HTLRVSDLLEVVNAWNNCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK* |
| Ga0114346_11764823 | 3300008113 | Freshwater, Plankton | EMVDAWNKCVDSGDAKEYATYNLSDPSGKMYTKNFYTNGKVTTR* |
| Ga0114347_10857933 | 3300008114 | Freshwater, Plankton | EAVEAWNKCVDFGDAKEYATYNLSDLTGKMYTKTFYRNGNVSIK* |
| Ga0114350_10359425 | 3300008116 | Freshwater, Plankton | VNTLRVSDLLEAVNAWDKCVDFGDAKEYATYNLSDLTGKMYTKTFYRNGEVVIR* |
| Ga0114350_10472681 | 3300008116 | Freshwater, Plankton | RVSDMLEAVEAWNKCVDFGDAKEYATYNLSDLTGKMYTKTFYRNGNVSIK* |
| Ga0114350_11507682 | 3300008116 | Freshwater, Plankton | MLEAVSAWDKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGQVVIKYALQC* |
| Ga0114354_11040071 | 3300008119 | Freshwater, Plankton | SDMLEAVDAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSVK* |
| Ga0114355_10184921 | 3300008120 | Freshwater, Plankton | RVWELCKDSGNAKEYATYNLTDPAGKMYTKNFYTDGRVSVK* |
| Ga0114355_11531841 | 3300008120 | Freshwater, Plankton | CSDFGDAKEYATYNLSEPNGKMHTKNFYRNGKVSGK* |
| Ga0114355_11670153 | 3300008120 | Freshwater, Plankton | DFGDAKEYATYNLSDPNGKMYTKTFYRNGNVSVK* |
| Ga0114355_12390472 | 3300008120 | Freshwater, Plankton | RLHDFMEAHDAWAKCVDYGNAKVYARYNLTDPTGKMFTKTFYANGEVVIK* |
| Ga0114841_12306541 | 3300008259 | Freshwater, Plankton | VDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0114361_12391161 | 3300008265 | Freshwater, Plankton | LVHTLRVSDMLEAVDAWNKCVDFGDAKEYATYNLSDPTGKMYTKNFYRNGVVSGK* |
| Ga0114363_100054219 | 3300008266 | Freshwater, Plankton | LVNTLRVSDMLEAVDAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRSGEVSIR* |
| Ga0114363_10766034 | 3300008266 | Freshwater, Plankton | MEAHEAWAKCVDYGNAKEYATYNLTDLTGKMYTKTFYSNGEVVIK* |
| Ga0114363_11220274 | 3300008266 | Freshwater, Plankton | RVSDMLEAVNAWSKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK* |
| Ga0102816_12475381 | 3300008999 | Estuarine | NCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK* |
| Ga0114973_100434011 | 3300009068 | Freshwater Lake | NAWTKCVDYGTAKQYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0114978_102871431 | 3300009159 | Freshwater Lake | DYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0129333_1000974123 | 3300010354 | Freshwater To Marine Saline Gradient | SDLLEAVNAWDKCVDFGEAKEYATYNLSDPTGKMYTKTFYRNGEVSIR* |
| Ga0129333_101615756 | 3300010354 | Freshwater To Marine Saline Gradient | SDLLEAVNAWDKCVDFGEAKEYATYNLSDPTGKMYTKTFYRNGNVSVK* |
| Ga0129333_102408875 | 3300010354 | Freshwater To Marine Saline Gradient | VDAWEKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGQVSIK* |
| Ga0129333_103445811 | 3300010354 | Freshwater To Marine Saline Gradient | VSDMLEAVDAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIK* |
| Ga0129333_110626031 | 3300010354 | Freshwater To Marine Saline Gradient | HTLRVSDMLEAVSAWDKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSVR* |
| Ga0129333_111391751 | 3300010354 | Freshwater To Marine Saline Gradient | LEIVNAWNKCVDFGDAKEYATYNLSDPSGKMYTKNFHRNGVVNGK* |
| Ga0129336_104096391 | 3300010370 | Freshwater To Marine Saline Gradient | KCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVVIR* |
| Ga0129336_104946063 | 3300010370 | Freshwater To Marine Saline Gradient | AWTKCVDFGDAKEYATYNLSEPTGKMYTKTFYRNGEVSVR* |
| Ga0129336_107406321 | 3300010370 | Freshwater To Marine Saline Gradient | LVNTLRVSDLLTAVDTWAKCVDCGDAKEYATYNLTDLTGKMYTKTFYRNGEVSIR* |
| Ga0133913_112356506 | 3300010885 | Freshwater Lake | LKVSDLLEIVNAWNLCVDYGTAKEYATYNLSDPTGKMFTKTFHRNGTVGVK* |
| Ga0138284_12115611 | 3300012779 | Freshwater Lake | LIHTLRVSDMLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| Ga0164292_108661733 | 3300013005 | Freshwater | LRVSDMLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| (restricted) Ga0172369_105906853 | 3300013125 | Freshwater | RVSDTLEAVEAWNKCVDYGTAKEYATYNLSNPMGKMYTKTFYTNGKVVTK* |
| Ga0177922_105305541 | 3300013372 | Freshwater | EAWAKCSDHGNAKEYATYNLTDPTGKMFTKNFYSDGRVSVK* |
| Ga0177922_109622063 | 3300013372 | Freshwater | DAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK* |
| (restricted) Ga0172376_101642561 | 3300014720 | Freshwater | HRISDFMEAHEAWAKCVDHGNAKEYATYNLTDLTGKMYTKNFYANGAVVIK* |
| (restricted) Ga0172376_105123353 | 3300014720 | Freshwater | CVDHGNAKEYATYNLTDLTGKMYTKNFYVDGRVSIK* |
| Ga0181347_11937471 | 3300017722 | Freshwater Lake | AWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGNVVIK |
| Ga0194111_103188513 | 3300020083 | Freshwater Lake | DLIAIIDAWNKCVDHGNAKEYAVYNLSDPLGKVYTKICYASGVKHEATSWTK |
| Ga0211736_100630484 | 3300020151 | Freshwater | VSTTRSADMLEIVTAWNKCVDFGDAKEYATYNLSDPIGKMYTKTFYRNGEVTLR |
| Ga0211736_108801776 | 3300020151 | Freshwater | CVDFGDAKEYATYNLSDPMGKMYTKTFYRNGNVSIK |
| Ga0211729_113481541 | 3300020172 | Freshwater | IDASEVWNSISDHGNAKEYATYNLTDPTGKMFTKNFYSDGRVSVK |
| Ga0194118_1002045011 | 3300020190 | Freshwater Lake | DKCVDHGNAKEYATYNLSDPIGKMYTKTFFADGRVQVK |
| Ga0194128_101432561 | 3300020197 | Freshwater Lake | AWNKCVDYGTAKEYATYNLSNPMGKMYTKTFYRNGKVVIK |
| Ga0194121_102098341 | 3300020200 | Freshwater Lake | SDLLEAVKAWDKCVDHGNAKEYATYNLSDPMGKMYTKTFYANGNVLVK |
| Ga0194116_104150391 | 3300020204 | Freshwater Lake | TDAANLWALCKDSGDAKEYATYNLTDLSGKMYTKNFYADGRVKVK |
| Ga0194116_104200251 | 3300020204 | Freshwater Lake | TDAANLWALCKDSGDAKEYATYNLTDLSGKMYTKNFYADGRVSIK |
| Ga0208050_10181933 | 3300020498 | Freshwater | VDYGTAKEYATYNLSDPIGKMYTKTFYTNGEVVIK |
| Ga0208090_10457901 | 3300020513 | Freshwater | HTLRVSDMLEAVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0208234_10269693 | 3300020515 | Freshwater | VDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0208858_10203414 | 3300020524 | Freshwater | WDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0208232_10347291 | 3300020527 | Freshwater | LRVSDMLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0208364_10168751 | 3300020533 | Freshwater | SDMLEAVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0208857_10324491 | 3300020542 | Freshwater | AWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0208599_10126434 | 3300020554 | Freshwater | DMLEAVDAWNKCVDFGDAKEYATYNLSDPTGKMYTKNFYRNGVVSGK |
| Ga0208486_10039996 | 3300020556 | Freshwater | VSDMLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0194126_103941844 | 3300020603 | Freshwater Lake | NKCVDYGTAKEYATYNLSNPMGKMYTKTFYRNGKVVIK |
| Ga0194133_101305101 | 3300021091 | Freshwater Lake | VNTLRVSDLLEAVKAWDKCIDHGNAKEYATYNLSDPIGKMYTKTFFADGRVQVK |
| Ga0194122_101259771 | 3300021092 | Freshwater Lake | AANLWALCKDSGDAKEYATYNLTDLSGKMYTKNFYADGRVSVK |
| Ga0194123_100787025 | 3300021093 | Freshwater Lake | LEAVKAWDKCIDHGNAKEYATYNLSDPIGKMYTKTFFADGRVSVK |
| Ga0222714_102036934 | 3300021961 | Estuarine Water | AVSAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSIK |
| Ga0214921_104961773 | 3300023174 | Freshwater | MRTADLMEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0214923_105765872 | 3300023179 | Freshwater | LEAVNAWTKCVDFGDAKEYATYNLSDPMGKMYTKTFYRNGNVSIK |
| Ga0255148_10162871 | 3300024306 | Freshwater | MLEAVDVWNKCVDHGFAKEYATYNLSDPIGKMYTKTFYANGEVSVK |
| Ga0255148_10496213 | 3300024306 | Freshwater | WTKCVDYGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIR |
| Ga0255148_10515991 | 3300024306 | Freshwater | MLTAVNAWDKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIR |
| Ga0255141_10317361 | 3300024351 | Freshwater | CVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSTK |
| Ga0255142_10680761 | 3300024352 | Freshwater | KCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIR |
| Ga0255171_10186004 | 3300024354 | Freshwater | ISDFMEAHEAWAKCVDHGNAKEYATYNLTDLTGKMYTKTFYANGKVTIR |
| Ga0255171_10423393 | 3300024354 | Freshwater | WDKCVDYGDAKEYATYNLSDPTGKMYTKTFYRNGEVSTK |
| Ga0256332_10354851 | 3300024484 | Freshwater | WNKCVDHGFAKEYATYNLSDPIGKMYTKTFYRNGEVSVK |
| Ga0255151_10637511 | 3300024496 | Freshwater | KTADMLEAVDVWNKCVDHGFAKEYATYNLSDPIGKMYTKTFYANGEVSVK |
| Ga0255143_10587263 | 3300024500 | Freshwater | VNTLRVSDMLTAVDAWDKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIR |
| Ga0255152_100257610 | 3300024503 | Freshwater | VDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIR |
| Ga0255144_10034961 | 3300024513 | Freshwater | EAVSAWDKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIR |
| Ga0255283_11098273 | 3300024557 | Freshwater | ELVSTTRSADLLEIVNAWNKCVDFGDAKEYATYNLSDPNGKMYTKNFYRNGQVSGK |
| Ga0255271_11397382 | 3300024864 | Freshwater | NAWNKCVDFGDAKEYATYNLSDPNGKMYTKNFYRNGQVSGK |
| Ga0208161_11109664 | 3300025646 | Aqueous | RVSDMLEAVDAWTKCVDHGNAKEYATYNLSDPTGKMYTKTFYRNGEVSIR |
| Ga0255166_1000041170 | 3300026473 | Freshwater | HEAWAKCVDHGNAKEYATYNLTDLTGKMYTKTFYANGKVTIR |
| Ga0255156_10037849 | 3300026478 | Freshwater | MLDAVNVWDKCVDYGDAKEYATYNLSDPTGKMYTKTFYRNGEVSTK |
| Ga0255156_10067295 | 3300026478 | Freshwater | YADFKTADMLEAVDVWNKCVDHGFAKEYATYNLSDPIGKMYTKTFYANGEVSVK |
| Ga0255269_10186054 | 3300026573 | Freshwater | LVSTTRSADLLEIVNAWNKCVDYGDAKEYATYNLSDPNGKMYTKNFYRNGQVSGK |
| Ga0208009_10827361 | 3300027114 | Deep Subsurface | AVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0255146_10030151 | 3300027396 | Freshwater | EIVNAWNKCVDYGDAKEYATYNLSDPMGKMYTKNFYRNGEVNGK |
| Ga0208788_10628334 | 3300027499 | Deep Subsurface | EAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0255072_10894761 | 3300027508 | Freshwater | WNKCVDYGTAKEYATYNLSDPMGKMYTKTFYSNGNVSVK |
| Ga0208974_11270374 | 3300027608 | Freshwater Lentic | VSDMLEAVNAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYADGNVVIK |
| Ga0208974_11639691 | 3300027608 | Freshwater Lentic | RLSDFLEAHEAWAKCSDHGNAKEYATYNLTDPTGKMFTKNFYSDGRVSIK |
| Ga0209356_11654561 | 3300027644 | Freshwater Lake | CVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0209356_12016872 | 3300027644 | Freshwater Lake | TLRVSDMLTAVDAWNKCVDYGFAKEYATYNLSDPTGKMYTKTFYANGKVSIK |
| Ga0208975_11873403 | 3300027659 | Freshwater Lentic | DKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0209033_11671603 | 3300027697 | Freshwater Lake | AVDAWNKCVDYGFAKEYATYNLSDPTGKMYTKTFYANGKVSIK |
| (restricted) Ga0247833_10490376 | 3300027730 | Freshwater | AWAKCSDHGNAKEYATYNLTDPTGKMYTKNFYANGKMSVK |
| (restricted) Ga0247833_12814441 | 3300027730 | Freshwater | VDFGDAKEYATYNLSDPMGKMYTKTFYRNGNVSVK |
| Ga0209088_102155031 | 3300027763 | Freshwater Lake | RVSNLLEIVNAWNLCVDHGTAKEYATYNLSDPTGKMFTKTFHRNGTVGVK |
| Ga0209770_101809814 | 3300027769 | Freshwater Lake | SDLLEVVNAWNNCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0209972_101631341 | 3300027793 | Freshwater Lake | INTLRVSDMLTAVDAWNKCVDYGFAKEYATYNLSDPTGKMYTKTFYANGEVSIK |
| Ga0209353_103826111 | 3300027798 | Freshwater Lake | CVDYGFAKEYATYNLSDLTGKMYTKTFYTNGKVVIK |
| Ga0209229_100357107 | 3300027805 | Freshwater And Sediment | LEIVNAWNKCVDFGDAKEYATYNMSDPMGKMYTKTFYRNGEVSVK |
| Ga0209550_102460191 | 3300027892 | Freshwater Lake | SAWNKCVDFGDAKEYATYNLSDPIGKMYTKTFYRNGNVSVK |
| Ga0209550_104792564 | 3300027892 | Freshwater Lake | LLEVVNAWNNCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0209299_11734994 | 3300027974 | Freshwater Lake | VDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0247723_100043268 | 3300028025 | Deep Subsurface Sediment | RVSDMLEAVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0247723_11603941 | 3300028025 | Deep Subsurface Sediment | SDMLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0247722_100934761 | 3300028027 | Deep Subsurface Sediment | TLRVSDLLEIVGAWNNCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0247722_103180261 | 3300028027 | Deep Subsurface Sediment | LVNTLRVSDMLEAVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGKVSVK |
| Ga0255172_10408141 | 3300028103 | Freshwater | TAVDAWEKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGEVSIR |
| (restricted) Ga0247835_11036161 | 3300028114 | Freshwater | CSDHGNAKEYATYNLTDPTGKMYTKNFYANGKMSVK |
| (restricted) Ga0247831_12249951 | 3300028559 | Freshwater | AVNAWTKCVDFGDAKEYATYNLSDPMGKMYTKTFYRNGNVSVK |
| (restricted) Ga0247831_13187882 | 3300028559 | Freshwater | ELVHTLRISDMLEAVSAWDKCVDYGTAKEYATYNLSDLTGKMYTKTFYTNGEVVIK |
| (restricted) Ga0247842_106718112 | 3300029268 | Freshwater | DFLEAHEAWAKCSDHGNAKEYATYNLTDPTGKMYTKNFYANGKVSVK |
| Ga0119944_10218501 | 3300029930 | Aquatic | LFSTLRLNDFAEASEAWAKCSDHGNAKEYATYNLTDPTGKMFTKNFYSDGRVSVK |
| Ga0307378_107478361 | 3300031566 | Soil | EAWAKCSDHGNAKEYATYNLTDPTGKMFTKNFYANGKVSVK |
| Ga0315907_103707981 | 3300031758 | Freshwater | VDFGDAKEYATYNLSDPIGKMYTKTFYRNGKVSVK |
| Ga0315907_105857791 | 3300031758 | Freshwater | RVWELCKDSGNAKEYATYNLTDPTGKMYTKNFYVDGKVTIK |
| Ga0315907_112132442 | 3300031758 | Freshwater | RLHDFMEAHDAWAKCVDYGNAKVYARYNLTDPTCKMYTKTFYANGEVVIK |
| Ga0315900_105261491 | 3300031787 | Freshwater | LRVSDMLEAVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0315909_101505736 | 3300031857 | Freshwater | VDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0315909_102834011 | 3300031857 | Freshwater | WNSISDHGNAKEYATYNLTDPTGKMFTKNFYSDGRVSVK |
| Ga0315904_103002633 | 3300031951 | Freshwater | TRSADLLEIVNAWNKCVDYGDAKEYATYNLSDPNGKMYTKNFYRNGQVSGK |
| Ga0315904_112432931 | 3300031951 | Freshwater | WNKCVDHGFAKEYATYNLSDPIGKMYTKTFYRNGEVSIK |
| Ga0315901_101807265 | 3300031963 | Freshwater | AVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGNVSVK |
| Ga0315906_100129191 | 3300032050 | Freshwater | LFSSMRTADLMEAINVWNKCVDFGDAKEYATYNLSDPNGKMYTKTFYRNGNVSVK |
| Ga0315906_104627531 | 3300032050 | Freshwater | RITDFTDAARVWELCKDSGNAKEYATYNLTDPAGKMYTKNFYTDGRVSVK |
| Ga0315906_110778231 | 3300032050 | Freshwater | EAHDAWAKCKDYGNAKVYARYNLTDPTGKMFTKTFYVDGEVVIK |
| Ga0315903_104152191 | 3300032116 | Freshwater | VNAWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0334992_0309839_20_160 | 3300033992 | Freshwater | MLEAVDAWTKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0334979_0186475_3_140 | 3300033996 | Freshwater | LEAVSAWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0334986_0632164_368_505 | 3300034012 | Freshwater | LEAVNAWTKCVDFGDAKEYATYNLSDPTGKMYTKTFYRNGKVSVK |
| Ga0335005_0471793_583_702 | 3300034022 | Freshwater | WNKCVDYGHAEQYATYNLSDPTGKMYTKTFYRNGEVTVK |
| Ga0335000_0692146_107_247 | 3300034063 | Freshwater | MMEAVDAWNKCVDYGNAKDYATYNLSDPTGKMYTKTFYANGEVVIK |
| Ga0335028_0108908_1662_1799 | 3300034071 | Freshwater | MEAVDVWNKCVDFGDAKEYATYNLSDPNGKMYTKTFYRSGMVSVK |
| Ga0335028_0115706_2_118 | 3300034071 | Freshwater | NKCVDFGDAKEYATYNLSDPMGKMYTKNFYRNGEVNGK |
| Ga0335020_0011584_3_143 | 3300034082 | Freshwater | MLEIVNAWNKCVDYGTAKEYATYNLSDPMGKMYTKTFYRNGKVAVK |
| Ga0335012_0371593_578_706 | 3300034093 | Freshwater | VSAWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0335012_0526794_441_554 | 3300034093 | Freshwater | KCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0335022_0110316_1_123 | 3300034095 | Freshwater | AWNLCVDHGTAKEYATYNLSDPTGKMFTKTFHRNGTVGVK |
| Ga0335030_0058130_2682_2822 | 3300034103 | Freshwater | MLEAVDAWTKCVDYGTAKEYATYNLSDPIGKMYTKTFYTNGEVVIK |
| Ga0335035_0479455_576_683 | 3300034105 | Freshwater | VDHGTAKEYATYNLSDPTGKMFTKTFHRNGTVGVK |
| Ga0335068_0298610_638_802 | 3300034116 | Freshwater | YNTHRIADFTDAARVWELCKDSGNAKEYATYNLTDPSGKMYTKNFYTDGRVSVK |
| Ga0335033_0085202_1733_1849 | 3300034117 | Freshwater | TKCVDYGTAKEYATYNLSDPTGKMYTKTFYTNGEVVIK |
| Ga0335033_0347870_2_139 | 3300034117 | Freshwater | LEIVNAWNLCVDHGTAKEYATYNLSDPTGKMFTKTFHRNGTVGVK |
| Ga0335058_0530149_1_108 | 3300034121 | Freshwater | VDFGDAKEYATYNLSDPMGKMYTKTFYRNGKVAVK |
| Ga0335007_0088133_2_121 | 3300034283 | Freshwater | WNKCIDHGDANEHATYNLSDPNGKMFTKIFFRDGEVSVK |
| Ga0335013_0550317_527_682 | 3300034284 | Freshwater | LKVADLLEIVNAWNNCVDYGTAKEYATYNLSDPTGKMFTKTFNRNGSVGIK |
| ⦗Top⦘ |