| Basic Information | |
|---|---|
| Family ID | F038904 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKSRRKKMIDKMKSKAMHYWSDHKIECLVVAVLVVAYIVK |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.24 % |
| % of genes near scaffold ends (potentially truncated) | 95.76 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (41.212 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.394 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.303 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 0.61 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.00 % |
| All Organisms | root | All Organisms | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 41.21% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.91% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.09% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.88% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 6.06% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.42% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.42% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.21% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.21% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.21% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.21% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.21% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.21% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.21% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.21% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.21% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.21% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.21% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.61% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.61% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.61% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.61% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.61% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.61% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.61% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000167 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120m | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300024230 | Seawater microbial communities from Monterey Bay, California, United States - 48D | Environmental | Open in IMG/M |
| 3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
| 3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025026 | Marine viral communities from the Pacific Ocean - LP-24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026125 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028127 | Seawater microbial communities from Monterey Bay, California, United States - 49D | Environmental | Open in IMG/M |
| 3300028280 | Seawater microbial communities from Monterey Bay, California, United States - 58D | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102440813 | 3300000101 | Marine | PTSSSMKSRRKKMIKKIKSKAMHYWSDHKIECLVFVILVIAYITK* |
| DelMOSpr2010_100966661 | 3300000116 | Marine | SMKSRRKKMIKKMKSKAMHYWSDHKIECLVVAVLVIAYIVK* |
| SI39nov09_120mDRAFT_10916851 | 3300000167 | Marine | GGQKIPTSSSMKSRRKKMIDKLKSKAMHYWSYHKIECLVVAVLVIAYIVK* |
| BBAY94_101547461 | 3300000949 | Macroalgal Surface | KKMINKMKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| JGI20155J14468_100911371 | 3300001354 | Pelagic Marine | KIRISSSMKLRRKKMIDKLKSKAVHYWSDHKIECLVVAVLVIAYIVK* |
| JGI20155J14468_101911553 | 3300001354 | Pelagic Marine | GLGVPKTQTSSSMKSRRKKMINKMKSKAMHYWSDHKVECLVVAVLIIAYIVK* |
| JGI20158J14315_101151011 | 3300001355 | Pelagic Marine | SSSMKSRRKKMIDKMKSKAMHYWSDHKIECLVVAVLIVAYIVK* |
| JGI24006J15134_100524301 | 3300001450 | Marine | LGVQKTPTSSSMKSRRKKMIDKIKSKAMHYWSEHKIECLVVAIIVVAYIIK* |
| JGI24003J15210_1000550918 | 3300001460 | Marine | MKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLVIAYIVK* |
| JGI24004J15324_101630352 | 3300001472 | Marine | GLGVLKTLTSSSMKLRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| JGI24523J20078_10354663 | 3300001718 | Marine | KMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| JGI25127J35165_10291921 | 3300002482 | Marine | MKSRRKKMISKLKSKAMHYWSDHKIECLVFAVLIVAYIVK* |
| JGI25127J35165_10924152 | 3300002482 | Marine | HGGQKIPTSSSMKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLVIAYIVK* |
| JGI25127J35165_11226011 | 3300002482 | Marine | KTPTISFTKSRRKKMIDKIKSKAKHYWMNHKVESIVFVVLVIALIIK* |
| JGI25128J35275_11156441 | 3300002488 | Marine | SSMKLRRKKMISKMKSKAMHYWSDHKIECLVVVVLVVAYILK* |
| Ga0065861_10073673 | 3300004448 | Marine | TSFSMKLRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0075478_100921453 | 3300006026 | Aqueous | RKKMIKKMKSKAMHYWSDHKIECLVVAVLVIAYIVK* |
| Ga0075478_102625731 | 3300006026 | Aqueous | SFSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0098038_10891221 | 3300006735 | Marine | MKSRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYILK* |
| Ga0098038_11285834 | 3300006735 | Marine | RRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK* |
| Ga0098038_12508481 | 3300006735 | Marine | TSSSMKSRRKKMINKIKSKAMHYWSEHKIECLVVIVLIVAYILK* |
| Ga0098042_10191481 | 3300006749 | Marine | KKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK* |
| Ga0098042_10786011 | 3300006749 | Marine | SSSMKSRRKKMIDKIKSKATHYWSEHKIECLVVAVLVIAYIVK* |
| Ga0098048_12218011 | 3300006752 | Marine | KKMINKMKSKAMHYWSDHKIECLVFVVLIVAYVLK* |
| Ga0098055_11782381 | 3300006793 | Marine | KIPTSSSMKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVLVIAYIVK* |
| Ga0070750_103271611 | 3300006916 | Aqueous | RIRFSMKSRGKKMINKIKSKAIHYWTDHKIECLVVAILVVAYIVK* |
| Ga0070748_11722591 | 3300006920 | Aqueous | KMISKLKNKAMHYWSDLKIECLVFAVLVVAYIIK* |
| Ga0098060_11112553 | 3300006921 | Marine | KIQTSFSMKSRRKKMINKMKSKAMHYWHNHKIETLVFIVLVVALIIK* |
| Ga0098060_11984993 | 3300006921 | Marine | RRKKMIDKIKSKATHYWSEHKIECLVVAVLVIAYIVK* |
| Ga0098045_10538311 | 3300006922 | Marine | KKMINKMKSKAMHYWSDHKIECLVFVVLVIAYIVK* |
| Ga0098045_11232702 | 3300006922 | Marine | SSMKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVLVIAYIVK* |
| Ga0098051_10974941 | 3300006924 | Marine | MKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVLVIAYIVK* |
| Ga0098050_11277742 | 3300006925 | Marine | SSSMKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVIVIAYIVK* |
| Ga0098036_10651554 | 3300006929 | Marine | MKLRRKKMINKMKSKAMHYWSDHKIECLVFVVLVIAYIVK* |
| Ga0098036_11364743 | 3300006929 | Marine | SMKSRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYILK* |
| Ga0098036_12248282 | 3300006929 | Marine | VQKIQTSSSMKSRRKKMISKMKSKAMHYWSDHKIECLVVVVLIVAYILK* |
| Ga0098036_12580691 | 3300006929 | Marine | QTSSSMKSRRKKMIDKLKSKAMHYWSDHKIECLVVAVLVIAYIVK* |
| Ga0098046_11099601 | 3300006990 | Marine | KMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK* |
| Ga0075468_102249823 | 3300007229 | Aqueous | SMKLRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0070753_11489391 | 3300007346 | Aqueous | RRKKMINKMKSKAMHYWSDHKIECLVVAVLIVAYLVK* |
| Ga0070751_13131151 | 3300007640 | Aqueous | EKNMIDKLKTKAMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0102855_10458121 | 3300007647 | Estuarine | KTPTSSSMKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLIIAYIVK* |
| Ga0102954_12225422 | 3300007778 | Water | SMKSRRRKMINKMKSKAMHYWSDHKIECLVVAVLIVAYIVK* |
| Ga0110931_11189543 | 3300007963 | Marine | GVQKIQTSSSMKSRRKKMISKMKSKAMHYWSDHKIECLVVVVLIVAYILK* |
| Ga0110931_12345902 | 3300007963 | Marine | SMKLRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYILK* |
| Ga0105748_101943663 | 3300007992 | Estuary Water | SSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAVLVIAYIVK* |
| Ga0102960_12532632 | 3300009000 | Pond Water | SMKSRRKKMINKMKSKAMHYWSDHKIECLVVAILIVAYIVK* |
| Ga0102960_13413961 | 3300009000 | Pond Water | SMKLRRKKMINKIKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0115549_10317771 | 3300009074 | Pelagic Marine | EINMIDKIKSKIAHYWSDHKVECLVVAVLIIAYIVK* |
| Ga0114909_10381154 | 3300009414 | Deep Ocean | MGGNMINKIKSKAMHYWSDHKVECLVVAVLIIAYIVK* |
| Ga0114909_10588681 | 3300009414 | Deep Ocean | SSSMKSRRKKMINKMKSKVMHYWSDHKIECLVVVVLVIAYIVK* |
| Ga0115545_10069201 | 3300009433 | Pelagic Marine | RRKKMINKMKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0115562_12331011 | 3300009434 | Pelagic Marine | RKKMIDKMKSKAMHYWSDHKVECLVVAVLIIAYIIK* |
| Ga0115561_13567361 | 3300009440 | Pelagic Marine | SSSMKSRRKKMIDKMKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0115563_12818991 | 3300009442 | Pelagic Marine | INMIDKIKSKIAHYWSDHKIECLVVAVLIVAYIVK* |
| Ga0115568_104941362 | 3300009498 | Pelagic Marine | SMKSRRKKMIDKMKSKAMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0114919_101799624 | 3300009529 | Deep Subsurface | GVQKIRISFSMKSRRKKMINKIKSKAMHYWSDHKIECLVVAVLIVAYIVK* |
| Ga0098043_11380911 | 3300010148 | Marine | PGGQRIPTSSSMKLRRKKMIDKMKRKAMHYWADHKVECLVFIVLVIALIIK* |
| Ga0098043_11409851 | 3300010148 | Marine | KIQTSSSMKLRRKKMINKIKSKAMHYWSEHKIECLVVVVLIIAYVLK* |
| Ga0098043_11626981 | 3300010148 | Marine | PTSFSMKSRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK* |
| Ga0098049_11314671 | 3300010149 | Marine | KIPTSSSMKSRRKKMIDKIKSKATHYWSEHKIECLVVVVLVIAYIVK* |
| Ga0098049_11818372 | 3300010149 | Marine | TSSSMKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVLVIAYIVK* |
| Ga0098049_12591792 | 3300010149 | Marine | RRKKMINKMKSKAMHYWSDHKIECLVVAVLIVAYIVK* |
| Ga0098056_11103644 | 3300010150 | Marine | KIQTSSSMKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVLVIAYIVK* |
| Ga0098059_10905704 | 3300010153 | Marine | RRKKMINKMKSKAMHYWSDHKIECLVFVVLVIAYIVK* |
| Ga0098059_12311551 | 3300010153 | Marine | RRKKMINKMKSKVMHYWSDHKIECLVVAILVVAYIVK* |
| Ga0151675_10107623 | 3300011254 | Marine | RRKKMIDKMKSKAMHYWSDHKIECLVFVVLVIAYIVK* |
| Ga0160423_111811932 | 3300012920 | Surface Seawater | RRKKMINKMKSKAMHYWSDHKVECIVFVVLIVAYIVK* |
| Ga0129327_104122903 | 3300013010 | Freshwater To Marine Saline Gradient | WRRKKMIKKIKSKVMHYWSDHKIECLVVAVLVVAYIIK* |
| Ga0129327_105201983 | 3300013010 | Freshwater To Marine Saline Gradient | SMKSRRKKMINKLKSKAMHYWSDHKIECLVVAVLVVAYIVK* |
| Ga0164313_115471081 | 3300013101 | Marine Sediment | RKKMINKIKSKAMHYWSDHKIECLVVVVLIVAYVLK* |
| Ga0181369_10521904 | 3300017708 | Marine | KLRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYILK |
| Ga0181403_10712811 | 3300017710 | Seawater | KKMINKLKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0181398_11490891 | 3300017725 | Seawater | EHGGQKIPTSSSMKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLVIAYIVK |
| Ga0181419_10782631 | 3300017728 | Seawater | SRRKKMIDKLKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0181416_11278961 | 3300017731 | Seawater | TSSSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIIK |
| Ga0187222_10706463 | 3300017734 | Seawater | SMKSRRKKMINKMKSKAMHYWSDNKIECLVVVVLVIAYIVK |
| Ga0181431_10889743 | 3300017735 | Seawater | GLGVPKTPTSSSMKSRRKKMINKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0181382_11106183 | 3300017756 | Seawater | GVQKITTSFSMKSRRKKMINKIKNKAMHYWSNHKVESIVFVILVIALIIK |
| Ga0181409_10757504 | 3300017758 | Seawater | IPTSSSMKSRRKKMIDKIKSKAMHYWSEHKIECFVVVALIIAYIVK |
| Ga0181414_11014671 | 3300017759 | Seawater | SSSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0181414_12108071 | 3300017759 | Seawater | KIPTSSSMKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLVIAYIVK |
| Ga0181406_12129432 | 3300017767 | Seawater | LGVQKIQTSSSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIIK |
| Ga0181394_12440812 | 3300017776 | Seawater | SRRKKMIDKLKSKAMHYWSDHKIECLVFVILVVAYITK |
| Ga0181394_12624701 | 3300017776 | Seawater | QKIRISSSMKLRRKKMIKKIKDKAMHYWSNHKVESIVFVVLVVAYIVK |
| Ga0181395_12004252 | 3300017779 | Seawater | RRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIIK |
| Ga0181423_10935971 | 3300017781 | Seawater | LGVQKIQTSFSMKSRKKKMINKMKSKVMHYWSDHKIECLVVVVLVIAYIVK |
| Ga0181552_105281181 | 3300017824 | Salt Marsh | RKKMINKIKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0181607_101913844 | 3300017950 | Salt Marsh | TSSSMKLRRKKMINKMKSKAMHYWSDHKVECLVFAVLIIAYIVK |
| Ga0194014_10252963 | 3300019732 | Sediment | ISFSMKSRRKKMIDKMKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0211512_105106841 | 3300020419 | Marine | KLRRKKMISKMKSKAMHYWSDHKIECLVFAVLVVAYIIK |
| Ga0213867_11032261 | 3300021335 | Seawater | RKKMINKIKSKAMHYWSDHKIECLVFAVLVIAYIVK |
| Ga0213869_102940913 | 3300021375 | Seawater | TPTSSSMKSRRKKMINKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0222719_106619122 | 3300021964 | Estuarine Water | RKKMINKMKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0196895_10071841 | 3300022067 | Aqueous | KRKKMIKKMKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0212020_10472883 | 3300022167 | Aqueous | KSRRKKMINKIKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0224506_101356981 | 3300022221 | Sediment | QKKPTSSSMKSRRKKMIDKLKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0228638_10974351 | 3300024230 | Seawater | EHGGQKIPTSSSMKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0228630_10857863 | 3300024292 | Seawater | SSMKSRRKKMINKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0228651_10453054 | 3300024293 | Seawater | SSSMKSRRKKMINKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0228658_11732121 | 3300024297 | Seawater | LRRKKMINKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0209986_105062732 | 3300024433 | Deep Subsurface | MKSRRKKMIDKMKSKAMHYWSDHKIECLVVAVLVVAYIVK |
| (restricted) Ga0255048_100903035 | 3300024518 | Seawater | FYEIEEKKMIDKMKSKAMHYWSDHKVECLVVAVLIIAYILK |
| Ga0207879_1040031 | 3300025026 | Marine | SFSMKLRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0208667_10559303 | 3300025070 | Marine | EEKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK |
| Ga0208791_10493471 | 3300025083 | Marine | KIQTSSSMKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVLVIAYIVK |
| Ga0208298_11024501 | 3300025084 | Marine | IQTSSSMKSRRKKMISKMKSKAMHYWSDHKIECLVVAVLVVAYVLK |
| Ga0208792_10757982 | 3300025085 | Marine | SSMKLRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK |
| Ga0208157_10428255 | 3300025086 | Marine | MKLRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK |
| Ga0208157_10942361 | 3300025086 | Marine | RKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYILK |
| Ga0208669_10541291 | 3300025099 | Marine | GVKKIQTSFSMKSRRKKMINKMKSKAMHYWHNHKIETLVFIVLVVALIIK |
| Ga0208669_11149953 | 3300025099 | Marine | SSMKSRRKKMIDKIKSKATHYWSEHKIECLVVAVLVIAYIVK |
| Ga0208666_10552784 | 3300025102 | Marine | MKSRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYILK |
| Ga0208666_10578183 | 3300025102 | Marine | QKIQTSSSMKSRRKKMINKMKSKVMHYWLDHKIECLVVVVLVIAYIVK |
| Ga0208013_10850683 | 3300025103 | Marine | MKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVLVIAYIVK |
| Ga0208158_10291221 | 3300025110 | Marine | RRKKMIDKIKSKATHYWSEHKIECLVVVVLIIAYIIK |
| Ga0208158_10437981 | 3300025110 | Marine | SMKLRRKKMIDKMKSKAMHYWSDHKVECLVVAVLIIAYILK |
| Ga0208158_11599771 | 3300025110 | Marine | RRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYILK |
| Ga0208158_11627191 | 3300025110 | Marine | KKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK |
| Ga0209349_11663202 | 3300025112 | Marine | EHGGQKIPTSSSMKSRRKKMIDKMKSKAMHYWSDHKIECLVFVVLIVAYVLK |
| Ga0209535_11773373 | 3300025120 | Marine | TSSSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0209348_10963891 | 3300025127 | Marine | SMKLRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK |
| Ga0208919_10552501 | 3300025128 | Marine | SMKSRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYILK |
| Ga0208919_11490403 | 3300025128 | Marine | RGEKKMINKMKSKAMHYWSDHKIECLVFVVLIVAYVLK |
| Ga0208919_11779812 | 3300025128 | Marine | FSMKSRRKKMIDKIKSKAKHYWSEHKIECLVVAVLVVAYIVK |
| Ga0208919_12188081 | 3300025128 | Marine | QTSSSMKSRRKKMIDKLKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0209128_11701692 | 3300025131 | Marine | KLRRKKMINKMKSKAMHYWSDHKIECLVVVVLIVAYVLK |
| Ga0209232_10787224 | 3300025132 | Marine | RKKMINKLKSKAMHYWSDHKIECLVFAVLVVALIIK |
| Ga0209232_11397951 | 3300025132 | Marine | RKKMINKLKSKAMHYWSDHKIECLVFAVLVVALIVK |
| Ga0209232_12375021 | 3300025132 | Marine | RKKMISKIKSKAMHYWSDHKIECLVVVVLVVAYVLK |
| Ga0209634_13202332 | 3300025138 | Marine | TSSSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0209756_12544611 | 3300025141 | Marine | KIQTSSSMKLRRKKMISKMKSKAMHYWSDHKIECLVVVALVVAYILK |
| Ga0209756_13328211 | 3300025141 | Marine | QTSFSMKLRRKKMISKMKSKAMHYWSDHKIECLVVVVLVVAYILK |
| Ga0208303_100915910 | 3300025543 | Aqueous | MINKMKSKAMHYWSDHKVECLVVAVLIIAYLLILKEM |
| Ga0208303_10122281 | 3300025543 | Aqueous | KLRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0209195_11207011 | 3300025590 | Pelagic Marine | RKKMIDKMKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0209094_10475961 | 3300025594 | Pelagic Marine | KKMIDKMKSKAMHYWSDHKIECLVVAVLIVAYIVK |
| Ga0208149_10309955 | 3300025610 | Aqueous | MKSRRKKMIKKMKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0209716_10556235 | 3300025626 | Pelagic Marine | SMKSRRKKMIDKMKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0208134_101191714 | 3300025652 | Aqueous | SFSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0208795_10918451 | 3300025655 | Aqueous | ISFSMKSRRKKMIKKMKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0209601_11734541 | 3300025666 | Pelagic Marine | MKSRRKKMIKKMKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0208898_11660781 | 3300025671 | Aqueous | RKKKMIKKMKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0208162_11398081 | 3300025674 | Aqueous | KLRRKKMINKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0209657_12105941 | 3300025676 | Marine | KKMIEKMKSKAMHYWSDHKIECLVFVILVVAYITK |
| Ga0209095_11634273 | 3300025685 | Pelagic Marine | VQKIPTSSSMKSRRKKMIKKMKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0209095_11779491 | 3300025685 | Pelagic Marine | RISSSMKSRRKKMIDKMKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0208150_11547373 | 3300025751 | Aqueous | FSMKLRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0209307_11550601 | 3300025832 | Pelagic Marine | KIRISSSMKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0208544_102517281 | 3300025887 | Aqueous | VLKTPTSFSMKSRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK |
| Ga0209425_100974097 | 3300025897 | Pelagic Marine | RKKMIDKMKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| Ga0209962_10295831 | 3300026125 | Water | RKKMINKIKSKAMHYWSDHKIECLVVAILIVAYIVK |
| Ga0209951_11260561 | 3300026138 | Pond Water | RRKKMINKMKSKAMHYWSDHKIECLVVAVLIVAYIVK |
| Ga0209932_10038201 | 3300026183 | Pond Water | GVLKTLTGSSMKLRRKKMINKIKSKAMHYWSDHKIECLVVAILIVAYIVK |
| Ga0247605_10789501 | 3300026503 | Seawater | SSSMKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0208023_10734043 | 3300027206 | Estuarine | PKTPTSFSMKSRRKKMINKMKSKAMHYWSDHKIECLVVAVLVIAYIVK |
| (restricted) Ga0233414_105305951 | 3300028045 | Seawater | SSSMKLRRKKMIDKMKSKAMHYWSDHKVECLVVAVLIIAYILK |
| Ga0247582_11852842 | 3300028109 | Seawater | PTSSSMKSRRKKMIDKMKSKAMHYWSDHKVECLVVAVLVIAYIVK |
| Ga0233401_10756393 | 3300028127 | Seawater | SMKSRRKKMIDKMKSKAMHYWSDHKIECLVFVVLIVAYVLK |
| Ga0228646_11462591 | 3300028280 | Seawater | GVLKTPTSSSMKSRRKKMINKMKSKAMHYWSDHKVECLVVAVLIIAYIVK |
| Ga0265303_102124691 | 3300028600 | Sediment | RKKMIDKMKSKAMHYWSDHKIECLVVAVLIVAYIVK |
| Ga0265303_105474573 | 3300028600 | Sediment | RRKKMIDKMKSKAMHYWSDHKIECLVVAVLIVAYIVK |
| Ga0315315_106677381 | 3300032073 | Seawater | SRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIIK |
| Ga0316203_11851281 | 3300032274 | Microbial Mat | MKWRRKKMIKKIKSKVMHYWSDHKIECLVVAVLVVAYIIK |
| Ga0316204_102531354 | 3300032373 | Microbial Mat | SRRKKMINKLKSKAMHYWSDHKIECLVVAILVVAYIVK |
| ⦗Top⦘ |