| Basic Information | |
|---|---|
| Family ID | F038881 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 47 residues |
| Representative Sequence | SGELVARWEDLQRRDLAAFQKLTAEGSLSTVVVPPAGRATEEPVAAH |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.61 % |
| % of genes near scaffold ends (potentially truncated) | 99.39 % |
| % of genes from short scaffolds (< 2000 bps) | 87.88 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.364 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.485 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 30.67% β-sheet: 0.00% Coil/Unstructured: 69.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF13507 | GATase_5 | 6.06 |
| PF00857 | Isochorismatase | 2.42 |
| PF10101 | DUF2339 | 1.82 |
| PF12969 | DUF3857 | 1.21 |
| PF01541 | GIY-YIG | 0.61 |
| PF04434 | SWIM | 0.61 |
| PF04014 | MazE_antitoxin | 0.61 |
| PF01435 | Peptidase_M48 | 0.61 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.61 |
| PF08281 | Sigma70_r4_2 | 0.61 |
| PF01370 | Epimerase | 0.61 |
| PF01841 | Transglut_core | 0.61 |
| PF13185 | GAF_2 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 2.42 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.42 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.61 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.61 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.36 % |
| Unclassified | root | N/A | 3.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_76878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1841 | Open in IMG/M |
| 3300001356|JGI12269J14319_10015093 | All Organisms → cellular organisms → Bacteria | 5860 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100771612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101690846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10243263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300004091|Ga0062387_101799068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300004092|Ga0062389_104310744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300004152|Ga0062386_100047291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3232 | Open in IMG/M |
| 3300004633|Ga0066395_10015018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2964 | Open in IMG/M |
| 3300004635|Ga0062388_100570014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300005174|Ga0066680_10410911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300005468|Ga0070707_100709943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300005526|Ga0073909_10028431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1890 | Open in IMG/M |
| 3300005542|Ga0070732_10184827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300005542|Ga0070732_10807822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005591|Ga0070761_10139405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1416 | Open in IMG/M |
| 3300005602|Ga0070762_10849993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300005614|Ga0068856_101684361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300005764|Ga0066903_104805354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300005921|Ga0070766_10800654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300006052|Ga0075029_101118031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300006086|Ga0075019_10157146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1332 | Open in IMG/M |
| 3300006086|Ga0075019_11023274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300006163|Ga0070715_10464881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300006174|Ga0075014_100181692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300006176|Ga0070765_100380401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1315 | Open in IMG/M |
| 3300006804|Ga0079221_10126127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
| 3300006893|Ga0073928_10488248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300009038|Ga0099829_10669780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300009521|Ga0116222_1212933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300009521|Ga0116222_1430120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300009522|Ga0116218_1046767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1957 | Open in IMG/M |
| 3300009522|Ga0116218_1256075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300009523|Ga0116221_1148530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1021 | Open in IMG/M |
| 3300009616|Ga0116111_1091602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300009618|Ga0116127_1119627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 679 | Open in IMG/M |
| 3300009624|Ga0116105_1245445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300010048|Ga0126373_10160761 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300010321|Ga0134067_10282570 | Not Available | 635 | Open in IMG/M |
| 3300010358|Ga0126370_10040608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2886 | Open in IMG/M |
| 3300010358|Ga0126370_11714582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300010361|Ga0126378_12847145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300010376|Ga0126381_100052140 | All Organisms → cellular organisms → Bacteria | 5015 | Open in IMG/M |
| 3300010379|Ga0136449_100450586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2258 | Open in IMG/M |
| 3300010379|Ga0136449_100815276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1539 | Open in IMG/M |
| 3300010379|Ga0136449_103554505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300011120|Ga0150983_14653065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300012096|Ga0137389_10060654 | All Organisms → cellular organisms → Bacteria | 2892 | Open in IMG/M |
| 3300012205|Ga0137362_10381773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1220 | Open in IMG/M |
| 3300012212|Ga0150985_105720331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300012354|Ga0137366_11208037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300012917|Ga0137395_10788687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300012927|Ga0137416_11466241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300012957|Ga0164303_11283822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300014155|Ga0181524_10304874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300014156|Ga0181518_10313985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300014158|Ga0181521_10301246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 822 | Open in IMG/M |
| 3300014199|Ga0181535_10302639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300014199|Ga0181535_10653669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300014200|Ga0181526_10238806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
| 3300014655|Ga0181516_10658960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300015371|Ga0132258_10017632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 15428 | Open in IMG/M |
| 3300016294|Ga0182041_10540863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300017924|Ga0187820_1310446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 521 | Open in IMG/M |
| 3300017935|Ga0187848_10122728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
| 3300017970|Ga0187783_11310661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300017972|Ga0187781_10108235 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300017973|Ga0187780_10768698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300017974|Ga0187777_11354105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300018004|Ga0187865_1058184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1522 | Open in IMG/M |
| 3300018006|Ga0187804_10395051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300018007|Ga0187805_10054272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1800 | Open in IMG/M |
| 3300018009|Ga0187884_10216973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300018021|Ga0187882_1342138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300018026|Ga0187857_10223711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300018038|Ga0187855_10225877 | Not Available | 1101 | Open in IMG/M |
| 3300018042|Ga0187871_10085999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1827 | Open in IMG/M |
| 3300018044|Ga0187890_10319269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300018086|Ga0187769_10740077 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300018468|Ga0066662_12343339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300019275|Ga0187798_1196465 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300020199|Ga0179592_10157916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
| 3300020579|Ga0210407_10312936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1227 | Open in IMG/M |
| 3300020581|Ga0210399_10025751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4677 | Open in IMG/M |
| 3300020582|Ga0210395_10540560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300020583|Ga0210401_10061318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3542 | Open in IMG/M |
| 3300021170|Ga0210400_11644796 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021403|Ga0210397_10493308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300021433|Ga0210391_11331116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300021474|Ga0210390_10824781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300021477|Ga0210398_10031928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4403 | Open in IMG/M |
| 3300021478|Ga0210402_10166388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2015 | Open in IMG/M |
| 3300021479|Ga0210410_10308750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1419 | Open in IMG/M |
| 3300022533|Ga0242662_10159997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300022557|Ga0212123_10863330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300022557|Ga0212123_10866835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300022726|Ga0242654_10429942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300023250|Ga0224544_1061399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300024225|Ga0224572_1076837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300024225|Ga0224572_1110872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300025509|Ga0208848_1073256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300025612|Ga0208691_1050377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300025924|Ga0207694_11235461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300025944|Ga0207661_11174020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300025949|Ga0207667_11362293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300026300|Ga0209027_1279003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300026301|Ga0209238_1270244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300026550|Ga0209474_10164971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
| 3300026557|Ga0179587_10156105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1425 | Open in IMG/M |
| 3300026869|Ga0207821_1021921 | Not Available | 630 | Open in IMG/M |
| 3300026998|Ga0208369_1028574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300027073|Ga0208366_1026002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300027590|Ga0209116_1081791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300027625|Ga0208044_1161641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Aurantiacibacter → Aurantiacibacter sediminis | 616 | Open in IMG/M |
| 3300027633|Ga0208988_1029862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1404 | Open in IMG/M |
| 3300027648|Ga0209420_1014677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2657 | Open in IMG/M |
| 3300027652|Ga0209007_1039194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300027681|Ga0208991_1064755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300027829|Ga0209773_10024410 | Not Available | 2384 | Open in IMG/M |
| 3300027842|Ga0209580_10518658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300027855|Ga0209693_10278990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300027857|Ga0209166_10672133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300027862|Ga0209701_10272343 | Not Available | 982 | Open in IMG/M |
| 3300027884|Ga0209275_10204150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
| 3300027898|Ga0209067_10103095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1486 | Open in IMG/M |
| 3300027898|Ga0209067_10723903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300027905|Ga0209415_10178031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2062 | Open in IMG/M |
| 3300027911|Ga0209698_10773593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300028047|Ga0209526_10540982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300028560|Ga0302144_10293723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300028747|Ga0302219_10442694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300028759|Ga0302224_10474536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300028798|Ga0302222_10026305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2383 | Open in IMG/M |
| 3300028879|Ga0302229_10524526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300029917|Ga0311326_10010712 | All Organisms → cellular organisms → Bacteria | 5828 | Open in IMG/M |
| 3300029952|Ga0311346_11109827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300030058|Ga0302179_10268729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300030494|Ga0310037_10460589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300030524|Ga0311357_11137039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 679 | Open in IMG/M |
| 3300030618|Ga0311354_10233113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1944 | Open in IMG/M |
| 3300030737|Ga0302310_10114401 | Not Available | 1655 | Open in IMG/M |
| 3300030741|Ga0265459_11431485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300031057|Ga0170834_104499892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300031090|Ga0265760_10099787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300031235|Ga0265330_10129779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
| 3300031239|Ga0265328_10441051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300031241|Ga0265325_10460641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300031715|Ga0307476_10981273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300031718|Ga0307474_10536074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300031720|Ga0307469_11368486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300031753|Ga0307477_10011474 | All Organisms → cellular organisms → Bacteria | 6063 | Open in IMG/M |
| 3300031753|Ga0307477_10109176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1926 | Open in IMG/M |
| 3300031754|Ga0307475_10417314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
| 3300031823|Ga0307478_10532499 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300031996|Ga0308176_11886284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300032160|Ga0311301_10360014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2265 | Open in IMG/M |
| 3300032174|Ga0307470_10126846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1518 | Open in IMG/M |
| 3300032174|Ga0307470_10590503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300032783|Ga0335079_11396733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300032829|Ga0335070_11820160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300033134|Ga0335073_10709802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
| 3300033134|Ga0335073_11078164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300033158|Ga0335077_11718731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300033158|Ga0335077_11888595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300033158|Ga0335077_11895927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.82% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.21% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.61% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.61% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01262770 | 2199352024 | Soil | LKRQAGELVTRWQSLQRGDLAAFQKLTAEGSLSTVVVPPAGQTVAEPVAAH |
| JGI12269J14319_100150934 | 3300001356 | Peatlands Soil | EKLKRQSGELIGRWEDLQRRDLAAFQKLAAEGSLSTVVVPPAGRATDEVVVAH* |
| JGIcombinedJ26739_1007716121 | 3300002245 | Forest Soil | LQFEKLSQQVKQLLGRWEDLQSHDLATFRKLTAESSLSTVVVPPAGRGGESEITDSH* |
| JGIcombinedJ26739_1016908461 | 3300002245 | Forest Soil | RRDLAAFQKLTAEGSLSTVVVPPAGRATDEPVAAH* |
| JGIcombinedJ51221_102432632 | 3300003505 | Forest Soil | GELIGRWEDLQHRDLAAFQKLTVEGSLSTVVVPPPGRATEDEVPAH* |
| Ga0062387_1017990681 | 3300004091 | Bog Forest Soil | GELIARWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDEAAPAH* |
| Ga0062389_1043107441 | 3300004092 | Bog Forest Soil | QFEKLKRQGGELLSLWDDLQRRDLAAFQKLTAEGSLSPVGVPPAGKAAEAENTDAR* |
| Ga0062386_1000472917 | 3300004152 | Bog Forest Soil | RWEDIQRRDLAAFQKLAAEGSLSTVMVPPAGRVVNEDVAAH* |
| Ga0066395_100150185 | 3300004633 | Tropical Forest Soil | RQSGELISRWEDLQRRDLAAFQKLTAEGSLSTVLVPPAGRTVDEPVAAH* |
| Ga0062388_1005700141 | 3300004635 | Bog Forest Soil | KQFEKLRRQTEELVNRWEDLQHHGLADFRKLTSESNLSTVVVPPAGRAPESESADSH* |
| Ga0066680_104109111 | 3300005174 | Soil | LKRQSGELLAKWEDLQRRDLAAFQKMAAEGSLSTVMVPPAGRAAEEPVAAH* |
| Ga0070707_1007099431 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NEERLGHWADLQRSDLAAFQKLTAEGSLTTVVVPPAGRTGEPVGTDAH* |
| Ga0073909_100284314 | 3300005526 | Surface Soil | QTGELIGRWDDLQRRDLAAFQKLTVQGSLSTVVVPPAGRAADEVVGAH* |
| Ga0070732_101848273 | 3300005542 | Surface Soil | RQSGELISRWEDLQRRDLASFQKLTAEGSLSTVVVPPPGRAADESVPAH* |
| Ga0070732_108078221 | 3300005542 | Surface Soil | DLQRRDLAAFQKLTAEGSLSTVVVPPAGRAVEEPVAAH* |
| Ga0070761_101394053 | 3300005591 | Soil | DLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDEEVPAH* |
| Ga0070762_108499931 | 3300005602 | Soil | FEKLKRQSGELLRRWEDMQRHDLGDFRKLTSESNLSTVVVPPAGQTGDPETTDAH* |
| Ga0068856_1016843612 | 3300005614 | Corn Rhizosphere | QRRDLADFQKLAAQGSLSTVVVPPAGRVADEPVAAH* |
| Ga0066903_1048053541 | 3300005764 | Tropical Forest Soil | QSGELISRWEDLQRRDLAAFQKLTAEGSLSTVLVPPAGRTVDEPVAAH* |
| Ga0070766_108006542 | 3300005921 | Soil | LQRRDLAAFQKLAAEGSLSTVVVPPAGRVADQDVPAH* |
| Ga0075029_1011180311 | 3300006052 | Watersheds | LQRRDLASFQKLTAEGSLSTVVVPPPGRSTEEAVPAH* |
| Ga0075019_101571461 | 3300006086 | Watersheds | AKWEDLQRRDLAAFQKLAAEGSLSTVMVPPAGRTAEEPVAAH* |
| Ga0075019_110232742 | 3300006086 | Watersheds | GELISRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRAADEPVDAH* |
| Ga0070715_104648812 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RQLERLKRQSGELLSKWDELQRRELAAFQKLTAEGSLSTVMVPPAGRSTEESVAAH* |
| Ga0075014_1001816923 | 3300006174 | Watersheds | QLEKLKRQSGELLAKWENLQRRDLVAFQKLTAEGSLSTVMVPPAGRSTEEPVAAH* |
| Ga0070765_1003804011 | 3300006176 | Soil | ELVARWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGWVPDESVAAH* |
| Ga0079221_101261273 | 3300006804 | Agricultural Soil | LQRRDLADFQKLAAQGSLSTVVVPPAGRVADEPVAAH* |
| Ga0073928_104882481 | 3300006893 | Iron-Sulfur Acid Spring | RQSGELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPAGRSTDQAGAAH* |
| Ga0099829_106697801 | 3300009038 | Vadose Zone Soil | LTRQTKELLSHWDDLQRGDLAAFRKLTSENNLSTVLVPPAGQTGEAENRDAH* |
| Ga0116222_12129331 | 3300009521 | Peatlands Soil | LIGRWEDLQRRDLAAFQKLAAEGSLSTVVVPPAGRATDEVVVAH* |
| Ga0116222_14301201 | 3300009521 | Peatlands Soil | FEKLKRQSGELIGRWEDLQRRDLGAFQKLTAEGSLSTVVVPPAGRATDESLQAH* |
| Ga0116218_10467673 | 3300009522 | Peatlands Soil | VGRWEDLQRRDLAAFQKLTAEGSLSTAVVPPAGRAGDEEVPAH* |
| Ga0116218_12560752 | 3300009522 | Peatlands Soil | WQDLQRRDLAASQKLTAEGSLSTVVVPPPGRVTEDEVPAH* |
| Ga0116221_11485301 | 3300009523 | Peatlands Soil | KLKRQSGELLARWEDVQRRDLAAFQKLTAEGSLSTVVVPPAGRVDEEVAAH* |
| Ga0116111_10916021 | 3300009616 | Peatland | ELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRIGDAENLEAH* |
| Ga0116127_11196271 | 3300009618 | Peatland | QSGELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRIGDAENLEAH* |
| Ga0116105_12454451 | 3300009624 | Peatland | EQLQFEKLKRQSADLLSHWEDLQRHELSDFRKLTAESNLSTVVVPPAGQTMDPENTEAH* |
| Ga0126373_101607611 | 3300010048 | Tropical Forest Soil | LKRQSGELLAKWDDLQRRDLAAFQKMTAEGSLSTVVVPPPGRVSEEPVAAH* |
| Ga0134067_102825702 | 3300010321 | Grasslands Soil | KRQSGELLARWDDLQRRDLADFQKLAAQGSLSTVVVPPAGRVAEEPIAAH* |
| Ga0126370_100406081 | 3300010358 | Tropical Forest Soil | RWDDLQRRDLAAFQKLTAEGSLSTVLVPPAGRTVEEPVAAH* |
| Ga0126370_117145821 | 3300010358 | Tropical Forest Soil | LISRWEDLQRRDLAAFQKLAAEGSLSSVIVPPAGRVPDEPEAAH* |
| Ga0126378_128471451 | 3300010361 | Tropical Forest Soil | LKRQSGELLAKWDDLQRRDLAAFQKMTAEGSLSTVVVPPPGRISEEPVAAH* |
| Ga0126381_1000521401 | 3300010376 | Tropical Forest Soil | SGELVARWEDLQRRDLAAFQKLTAEGSLSTVVVPPAGRATEEPVAAH* |
| Ga0136449_1004505861 | 3300010379 | Peatlands Soil | RQSGELIGRWEDLQRRDLAAFQKLAAEGSLSTVVVPPAGRATDEVVVAH* |
| Ga0136449_1008152761 | 3300010379 | Peatlands Soil | RQSGELIGRWEDLQRRDLAAFQKLAAEGSLSTVVVPPAGRVTDEVVVAH* |
| Ga0136449_1035545051 | 3300010379 | Peatlands Soil | KRQSGQLLSRWEDLQRHDLADFRKLTSESNLSTVVVPPAGRTGEPENTEAH* |
| Ga0150983_146530651 | 3300011120 | Forest Soil | GRWEDLQRRDLAAFQKLTVEGSLSTVVVPPAGRSIEQGVSAH* |
| Ga0137389_100606545 | 3300012096 | Vadose Zone Soil | DLAAFQKLTAEANLSSVVVPPAGQSGAAADVDTH* |
| Ga0137362_103817731 | 3300012205 | Vadose Zone Soil | QTKELLSHWDDLQHGDLAAFRKLTSENSLSTVVVPPAGRTGEAENIDAH* |
| Ga0150985_1057203312 | 3300012212 | Avena Fatua Rhizosphere | LQRRDLGAFQKMAAQESLSTVVVPPAGQALDEPAASH* |
| Ga0137366_112080371 | 3300012354 | Vadose Zone Soil | DLQHRDLAAFQKLTVEGSLSTVVVPPAGRMVDEAFAAH* |
| Ga0137395_107886871 | 3300012917 | Vadose Zone Soil | DKLTRQTKELLSHWDDLQRGDLAAFRKLTSENNLSTVLVPPAGQTGEAENRDAH* |
| Ga0137416_114662411 | 3300012927 | Vadose Zone Soil | DLAAFQKLTAEGSLTTVVVPPAGRTGQAVGTDAH* |
| Ga0164303_112838221 | 3300012957 | Soil | ERLKRQSGELLSKWDELQRRELAAFQKLTAEGSLSTVMVPPAGRSTEESVAAH* |
| Ga0181524_103048741 | 3300014155 | Bog | SGELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRIGDAENLEAH* |
| Ga0181518_103139851 | 3300014156 | Bog | LKRQSGELMARWEDLQRRDLAAFQKLTAEGSLSTVVVPPAGRAADEPVLAH* |
| Ga0181521_103012461 | 3300014158 | Bog | VQRRDLAAFQKLTAEGSLSTVVVPPAGRVDEEVAAH* |
| Ga0181535_103026392 | 3300014199 | Bog | WDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRIGDAENLEAH* |
| Ga0181535_106536691 | 3300014199 | Bog | RQSGELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATEDENPAH* |
| Ga0181526_102388063 | 3300014200 | Bog | RQSGELIGRWQDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATEDEVPAH* |
| Ga0181516_106589601 | 3300014655 | Bog | LKRQSGELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDEEVPAH* |
| Ga0132258_1001763214 | 3300015371 | Arabidopsis Rhizosphere | ISRWEDIQRRDLAAFQKLATAGSLTTVIVPPAGKATEDPVTAH* |
| Ga0182041_105408632 | 3300016294 | Soil | ESGELLAKWDDLQRRDLAAFQKMASEGSLSTVMVPPAGRSVEEPVPAH |
| Ga0187820_13104461 | 3300017924 | Freshwater Sediment | TRQSGEMLSEWEHLQRNELAAFQKLTAASSLSTVVVPPAGRSVEPESAEAH |
| Ga0187848_101227281 | 3300017935 | Peatland | GQWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRAAEAENADAR |
| Ga0187783_113106611 | 3300017970 | Tropical Peatland | QFEKLKRQSGELLSRWEDLQRSDLAAFRKLTSESNLSTVVVPPAGQTGDLETTDAH |
| Ga0187781_101082352 | 3300017972 | Tropical Peatland | GRWEDLQRRDLAAFQKLTSEGSLSTVMVPPAGRAAEEEIPAH |
| Ga0187780_107686981 | 3300017973 | Tropical Peatland | ARWEDLQRRDLAAFQKLTAEGSLSTVVVPPAGRSTEEPVAAH |
| Ga0187777_113541051 | 3300017974 | Tropical Peatland | AKWDDLQRRDLAAFQKLAAEGSLSTVLVPPAGRAAEETLPAH |
| Ga0187865_10581841 | 3300018004 | Peatland | QLEFEKLSRQSGELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRIGDAENLEAH |
| Ga0187804_103950511 | 3300018006 | Freshwater Sediment | EKLKRQSGELLSRWDDLQRHDLAAFRKLTSESNLSTVVVPPAGQTGDTENTDAH |
| Ga0187805_100542721 | 3300018007 | Freshwater Sediment | KLKRQSGELVARWDDLQRRDLAAFQKLTAEGSVSTVMVPPAGRSMEEPVAAH |
| Ga0187884_102169731 | 3300018009 | Peatland | ELLSRWDDLQRSDLAAFQKLTAESRLSTVVVPPAGRIVYTGNLDAH |
| Ga0187882_13421381 | 3300018021 | Peatland | KLKRQSGELLSRWDDLQRSDLAAFQKLTAESRLSTVVVPPAGRIVYTGNLDAH |
| Ga0187857_102237112 | 3300018026 | Peatland | LQRRDLAAFQKLTAEGSLSTVVVPPAGRIGDAENLEAH |
| Ga0187855_102258771 | 3300018038 | Peatland | KLNHETADVLASWESLEHGELAAFQKLTSDGSLSTVVVPPAGRTVNAEATEAH |
| Ga0187871_100859991 | 3300018042 | Peatland | ELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRTAEEENSEAH |
| Ga0187890_103192692 | 3300018044 | Peatland | FEKLKRQSGELLSRWDDLQRRDLAAFQKLTVEGSLSTVVVPPAGRAGEVENIDAH |
| Ga0187769_107400771 | 3300018086 | Tropical Peatland | RRDLAAFQKLTAEGSLSTVVVPPPGRAGEEEIPAH |
| Ga0066662_123433391 | 3300018468 | Grasslands Soil | YLGRWDDLQRGDLAAFRKLSSENSLSTVVVPPAGQAAEAESADAH |
| Ga0187798_11964652 | 3300019275 | Peatland | QRRDLADFQKLTAEGSLSTVVVPPPGRAADEAVPAH |
| Ga0179592_101579162 | 3300020199 | Vadose Zone Soil | GQVGDLLGRWQDLQSHDLGTFRKLTAESSLSTVVVPPAGRVGESENTESH |
| Ga0210407_103129361 | 3300020579 | Soil | EDLQRRDLAAFQKLTAEGSLSTVVVPPAGRSTDQAGAAH |
| Ga0210399_100257511 | 3300020581 | Soil | SRWDDLQRRDLAGFQKLTAEGSLSTVVVPPAGRVTDEEIPAH |
| Ga0210395_105405601 | 3300020582 | Soil | QSGELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDETLPAH |
| Ga0210401_100613181 | 3300020583 | Soil | GELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDETLPAH |
| Ga0210400_116447961 | 3300021170 | Soil | LTRMNEELLGHWAELQRSDLAAFQKLTAEGSLTTVVVPPAGRSGEPVGNDAH |
| Ga0210397_104933081 | 3300021403 | Soil | GELLSRWDDLQLRDLPAFRKLTTESNLSTVVVPPPGQTGEAENTDAH |
| Ga0210391_113311161 | 3300021433 | Soil | QRRDLAAFQKLTAERSLSPVGVPPAGKAAEAENTDAR |
| Ga0210390_108247812 | 3300021474 | Soil | WEDLQRRDLAAFQKLTSEGSLSTVVVPPPGRATDETFPAH |
| Ga0210398_100319281 | 3300021477 | Soil | DLQRRDLAAFQKLTAEGSLSTVVVPPPGRATEEEIPAH |
| Ga0210402_101663881 | 3300021478 | Soil | LMGRWDDLQRRDLAGFQKLTAEGSLSTVVVPPAGRVTDEEIPAH |
| Ga0210410_103087501 | 3300021479 | Soil | ALASWESLEHGDLAAFQKLTAEGSLSTVVVPPAGRTGNAVGAEAH |
| Ga0242662_101599971 | 3300022533 | Soil | WDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRTADEPVAAH |
| Ga0212123_108633301 | 3300022557 | Iron-Sulfur Acid Spring | SGELLSRWEDLQRHDLADFRKLTADSNLSTVVVPPAGRTGDAESTEAH |
| Ga0212123_108668351 | 3300022557 | Iron-Sulfur Acid Spring | KRQSGELIGRWDELQRRDLAAFQKLTAEGSLSTVVVPPAGRIPEEPAASH |
| Ga0242654_104299421 | 3300022726 | Soil | EFEKLKRQSGELVGRWEDLQRRDLAAFQKLTVEGSLSTVVVPPAGRSIEQGVSAH |
| Ga0224544_10613991 | 3300023250 | Soil | QSGELLSRWEDLQRHDLGAFRKLTSESNLSTVVVPPAGQTGDPETTDAH |
| Ga0224572_10768372 | 3300024225 | Rhizosphere | SGELIGRWEDLQRRDLAAFQKLTVEGSLSTVVVPPPGRATDEEIPAH |
| Ga0224572_11108721 | 3300024225 | Rhizosphere | QLEFEKLKRQCGELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRAGETETLDAH |
| Ga0208848_10732561 | 3300025509 | Arctic Peat Soil | QSGELIGRWDDLQRRDLAAFQKLTAEGSLSTVVVPPPGRSTEEAVPAH |
| Ga0208691_10503771 | 3300025612 | Peatland | LQRRDLAAFQKLTAEGSLSTVVVPPAGRAAEAENADAR |
| Ga0207694_112354611 | 3300025924 | Corn Rhizosphere | WDDLQRRDLADFQKLTAQGSLSTVVVPPAGRVADEPVAAH |
| Ga0207661_111740201 | 3300025944 | Corn Rhizosphere | RWDDLQRRDLADFQKLAAQGSLSTVVVPPAGRVADEPVAAH |
| Ga0207667_113622931 | 3300025949 | Corn Rhizosphere | ELLARWDDLQRRDLADFQKLTAQGSLSTVVVPPAGRTSEEPVSAH |
| Ga0209027_12790031 | 3300026300 | Grasslands Soil | DLQRRDLGDFQKLAAEGSLSTVVVPPAGRAADEGVPAH |
| Ga0209238_12702442 | 3300026301 | Grasslands Soil | AKLKRHTGELLARWDDLQRRDLGDFQKLAAEGSLSTVVVPPAGRAADEGVPAH |
| Ga0209474_101649712 | 3300026550 | Soil | GLQRRDLADFQKLAAQGSLSTVVVPPAGRVGDDPMPAH |
| Ga0179587_101561051 | 3300026557 | Vadose Zone Soil | RQSGELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPAGRAEETVPAH |
| Ga0207821_10219211 | 3300026869 | Tropical Forest Soil | QRRDLAAFQKLTAEGSLSTVVVPPAGRSADEVVAAH |
| Ga0208369_10285742 | 3300026998 | Forest Soil | ERLKRQSGELLAKWEDLQRRDLAAFQKMAAEGSLSTVMVPPAGRAAEEPVAAH |
| Ga0208366_10260021 | 3300027073 | Forest Soil | LQRRDLAAFQKMAAEGSLSTVMVPPAGRAAEEPVAAH |
| Ga0209116_10817911 | 3300027590 | Forest Soil | AGEFLSRWEDLQRQDLASFRKLTSESNLSTIVVPPAGRTGETEDRDAH |
| Ga0208044_11616412 | 3300027625 | Peatlands Soil | KEFEKLKRQSGELIGRWQDLQRRDLAAFQKLTAEGSLSTVVVPPPGRVTEDEVPAH |
| Ga0208988_10298621 | 3300027633 | Forest Soil | NGEILVRWTELQHADLAAFQKLTAEGSLSTVVVPPAGKAGEVNDAETH |
| Ga0209420_10146774 | 3300027648 | Forest Soil | RQSAELLRHWEDLQRHELSDFRKLTSESNLSTVVVPPAGQTVDPENTEAH |
| Ga0209007_10391942 | 3300027652 | Forest Soil | KLKRQSGELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRAGETETLDAH |
| Ga0208991_10647551 | 3300027681 | Forest Soil | GEILARWTELQHADLAAFQKLTAEGSLSTVVVPPAGKAGEVNDAETH |
| Ga0209773_100244104 | 3300027829 | Bog Forest Soil | WDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRTVEAEGVDAH |
| Ga0209580_105186581 | 3300027842 | Surface Soil | QLEKLKRQSGELLAKWEDLQRRDLAAFQKMAAEGSLSTVMVPPAGRAAEEPVAAH |
| Ga0209693_102789901 | 3300027855 | Soil | RWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGWIPDEPVAAH |
| Ga0209166_106721331 | 3300027857 | Surface Soil | YREFEKLKRQSGEFIARWEDLQRRDLAAFQKLAVEGSLSTVVVPPAGRVTEEPVAAH |
| Ga0209701_102723432 | 3300027862 | Vadose Zone Soil | MNEERLGHWADLQRSDLAAFQKLTAEGSLTTVVVPPAGRTGEPVGTDAH |
| Ga0209275_102041501 | 3300027884 | Soil | TEFEKLKRQSGELVGRWEDLQRRDLAAFQKLTVEGSLSTVVVPPAGRSIEQGVSAH |
| Ga0209067_101030951 | 3300027898 | Watersheds | KWEDLQRRDLAAFQKLAAEGSLSTVMVPPAGRTAEEPVAAH |
| Ga0209067_107239031 | 3300027898 | Watersheds | LQLEKLKRQSGELISRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRAADEPVDAH |
| Ga0209415_101780311 | 3300027905 | Peatlands Soil | ELIGRWEDLQRRDLAAFQKLAAEGSLSTVVVPPAGRATDEVVVAH |
| Ga0209698_107735931 | 3300027911 | Watersheds | LNRQSGELLAKWEDLQRRDLAAFQKLAAEGSLSTVMVPPAGRTAEEPVAAH |
| Ga0209526_105409821 | 3300028047 | Forest Soil | LQRRDLAAFQKLTAEGSLSTVVVPPAGRATEEPVAAH |
| Ga0302144_102937231 | 3300028560 | Bog | GELQSRWDDLQRRDLAAFRKLTSENNLSTVVVPPAGQTSEEENLDAH |
| Ga0302219_104426941 | 3300028747 | Palsa | DLQRRDLAAFQKRTAEGSLSTVIVPPADRAAEAEDAEAH |
| Ga0302224_104745361 | 3300028759 | Palsa | ELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDEEIPAH |
| Ga0302222_100263054 | 3300028798 | Palsa | QSGELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRTAGEENSDAH |
| Ga0302229_105245262 | 3300028879 | Palsa | GELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDEEIPAH |
| Ga0311326_100107121 | 3300029917 | Bog | EKLKRQSGELQSRWDDLQRRDLAAFRKLTSENNLSTVVVPPAGQTSEEENLDAH |
| Ga0311346_111098271 | 3300029952 | Bog | QSAELLARWDTLQGQDLAAFRKLTAENNLSTVVVPPAGQTGAEENKDAH |
| Ga0302179_102687291 | 3300030058 | Palsa | VFEKLRRQREELLNRWEDLQRHELAAFRKLTSESNLSTVVVPPAGQTGDVENTDAH |
| Ga0310037_104605891 | 3300030494 | Peatlands Soil | QFEKLKRQSGELIGRWEDLQRRDLAAFQKLTAEGSLATVVVPPPGRATDETIPAH |
| Ga0311357_111370392 | 3300030524 | Palsa | KEFEKLKRQSGELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDEEVPAH |
| Ga0311354_102331131 | 3300030618 | Palsa | LKRQAGEFLSRWEDLQRQDLASFRKLTSESNLSTIVVPPAGRTGETEDRDAH |
| Ga0302310_101144011 | 3300030737 | Palsa | SGELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRATDEEIPAH |
| Ga0265459_114314851 | 3300030741 | Soil | HETAEALASWESLEHGDLAAFQKLTAEGSLSTVVVPPAGRTGDAEGAEAH |
| Ga0170834_1044998921 | 3300031057 | Forest Soil | LFSQWEDLQRHDLANFQKLTAEGSLSTVVVPPAGRAGEPESTDAH |
| Ga0265760_100997873 | 3300031090 | Soil | QSGELIGRWEDLQRRDLAAFQKLTVEGSLSTVVVPPPGRATDEEIPAH |
| Ga0265330_101297791 | 3300031235 | Rhizosphere | SGELIGRWEDLQRRDLAAFQKLTVEGSLSTVVVPPPGRATDEAVPAH |
| Ga0265328_104410512 | 3300031239 | Rhizosphere | LIGRWEDLQRRDLAAFQKLTVEGSLSTVVVPPPGRATDEAVPAH |
| Ga0265325_104606412 | 3300031241 | Rhizosphere | EDLQRRDLAAFQKLTVEGSLSTVVVPPPGRATDEAVPAH |
| Ga0307476_109812731 | 3300031715 | Hardwood Forest Soil | RESGELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPPGRIADAESIDAH |
| Ga0307474_105360742 | 3300031718 | Hardwood Forest Soil | GELLSRWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRTADAESIDAH |
| Ga0307469_113684861 | 3300031720 | Hardwood Forest Soil | VGRWDDLQSHDLAAFRKLTAESSLSTVVVPPAGRAGESESMEAH |
| Ga0307477_100114741 | 3300031753 | Hardwood Forest Soil | QQFERLKRQSGELIGRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRAAEEIVPAH |
| Ga0307477_101091763 | 3300031753 | Hardwood Forest Soil | RLNAELLGHWADLQRGDLAAFQKLTAQGSLSTVVVPPAGRGEVGDNSEAH |
| Ga0307475_104173141 | 3300031754 | Hardwood Forest Soil | WQELQSRDLAAFRKLTSESSLSTVVVPPAGRTGGEENTDTH |
| Ga0307478_105324991 | 3300031823 | Hardwood Forest Soil | GRWEDLQRRDLAAFQKLTVEGSLSTVVVPPAGRATDESVPAH |
| Ga0308176_118862841 | 3300031996 | Soil | LKRQSGELLARWDDLQRRDLADFQKLAAQGSLSTVVVPPAGRVADEPIAAH |
| Ga0311301_103600143 | 3300032160 | Peatlands Soil | LKRQSGELIGRWEDLQRRDLAAFQKLAAEGSLSTVVVPPAGRATDEVVVAH |
| Ga0307470_101268461 | 3300032174 | Hardwood Forest Soil | RRDLAAFQKLTVEGSLSTVVVPPPGRATDEAIPAH |
| Ga0307470_105905032 | 3300032174 | Hardwood Forest Soil | LKGQVGELLGRWQDLQSHDLATFRKLTAESSLSTVVVPPAGRAGESENADAH |
| Ga0335079_113967332 | 3300032783 | Soil | RWDDVQRRDLAAFQKLAAQGSLSTVVVPPAGRVDEDVAAH |
| Ga0335070_118201601 | 3300032829 | Soil | GELMSRWEDLQRRDLAAFQKLTAEGSLSTVVVPPPGRAGDEPVAAH |
| Ga0335073_107098022 | 3300033134 | Soil | QFDKLKRQTGELVSRWEDLQRRDLAAFQKLTAEGSLSTVIVPPAGREPEEPVAAH |
| Ga0335073_110781642 | 3300033134 | Soil | FGKLKRQSGELLSRWDDLQRRDLAAFQKMTAEGSLSTVVVPPAGRATEEETIEAH |
| Ga0335077_117187311 | 3300033158 | Soil | TGEFIARWEDVQHRDLAAFQKMTAEGSLSTVVVPPAERATEESVAAH |
| Ga0335077_118885952 | 3300033158 | Soil | EARWDDLQRRDLAAFQKLTAEGSLSTVVVPPAGRATEEPIAAH |
| Ga0335077_118959272 | 3300033158 | Soil | RWEDVQRRDLASFQKLAAEGNLSTVVVPPPGRTTEEPIAAH |
| ⦗Top⦘ |