 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F038744 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 41 residues |
| Representative Sequence | QKIELEDRLETLGYSGNLVKMHQIEEEIYEIEDTIRKLMP |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.61 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.55 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.576 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (24.242 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF00886 | Ribosomal_S16 | 0.61 |
| PF01555 | N6_N4_Mtase | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.61 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.58 % |
| All Organisms | root | All Organisms | 22.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 24.24% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 15.15% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.52% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 10.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.06% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.06% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.64% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.03% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.42% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.82% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.82% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.82% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.21% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.21% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.21% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.61% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.61% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.61% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.61% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.61% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.61% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000179 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 500m | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004110 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA | Environmental | Open in IMG/M |
| 3300005425 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199 | Environmental | Open in IMG/M |
| 3300005431 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013115 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020250 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555986-ERR599129) | Environmental | Open in IMG/M |
| 3300020266 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022842 | Saline water microbial communities from Ace Lake, Antarctica - #46 | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023240 | Saline water microbial communities from Ace Lake, Antarctica - #870 | Environmental | Open in IMG/M |
| 3300023294 | Saline water microbial communities from Ace Lake, Antarctica - #732 | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025623 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026125 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031625 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031676 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20m | Environmental | Open in IMG/M |
| 3300031700 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_surface | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPjun09P16500mDRAFT_10250632 | 3300000179 | Marine | ERVRELEGQKVILEDRLEHLSYTDNMVXMVXIEXEIFXIEXTIKKLTI* |
| JGI20152J14361_100732011 | 3300001344 | Pelagic Marine | EMERQKIDLENQLELLGYSGNLVKMHQIEEEIYEIEDTIRKLLP* |
| JGI24003J15210_100579171 | 3300001460 | Marine | SLERQKIEMENRLEFLGYSGNLVQMHKIEEEIFEIEDTIKKLID* |
| JGI24005J15628_100520241 | 3300001589 | Marine | GQKVILEDRLEHLGYASNLVKMHEVEEQIFEIEDTIKKLIS* |
| Ga0008648_101981691 | 3300004110 | Marine | LERQKIELNNQLEFLGYSGNLVRMHKIEEEIYEIDDTIKKLIK* |
| Ga0066859_100890061 | 3300005425 | Marine | EDRLEFVGSNFVKMHELEQEIFEIEDTIKKLTSKMEGFSG* |
| Ga0066854_102516622 | 3300005431 | Marine | DRIRDLERQKIDLEDRLELFTDNNLVKMVEIENEIFEIEDTIKKLTG* |
| Ga0066861_102869311 | 3300005522 | Marine | ENRLEHLGYSGNLVRMHEIEQEIYEIEDTIRKLLP* |
| Ga0066852_101731342 | 3300005604 | Marine | DQLEHLSYTGNMVKMVEIENEIFEIEDTIKKLIG* |
| Ga0075108_102265391 | 3300005913 | Saline Lake | ELEGQKVILEDRLEHLGYANNLVRMHEVEEQIFEIEDTIRKLVG* |
| Ga0075478_102140511 | 3300006026 | Aqueous | RQKIDLENQLELLGYSGNLVRMHQIEEEIYEIEDTIRKLLP* |
| Ga0075446_100475421 | 3300006190 | Marine | KIRELEGQKILLEDRLEHLGYASNLVRMHETESEIFEIEDTIKKLIG* |
| Ga0075446_101676781 | 3300006190 | Marine | KIRDLEGQKILLEDRLEHLGYASNLVKMHEIESEIFEIEDTIKKLIS* |
| Ga0098037_11416553 | 3300006737 | Marine | LENHLELLGYSGNLVKMHQIEEEIYEIEDTIRKLLP* |
| Ga0075481_101250271 | 3300006868 | Aqueous | KIELENQLETLGYSGNLVRMHQIDEEIYEIEDTIRKLLP* |
| Ga0075475_103182322 | 3300006874 | Aqueous | RQKIELNDQLEILGYTGNLVRMHQIEEQIFEIEDTIKKLIK* |
| Ga0075475_103233001 | 3300006874 | Aqueous | RQKIELNDQLEILGYSGNLVRMHQIEEQIFEIEDTIRKLTA* |
| Ga0070746_104395721 | 3300006919 | Aqueous | LERQKIELNDQLEILGYTGNLVRMHQIEEQIFEIEDTIRKLTA* |
| Ga0098051_10415511 | 3300006924 | Marine | NQLELLGYSGNLVKMHQIEEEIYEIEDTIRKLLP* |
| Ga0098036_11997241 | 3300006929 | Marine | ENQLEMLGYAGNLVKMHQIEEAIYEIEDSIRKILP* |
| Ga0075110_10932801 | 3300007074 | Saline Lake | RIRELEGQKVILEDRLEHLGYANNLVKMHEVEEEIFEIEDTIQKLIK* |
| Ga0102951_10810773 | 3300007725 | Water | QDRLEMLSYSSNLVKMHQIEQEIFEIEDTIQKLTT* |
| Ga0075480_102615601 | 3300008012 | Aqueous | KIDLENQLELLGYSGNLVRMHQIEEEIYEIQDTIRKLLP* |
| Ga0115552_11192001 | 3300009077 | Pelagic Marine | MERQKIDLENRLELLGYSGNLVKMHQIEEEIYEIEDTIRKLLP* |
| Ga0115552_11704631 | 3300009077 | Pelagic Marine | LENQLETLGYANNLVRMHQIEEEIYEIEDTIRKLLP* |
| Ga0117901_11385161 | 3300009103 | Marine | RQKIALEDQLELVGNNLVKMHEIESEIYEIDDTIRKLTA* |
| Ga0118687_101732882 | 3300009124 | Sediment | QKIDLDNKAEMLGYSGNLVKMHQIEEEIYEIEDTIRKLLP* |
| Ga0114995_103941152 | 3300009172 | Marine | KIRDLEGQKVILEDRLEHLGYASNLVKMHEIESEIFEIEDTIKKLIG* |
| Ga0114997_105526201 | 3300009425 | Marine | GQKIMLEDRLEHLGYSGNLVRMHEIEEEIFEIEDTIQKLIK* |
| Ga0114997_107254312 | 3300009425 | Marine | GQKIMLEDRMEHLGYSGNLVKMHEIEEEIFEIEDTIRKLVG* |
| Ga0115547_12841161 | 3300009426 | Pelagic Marine | IAELERQKIDLNDQLETLGYSGNLVRMHKIEEEIYEIEDTIKKLIK* |
| Ga0115545_10516583 | 3300009433 | Pelagic Marine | QKILLEDRMEHLGYASNLVKMHEIEEEIFEIEDTIQKLIK* |
| Ga0115562_13474102 | 3300009434 | Pelagic Marine | EMERQKIELENQLELLGYSGNLVKMHQIEEEIYEIEDTIRKLLP* |
| Ga0115557_10369024 | 3300009443 | Pelagic Marine | ELENQLELLGYSGNLLRMHQIEEEIFEIEDTITKLIK* |
| Ga0115558_13165801 | 3300009449 | Pelagic Marine | LERQKIDLENQLELLGYSGNLVRMHQIEEEIYEIQDTIRKLLP* |
| Ga0115554_10952101 | 3300009472 | Pelagic Marine | KIDLNDQLETLGYSGNLVRMHKVEEEIYEIEDTIKKLIG* |
| Ga0115555_13544031 | 3300009476 | Pelagic Marine | QLEMLGYSGNLVRMHQIEEEIYEIEDTIKKLIGQV* |
| Ga0114932_101811451 | 3300009481 | Deep Subsurface | LEDRLETLGYSGNLVRMHEIEEEIFEIEDSIKKLLG* |
| Ga0115564_100579184 | 3300009505 | Pelagic Marine | GMERQKIELENQLELLGYSGNLLRMHQIEEEIFEIEDTITKLIK* |
| Ga0115572_104624431 | 3300009507 | Pelagic Marine | KIELNDQLETLGYSGNLVRMHEVEEQIYEIEDTIRKLVG* |
| Ga0115003_101563523 | 3300009512 | Marine | QLEGQKVILEDRLEHLGYASNLVKMHEVEEEIFEIEDTIRKLVG* |
| Ga0115003_102328142 | 3300009512 | Marine | ELDNQLEMLGYSGNLVRMHEIEEEIFEIEDTIVKLIGQV* |
| Ga0115003_105443402 | 3300009512 | Marine | EGQKVILEDRLEHLGYASNLVKMHEIESEIFEIEDTIKKLVS* |
| Ga0115003_106001791 | 3300009512 | Marine | LEGQKIMLEDRLEHLGYSGNLVKMHEIEEEIFEIQDTILKLTA* |
| Ga0115004_103759531 | 3300009526 | Marine | IRQLEGQKVILEDRLEHLGYASNLVKMHEVEEQIFEIEDTIRKLVG* |
| Ga0115004_105885351 | 3300009526 | Marine | AEMERQKIDLESQLELLGYSGNLVKMHQIEEEIYEIEDTIRKLLP* |
| Ga0115011_104132384 | 3300009593 | Marine | LEGRLEMLGYSNNLVKMVEIEEEIFEIEDTIRKLLP* |
| Ga0115001_101577963 | 3300009785 | Marine | RQLEGQKVILEDRLEHLGYASNLVKMHEVEEQIFEIEDTIRKLVG* |
| Ga0115001_105990621 | 3300009785 | Marine | DRLEHLGYAGNLVKMHEVEEEIFEIEDTIRKLIK* |
| Ga0115001_106371351 | 3300009785 | Marine | LEDRLEHLGYSGNLVRMHEIEEEIFEIEDTIQKLIK* |
| Ga0115001_108921181 | 3300009785 | Marine | RQLEGQKVILEDRLEHLGYASNLVKMHEVEEQIFEIEDTIKKLLG* |
| Ga0133547_116122972 | 3300010883 | Marine | QKVILEDRLEHLGYASNLVKMHEVEEEIFEIEDTIQKLIK* |
| Ga0151674_10391453 | 3300011252 | Marine | KVELENRLEHLGYSGNLVRMHEIEQEIYEIEDTIRKLLP* |
| Ga0151675_10700393 | 3300011254 | Marine | MERQKVILEDRLEHLGYASNLVKMHEIESEIFEIEDTIKKLI |
| Ga0160422_103734943 | 3300012919 | Seawater | AELERQKIELESRLEMLSYANNHLRMVEIEQEIYEIEDTIRKLMP* |
| Ga0163110_103428391 | 3300012928 | Surface Seawater | IDLEDRLEYVGSNLVRMHQLEQEIYEIEDTIAKLTG* |
| Ga0129327_104349702 | 3300013010 | Freshwater To Marine Saline Gradient | ELERQKIDLENQLELLGYSGNLVRMHQIEEEIYEIQDTIRKLLP* |
| Ga0171651_10193831 | 3300013115 | Marine | QKVILEDRLEHLSYTGNMVKMVEIEQEIYEIEDTIRKLTA* |
| Ga0182078_101983973 | 3300016747 | Salt Marsh | ELESRLEMLSYSNNLVRMVEIEQEIAEIEDTIRKLLP |
| Ga0180120_102282301 | 3300017697 | Freshwater To Marine Saline Gradient | KIELENQLELLGYSGNLLRMHQIEEEIFEIEDTITKLIK |
| Ga0181391_10326411 | 3300017713 | Seawater | IDLDNKAEMMGYSGNLVKMHQIEEEIYEIEDTIRKLLP |
| Ga0181391_10691231 | 3300017713 | Seawater | RQKIDLENQLEMLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0181390_10700351 | 3300017719 | Seawater | QKIELENRLETLGYSGNLVKMHHIEEEIYEIEDTIRKLLP |
| Ga0181398_10115171 | 3300017725 | Seawater | RQKIELENQLETLGYSGNLVRMHQIEEEIFEIEDTIKKLIA |
| Ga0181422_11623541 | 3300017762 | Seawater | KRLEMLSYSKNTVKITEIEQEIYEINDTITKLKGSI |
| Ga0181413_11776863 | 3300017765 | Seawater | LEDRLEMISYAGNLVKMHEIESEIYEIEDTIRKLTA |
| Ga0181413_12072421 | 3300017765 | Seawater | KIDLDNKAEMMGYSGNLVKMHQIEEEIYEIEDTIRKLLP |
| Ga0187220_12193891 | 3300017768 | Seawater | QMERQKIDLENQLELLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0181394_10485483 | 3300017776 | Seawater | IDLNDQLETLGYSGNLVRMHKIEEEIYEVEDTIQKLIK |
| Ga0181423_11297212 | 3300017781 | Seawater | IILEDRLEHLGYAGNLVRMHKIEEEIFEIEDTIAKLTS |
| Ga0181552_102989451 | 3300017824 | Salt Marsh | ERQKLDLEDRLEMLSYANNLVKMVEIEQEIYEIEDTIRKLLP |
| Ga0181583_104706071 | 3300017952 | Salt Marsh | AELERQKIELNDQLEILGYTGNLVRMHQIEEQIFEIEDTIKKLLA |
| Ga0181583_107251152 | 3300017952 | Salt Marsh | LNDQLEILGYSGNLVRMHELEQEIFEIDDTLKKLTNH |
| Ga0181582_100903371 | 3300017958 | Salt Marsh | LERQKIELQNRLEMLSYSTNLVRMVEIEQEIDEIEDTIRKLLP |
| Ga0181581_101737491 | 3300017962 | Salt Marsh | IAELERQKLDLEDRLEMLSYANNLVKMVEIEQEIYEIEDTIRKLLP |
| Ga0181589_102279141 | 3300017964 | Salt Marsh | ELERQKIELNDQLEILGYSGNLVRMHQIEEQIFEIEDTIKKLTS |
| Ga0181590_102219061 | 3300017967 | Salt Marsh | LERQKIELNDQLETLGYTGNLVRMHEIEQEIFEIEDTIKKLTN |
| Ga0181590_102220221 | 3300017967 | Salt Marsh | RIAELERQKIELNDQLEILGYSGNLVRMHQIEEQIFEIEDTIKKLTA |
| Ga0181576_107022081 | 3300017985 | Salt Marsh | IELNDQLEILGYTGNLVRMHQIEEQIYEIDDTIAKLIK |
| Ga0181572_104416101 | 3300018049 | Salt Marsh | RIAELERQKIELNDQLEILGYSGNLVKMHQIEEQIFEIEDTIKKLTA |
| Ga0181560_103509811 | 3300018413 | Salt Marsh | RIADLERQKIDLEGQLELLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0181559_104653671 | 3300018415 | Salt Marsh | ADLERQKIELQNRLEMLSYTNNMVKMVEIEQEIDEINDTIGKLLP |
| Ga0181553_106105511 | 3300018416 | Salt Marsh | DLERQKIDLQDRLETLGYSGNLVRMHKLEEEIFEIEDTIKKLTS |
| Ga0181553_107494281 | 3300018416 | Salt Marsh | EGQLELLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0181563_106086881 | 3300018420 | Salt Marsh | ERQKIDLEGQLELLGYSGNLVKMHQIEEEIYEIEDTIRKLLP |
| Ga0181592_102408563 | 3300018421 | Salt Marsh | RIAELERQKIELNDQLEILGYSGNLVRMHQIEEQIFEIEDTIKKLTS |
| Ga0181568_114322901 | 3300018428 | Salt Marsh | RQKIELQNRLEMLSYTNNMVKMVEIEQEIDEINDTIGKLLP |
| Ga0194024_11326492 | 3300019765 | Freshwater | NDQLEILGYTGNLVRMHQIEEQIFEIEDTIKKLTA |
| Ga0211627_10513142 | 3300020250 | Marine | RIADLERQKIELENRLETLGYSGNLVRMHELEQEIYEIEDTIRKLLP |
| Ga0211519_10124064 | 3300020266 | Marine | EDRLETLGYSANLVRMHEIEEQIFEIEDTIQKLVK |
| Ga0211498_102216921 | 3300020380 | Marine | VELENRLEHLGYSGNLVRMHEIEQEIYEIEDTIRKLLP |
| Ga0211476_102392221 | 3300020381 | Marine | KLRIRDLEQQKIELENRLELLGYSNNLVKMHQIEEEIYEIEDTIRKLMP |
| Ga0211675_101442861 | 3300020391 | Marine | ELESRLEMLSYANNHIRMVEIEQEIYEIDDTIRKLMP |
| Ga0211687_103849231 | 3300020396 | Marine | LENQLELLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0211659_103148792 | 3300020404 | Marine | RQKIELENRLEFLGYSNNLVRMHKIEEEIFEIEDTIAKLIS |
| Ga0211699_102160501 | 3300020410 | Marine | EDRLEMISYSGNLVKMHEIESEIYEIEDTICKLTA |
| Ga0211644_101057521 | 3300020416 | Marine | EGQKIILEDRLEMLGYSGNLVKMHKIEEEIFEIEDTIAKLTA |
| Ga0211580_103802541 | 3300020420 | Marine | EGEKIILEDRLEHLSYSGNLVKMHEIESEIYEIEDTIRKLTA |
| Ga0211622_101344364 | 3300020430 | Marine | KIELENQLEMLGYSGNLVRMHQIEEEIYEIEDTIRKLIP |
| Ga0211576_101665441 | 3300020438 | Marine | KIILEDRLEHLGYAGNLVRMHKIEEEIFEIEDTIAKLTS |
| Ga0211518_104471001 | 3300020440 | Marine | QKIELEDRLETLGYSGNLVKMHQIEEEIYEIEDTIRKLMP |
| Ga0211691_100969151 | 3300020447 | Marine | VILEDRLEHLSYTDNMVKMVEIENEIFEIEDTIKKLTI |
| Ga0211548_103401131 | 3300020454 | Marine | RQKIVLEDRLEYVGNNLVKMHQIEQEIFEIEDTIGKLTA |
| Ga0211577_106439651 | 3300020469 | Marine | QKIELENQLELLGYSGNLLRMHQIEEEIFEIEDTITKLIK |
| Ga0206678_102943273 | 3300021084 | Seawater | IKNLERQKILLEDRLEHLSYTDNMVKMVELEQEIFEIEDTISKLTA |
| Ga0213858_100880221 | 3300021356 | Seawater | DLERQKIELEDQLETLGYAGNLVRMHELEEQIFEIEDTIKKLIAQ |
| Ga0206685_101523243 | 3300021442 | Seawater | VRELEGQKVILEDRLEHLGYSGNLVRMVEIEQEIYEIEDTISKLTA |
| Ga0222718_100959661 | 3300021958 | Estuarine Water | IELENQLEMLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0222718_101366913 | 3300021958 | Estuarine Water | KIELNDQLEILGYTGNLVRMHELENEIFEIEDTIKKLLA |
| Ga0222718_104054191 | 3300021958 | Estuarine Water | LERQKIELNDQLEILGYTGNLVKMHEIEQEIFEIEDTIKKLTN |
| Ga0222719_101043277 | 3300021964 | Estuarine Water | ERQKIELENQLELLGYSGNLVRMHQIEEEIYEIQDTIRKLLP |
| Ga0222719_102150532 | 3300021964 | Estuarine Water | AELERQKIELNDQLEILGYTGNLVKMHEIEEQIFEIEDTIKKLTL |
| Ga0222719_103443241 | 3300021964 | Estuarine Water | RIANLERQKIELNDQLEILGYTGNLVKMHEIEQEIFEIEDTIKKLTN |
| Ga0222632_10298451 | 3300022842 | Saline Water | KIDLEGRLEMLGYSNNLVKMVKIEEEIFEIEDTIKKLLP |
| Ga0255779_12505033 | 3300022922 | Salt Marsh | DLERQKIELQNRLEMLSYTNNMVKMVEIEQEIDEINDTIGKLLP |
| Ga0255770_101422125 | 3300022937 | Salt Marsh | LDLEDRLEMLSYANNLVKMVEIEQEIYEIEDTIRKLLP |
| Ga0255782_103125103 | 3300023105 | Salt Marsh | ADLERQKIDLEGQLELLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0255760_104779681 | 3300023115 | Salt Marsh | RIAELERQKLDLEDRLEMLSYANNLVKMVEIEQEIYEIEDTIRKLLP |
| Ga0255766_101710811 | 3300023172 | Salt Marsh | DLERQKIELNDQLEILGYTGNLVRMHQIEEQIFEIEDTIKKLIK |
| Ga0255772_104778022 | 3300023176 | Salt Marsh | ELNDQLETLGYTGNLVRMHEIEQEIFEIEDTIKKLTN |
| Ga0222676_10471812 | 3300023240 | Saline Water | IRELEGQKVILEDRLEHLGYANNLVRMHEVEEQIFEIEDTIKKLVS |
| Ga0222670_10488741 | 3300023294 | Saline Water | IRELEGQKVILEDRLEHLGYANNLVKMHEVEEQIFEIEDTIKKLVG |
| Ga0209336_100491845 | 3300025137 | Marine | VMLEDRLEHLGYASNLVKMHEIESEIFEIEDTIKKLVS |
| Ga0208646_10645542 | 3300025425 | Saline Lake | RIRELEGQKVILEDRLEHLGYANNLVKMHEVEEEIFEIEDTIQKLIK |
| Ga0208149_11228151 | 3300025610 | Aqueous | RQKIDLENQLELLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0209041_11633151 | 3300025623 | Marine | LERQKIELNNQLEFLGYSGNLVRMHKIEEEIYEIDDTIKKLIK |
| Ga0208428_11616372 | 3300025653 | Aqueous | IDLENQLELLGYSGNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0209601_11709701 | 3300025666 | Pelagic Marine | QKIDLENQLELLGYSGNLVRMHELENEIYEIEDTIRKLLP |
| Ga0209306_11442291 | 3300025680 | Pelagic Marine | ILLEDRMEHLGYASNLVKMHEIEEEIFEIEDTIQKLIK |
| Ga0209306_11600461 | 3300025680 | Pelagic Marine | LENQLETLGYANNLVRMHQIEEEIYEIEDTIRKLLP |
| Ga0209199_10445801 | 3300025809 | Pelagic Marine | GMERQKIELENQLELLGYSGNLLRMHQIEEEIFEIEDTITKLIK |
| Ga0209199_12469441 | 3300025809 | Pelagic Marine | LNNQLEFLGYSGNLVRMHELENEIYEIEDTIRKLLG |
| Ga0208785_10748693 | 3300025815 | Aqueous | DLERQKIELENQLETLGYSGNLVRMHQIDEEIYEIEDTIRKLLP |
| Ga0209193_10481393 | 3300025816 | Pelagic Marine | RIAELERQKIELNDQLELLGYSGNLVRMHKIEEEIFEIEDTIA |
| Ga0209600_10444741 | 3300025821 | Pelagic Marine | ARIADLERQKIELNNQLEFLGYSGNLVRMHELENEIYEIEDTIRKLLG |
| Ga0208917_12136781 | 3300025840 | Aqueous | RQKIELNDQLEILGYTGNLVRMHQIEEQIFEIEDTIKKLIK |
| Ga0209223_102078891 | 3300025876 | Pelagic Marine | DLERQKIELENQLETLGYSGNLVRMHQIEEEIYEIQDTIRKLLP |
| Ga0209632_102805232 | 3300025886 | Pelagic Marine | ERQKIELNNQLEFLGYSGNLVRMHELENEIYEIEDTIRKLLGRQ |
| Ga0209962_10440803 | 3300026125 | Water | QKIELENQLELLGYSGNLVRMHQIEEEIYEIQDTIRKLLP |
| Ga0209071_11599562 | 3300027686 | Marine | DLEGQKILLEDRLEHLGYASNLVKMHETESEIFEIEDTIKKLLG |
| Ga0209830_104164721 | 3300027791 | Marine | LEDRLEHLGYSGNLVRMHEIEEEIFEIEDTIQKLIK |
| Ga0209830_104822762 | 3300027791 | Marine | EDRLEHLGYAGNLVKMHEVEEEIFEIEDTIRKLIK |
| Ga0209091_103597801 | 3300027801 | Marine | LEDRLEHLGYAGNLAKMHEVEEQIFEIEDTIKKLIG |
| Ga0209090_102065234 | 3300027813 | Marine | VILEDRLEHLGYASNLVKMHEVEEQIFEIEDTIKKLIS |
| Ga0209501_105631502 | 3300027844 | Marine | LEDRLEHLGYASNLVKMHEVEEQIFEIEDTIKKLVS |
| Ga0233450_100699631 | 3300028115 | Salt Marsh | KIELENQLELLGYSGNLVRMHQIEEEIYEIQDTIRKLLP |
| Ga0257114_11966761 | 3300028196 | Marine | IRELEGQKVILEDRLEHLGYAGNLVRMHEVEEQIYEIEDTIKKLIG |
| Ga0308022_10298627 | 3300031142 | Marine | EDRLEHLGYASNLVKMHKIEEEIFEIEDTIAKLTA |
| Ga0308010_12180961 | 3300031510 | Marine | EGQKVILEDRLEHLGYAGNLVKMHELENEVYEIEDTIRKLLG |
| Ga0307488_103894014 | 3300031519 | Sackhole Brine | LEDRMEHLGYSGNLVKMHEIEEEIFEIDDTILKLTA |
| Ga0308007_101664592 | 3300031599 | Marine | KVILEDRLEHLGYASNLVKMHEVEEQIFEIEDTIRKLVG |
| Ga0302132_103297771 | 3300031605 | Marine | LEDRLEHLGYASNLVKMHEVEEEIFEIEDTIRKLVG |
| Ga0302132_104040182 | 3300031605 | Marine | LEDRMEHLGYASNLVKMHEIEEEIFEIEDTIQKLIK |
| Ga0302114_100981072 | 3300031621 | Marine | RIRQLEGQKVILEDRLEHLGYASNLVKMHEVEEQIFEIEDTIKKLLG |
| Ga0302135_101830583 | 3300031625 | Marine | KIRDLEGQKIMLEDRMEHLGYSGNLVKMHEIEEEIFEIDDTILKLTA |
| Ga0302121_100223231 | 3300031626 | Marine | QKVILEDRLEHLGYASNLVKMHEVEEQIFEIEDTIKKLIS |
| Ga0302121_101103162 | 3300031626 | Marine | EGQKIMLEDRMEHLGYSGNLVKMHEIEEEIFEIEDTIRKLVG |
| Ga0302125_100334496 | 3300031638 | Marine | IRDLEGQKVILEDRLEHLGYASNLVKMHEIESEIFEIEDTIKKLVS |
| Ga0302125_101629492 | 3300031638 | Marine | RDLEGQKIMLEDRMEHLGYSGNLVKMHEIEEEIFEIEDTIRKLVG |
| Ga0302136_12339841 | 3300031676 | Marine | IMLEDRMEHLGYSGNLVKMHEIEEEIFEIEDTIRKLVG |
| Ga0302130_10266385 | 3300031700 | Marine | DLEGQKIMLEDRMEHLGYSGNLVKMHEIEEEIFEIEDTIRKLVG |
| Ga0315328_107308062 | 3300031757 | Seawater | QKVILEDRLEFLGYSGNLVKMHEIEQEIYEIDDTIAKLTA |
| Ga0315334_102964552 | 3300032360 | Seawater | KIILEGNLEHLSYTNNYVKMVEIENEIFEIEDTIKKLTI |
| Ga0315334_103329756 | 3300032360 | Seawater | VILEDRLEHLGYSGNLVRMVEIEQEIYEIEDTISKLTA |
| Ga0310342_1011112664 | 3300032820 | Seawater | KIALEDQLEFVGNNLVKMHDLEEQIFEIEDTIRKLTA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |