NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F038686

Metagenome / Metatranscriptome Family F038686

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F038686
Family Type Metagenome / Metatranscriptome
Number of Sequences 165
Average Sequence Length 73 residues
Representative Sequence MHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASGVSSGAL
Number of Associated Samples 146
Number of Associated Scaffolds 165

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.02 %
% of genes near scaffold ends (potentially truncated) 96.36 %
% of genes from short scaffolds (< 2000 bps) 89.70 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.273 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(25.455 % of family members)
Environment Ontology (ENVO) Unclassified
(74.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(80.606 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.74%    β-sheet: 0.00%    Coil/Unstructured: 75.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.18 %
UnclassifiedrootN/A1.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10132046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium883Open in IMG/M
3300001450|JGI24006J15134_10255526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium501Open in IMG/M
3300001472|JGI24004J15324_10153254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium530Open in IMG/M
3300001720|JGI24513J20088_1004630All Organisms → Viruses → Predicted Viral1948Open in IMG/M
3300002153|JGI24540J26637_10061092All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1165Open in IMG/M
3300002153|JGI24540J26637_10157552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium603Open in IMG/M
3300002154|JGI24538J26636_10013718All Organisms → cellular organisms → Bacteria → Proteobacteria2016Open in IMG/M
3300002186|JGI24539J26755_10007954All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCGC AAA164-I214313Open in IMG/M
3300002482|JGI25127J35165_1115927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium532Open in IMG/M
3300002488|JGI25128J35275_1074020All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia706Open in IMG/M
3300002514|JGI25133J35611_10025480All Organisms → cellular organisms → Bacteria2275Open in IMG/M
3300004113|Ga0065183_10703088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium530Open in IMG/M
3300005821|Ga0078746_1031482All Organisms → Viruses → Predicted Viral1115Open in IMG/M
3300005920|Ga0070725_10495096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium550Open in IMG/M
3300006026|Ga0075478_10187837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium634Open in IMG/M
3300006421|Ga0082247_10019123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium977Open in IMG/M
3300006467|Ga0099972_12050730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium928Open in IMG/M
3300006637|Ga0075461_10238139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium536Open in IMG/M
3300006737|Ga0098037_1271989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium539Open in IMG/M
3300006749|Ga0098042_1150063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium571Open in IMG/M
3300006790|Ga0098074_1180855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium529Open in IMG/M
3300006802|Ga0070749_10723330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium531Open in IMG/M
3300006803|Ga0075467_10663171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium532Open in IMG/M
3300006810|Ga0070754_10226080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium863Open in IMG/M
3300006810|Ga0070754_10251516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium807Open in IMG/M
3300006916|Ga0070750_10316641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium664Open in IMG/M
3300006919|Ga0070746_10238604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium853Open in IMG/M
3300007344|Ga0070745_1354440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium514Open in IMG/M
3300007346|Ga0070753_1292650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium583Open in IMG/M
3300007346|Ga0070753_1369715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium502Open in IMG/M
3300007539|Ga0099849_1196979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium759Open in IMG/M
3300007544|Ga0102861_1034121All Organisms → Viruses → Predicted Viral1297Open in IMG/M
3300007554|Ga0102820_1131672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium602Open in IMG/M
3300007640|Ga0070751_1078780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1387Open in IMG/M
3300007871|Ga0111032_1081922All Organisms → Viruses → Predicted Viral1364Open in IMG/M
3300007956|Ga0105741_1092240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium740Open in IMG/M
3300007974|Ga0105747_1128809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium807Open in IMG/M
3300008012|Ga0075480_10238972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium944Open in IMG/M
3300008219|Ga0114905_1157491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium753Open in IMG/M
3300009136|Ga0118735_10328056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium531Open in IMG/M
3300009412|Ga0114903_1118416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium582Open in IMG/M
3300009412|Ga0114903_1122347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium572Open in IMG/M
3300009422|Ga0114998_10605847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium516Open in IMG/M
3300009436|Ga0115008_10967919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium633Open in IMG/M
3300009544|Ga0115006_10666167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium914Open in IMG/M
3300009602|Ga0114900_1150299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium603Open in IMG/M
3300009605|Ga0114906_1203207All Organisms → cellular organisms → Bacteria → Proteobacteria662Open in IMG/M
3300009677|Ga0115104_10020183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium705Open in IMG/M
3300010148|Ga0098043_1219637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium522Open in IMG/M
3300011253|Ga0151671_1010134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium500Open in IMG/M
3300011261|Ga0151661_1174445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1357Open in IMG/M
3300012952|Ga0163180_11446631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium572Open in IMG/M
3300012953|Ga0163179_11167944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium679Open in IMG/M
3300013188|Ga0116834_1086494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium637Open in IMG/M
3300017710|Ga0181403_1014436All Organisms → Viruses → Predicted Viral1691Open in IMG/M
3300017717|Ga0181404_1181912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium502Open in IMG/M
3300017719|Ga0181390_1158027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium566Open in IMG/M
3300017724|Ga0181388_1090888All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300017725|Ga0181398_1147862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium557Open in IMG/M
3300017726|Ga0181381_1028964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1247Open in IMG/M
3300017731|Ga0181416_1143019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium576Open in IMG/M
3300017732|Ga0181415_1142031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium537Open in IMG/M
3300017737|Ga0187218_1150850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium549Open in IMG/M
3300017738|Ga0181428_1016564All Organisms → Viruses → Predicted Viral1700Open in IMG/M
3300017739|Ga0181433_1081510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium797Open in IMG/M
3300017740|Ga0181418_1001636All Organisms → cellular organisms → Bacteria → Proteobacteria7141Open in IMG/M
3300017743|Ga0181402_1176229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium535Open in IMG/M
3300017745|Ga0181427_1165509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium534Open in IMG/M
3300017746|Ga0181389_1138723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium653Open in IMG/M
3300017749|Ga0181392_1012707All Organisms → Viruses → Predicted Viral2739Open in IMG/M
3300017749|Ga0181392_1189909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium593Open in IMG/M
3300017750|Ga0181405_1032219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1422Open in IMG/M
3300017752|Ga0181400_1160736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium634Open in IMG/M
3300017752|Ga0181400_1201071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium549Open in IMG/M
3300017752|Ga0181400_1210025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium534Open in IMG/M
3300017753|Ga0181407_1168372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium537Open in IMG/M
3300017753|Ga0181407_1188108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium502Open in IMG/M
3300017755|Ga0181411_1157045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium653Open in IMG/M
3300017758|Ga0181409_1201772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium573Open in IMG/M
3300017759|Ga0181414_1021715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1750Open in IMG/M
3300017763|Ga0181410_1019977All Organisms → Viruses → Predicted Viral2216Open in IMG/M
3300017764|Ga0181385_1132623All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.759Open in IMG/M
3300017764|Ga0181385_1197092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium608Open in IMG/M
3300017765|Ga0181413_1181241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium631Open in IMG/M
3300017768|Ga0187220_1059849All Organisms → Viruses → Predicted Viral1146Open in IMG/M
3300017768|Ga0187220_1206768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium591Open in IMG/M
3300017772|Ga0181430_1139863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium706Open in IMG/M
3300017779|Ga0181395_1152253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium728Open in IMG/M
3300017783|Ga0181379_1294666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium552Open in IMG/M
3300017786|Ga0181424_10186820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium881Open in IMG/M
3300020388|Ga0211678_10109495All Organisms → Viruses → Predicted Viral1216Open in IMG/M
3300020419|Ga0211512_10570715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium500Open in IMG/M
3300021379|Ga0213864_10395797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium697Open in IMG/M
3300021957|Ga0222717_10422756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium732Open in IMG/M
3300022065|Ga0212024_1070276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium621Open in IMG/M
3300022071|Ga0212028_1098688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium544Open in IMG/M
3300022072|Ga0196889_1058496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium738Open in IMG/M
3300022164|Ga0212022_1031249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium817Open in IMG/M
3300022178|Ga0196887_1122259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium558Open in IMG/M
3300022187|Ga0196899_1082517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium981Open in IMG/M
(restricted) 3300022938|Ga0233409_10111064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium875Open in IMG/M
(restricted) 3300023114|Ga0233405_10029400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium807Open in IMG/M
(restricted) 3300024059|Ga0255040_10191432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium835Open in IMG/M
(restricted) 3300024059|Ga0255040_10320061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium650Open in IMG/M
(restricted) 3300024062|Ga0255039_10278750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium710Open in IMG/M
(restricted) 3300024062|Ga0255039_10366263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium620Open in IMG/M
3300024235|Ga0228665_1024463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1234Open in IMG/M
3300024235|Ga0228665_1033145All Organisms → cellular organisms → Bacteria → Proteobacteria1061Open in IMG/M
3300024322|Ga0228656_1056635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium868Open in IMG/M
(restricted) 3300024338|Ga0255043_10154502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium776Open in IMG/M
3300024343|Ga0244777_10945050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium501Open in IMG/M
3300024348|Ga0244776_10787955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium576Open in IMG/M
(restricted) 3300024518|Ga0255048_10552293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium557Open in IMG/M
(restricted) 3300024520|Ga0255047_10062684All Organisms → Viruses → Predicted Viral1923Open in IMG/M
(restricted) 3300024520|Ga0255047_10094959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1532Open in IMG/M
(restricted) 3300024529|Ga0255044_10190256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium803Open in IMG/M
3300025071|Ga0207896_1004048All Organisms → Viruses → Predicted Viral2718Open in IMG/M
3300025071|Ga0207896_1007816All Organisms → Viruses → Predicted Viral1929Open in IMG/M
3300025079|Ga0207890_1080562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium505Open in IMG/M
3300025102|Ga0208666_1062605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1004Open in IMG/M
3300025120|Ga0209535_1216999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium519Open in IMG/M
3300025127|Ga0209348_1027053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium2087Open in IMG/M
3300025137|Ga0209336_10021598All Organisms → Viruses → Predicted Viral2279Open in IMG/M
3300025168|Ga0209337_1328253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium537Open in IMG/M
3300025251|Ga0208182_1088064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium574Open in IMG/M
3300025305|Ga0208684_1160436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium521Open in IMG/M
3300025610|Ga0208149_1010304All Organisms → cellular organisms → Bacteria → Proteobacteria2866Open in IMG/M
3300025621|Ga0209504_1145910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium569Open in IMG/M
3300025653|Ga0208428_1029175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1771Open in IMG/M
3300025653|Ga0208428_1070439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1025Open in IMG/M
3300025658|Ga0209659_1010421All Organisms → cellular organisms → Bacteria → Proteobacteria4232Open in IMG/M
3300025671|Ga0208898_1176581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium544Open in IMG/M
3300025771|Ga0208427_1171700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium704Open in IMG/M
3300025806|Ga0208545_1085990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium848Open in IMG/M
3300025853|Ga0208645_1050061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1997Open in IMG/M
3300025889|Ga0208644_1207164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium846Open in IMG/M
3300026136|Ga0208763_1001216All Organisms → Viruses → Predicted Viral4705Open in IMG/M
3300026495|Ga0247571_1016907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1499Open in IMG/M
3300026517|Ga0228607_1067571All Organisms → cellular organisms → Bacteria → Proteobacteria908Open in IMG/M
3300027687|Ga0209710_1099830All Organisms → Viruses → Predicted Viral1150Open in IMG/M
3300027757|Ga0208671_10118552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium968Open in IMG/M
3300027780|Ga0209502_10006980All Organisms → cellular organisms → Bacteria → Proteobacteria7883Open in IMG/M
3300027801|Ga0209091_10100566Not Available1556Open in IMG/M
(restricted) 3300027856|Ga0255054_10568480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium549Open in IMG/M
3300027883|Ga0209713_10022277All Organisms → cellular organisms → Bacteria → Proteobacteria4278Open in IMG/M
(restricted) 3300027996|Ga0233413_10033723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1940Open in IMG/M
(restricted) 3300028045|Ga0233414_10268401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium777Open in IMG/M
3300028282|Ga0256413_1048017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1478Open in IMG/M
3300028290|Ga0247572_1034395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1171Open in IMG/M
3300028334|Ga0247597_1038326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium641Open in IMG/M
3300028598|Ga0265306_10336904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium815Open in IMG/M
3300028599|Ga0265309_10161070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1381Open in IMG/M
3300031519|Ga0307488_10762258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium540Open in IMG/M
3300031569|Ga0307489_10493327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium832Open in IMG/M
3300031621|Ga0302114_10306715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium621Open in IMG/M
3300031622|Ga0302126_10030593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium2376Open in IMG/M
3300031622|Ga0302126_10047078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1823Open in IMG/M
3300031676|Ga0302136_1201049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium588Open in IMG/M
3300032088|Ga0315321_10571535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium674Open in IMG/M
3300032136|Ga0316201_10686402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium872Open in IMG/M
3300032212|Ga0316207_10286604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium622Open in IMG/M
3300032373|Ga0316204_10409286All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300034418|Ga0348337_199444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium501Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater25.45%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.21%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous17.58%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater5.45%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.45%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean4.24%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.64%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.82%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.82%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.21%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.21%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.21%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.21%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment1.21%
SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Sediment0.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.61%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.61%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.61%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.61%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.61%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.61%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.61%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.61%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.61%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300002153Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M MetagenomeEnvironmentalOpen in IMG/M
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300005821Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1EnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006421Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IEnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007871Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2EnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300009136Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsfEnvironmentalOpen in IMG/M
3300009412Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009602Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231EnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013188Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023114 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300024338 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025251Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes)EnvironmentalOpen in IMG/M
3300025305Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026517Seawater microbial communities from Monterey Bay, California, United States - 8DEnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032212Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyriteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1013204633300000116MarineMHISLDSALGRQRRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFSGSQIESGEMARWVNEQPTLPLDLRELDTNTGERDG
JGI24006J15134_1025552613300001450MarineMHVSLDSALGRQRRLNSVGESVLQIAPSATAAYSLRSLTGGDPKVVRVRRDTDNAEQDFTVSGVSSGALTSFTNAD
JGI24004J15324_1015325413300001472MarineMHVSLDSALGRQRRLNSVGESVLQIAPSATAAYSLRSLTGGDPKVVRVRRDTDNAEQDFTVSGVSSGALTSFTNADYAKYTSDF
JGI24513J20088_100463043300001720MarineMHISLDSALGRQRRLNSVGESALQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNH
JGI24540J26637_1006109243300002153MarineMHISLDSALGRQRRLNSVGESVFQIAPDASAGYSLRSLTGGDPSVVRVRRDSDNGERDFR
JGI24540J26637_1015755223300002153MarineMHISLDSALGRQRRLNSVGESVFQIAPDASAGYSLRSLTGGDPSVVRVRRDSDNGERDFRSSEINSGEMVSWVNQQLLNPLIFVS*
JGI24538J26636_1001371853300002154MarineMHISLDSALGRQRRLNSVGESVFQIAPDASAGYSLRSLTGGDPSVVRVRRDSDNGERDF
JGI24539J26755_1000795413300002186MarineMHISLDSALGRQRRLNSVGESVFQIAPDASAGYSLRSLTGGDPSVVRVRRDSDNGERD
JGI25127J35165_111592713300002482MarineMHISLDSALGRQRRLNSVGETISSIAPLAAAYSLRSLTGGDPRAVRVRRVIDNAESDFTASGISSGALVDFVNQIQTV
JGI25128J35275_107402013300002488MarineMHVSLDSALGQQRRLNQVGQTISSIATPTVAYSLRSLTGGDPRVVRVRRESDNHEQDFTASEVSSGA
JGI25133J35611_1002548013300002514MarineMHISLDSALGRQKRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFSGSQIESGEMARWVNEQ
Ga0065183_1070308823300004113Pelagic MarineMHISLDSALGRQRRLNSVGESVFQIAPNPSAGYSLRSLTGGDPAVVRVRRASDNSEKDFNSSGVSSGELVNWVNAQVVPPLDVRELVDGERTGALI
Ga0078746_103148233300005821Marine SedimentMHISLDSALGRQRRLNSVGESVFQIAPNPSAGYSLRSLTGGDPAVVRVRRASDNSEKDFNSSGVSS
Ga0070725_1049509633300005920Marine SedimentMHVSLDSALGRQRRLNSVGESFLQIAPSAAAAYSLRSLTSGDPKVVRVRRGSDNHEQDFTAS
Ga0075478_1018783713300006026AqueousMHISLDSALGRQRRLNSVGESVLQIAPNAKAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEDFTASGI
Ga0082247_1001912313300006421SedimentMHISLDSALGRQRRLNSVGESVFQIAPDASAGYSLRSLTGGDPSVVRVRRDSDNGERDFRSSEINSGEMVSWVNQQVIAPLDIRELEAD
Ga0099972_1205073033300006467MarineMHTSLDSALGRQRRLNQVGESITQIAPDPAAAYSLRSLTGSDPKVVRVRRGSDNHEQDFT
Ga0075461_1023813913300006637AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAKAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEDFTASGI
Ga0098037_127198923300006737MarineMHVSLDSALGRQRRLNSVGDSVLQIAPSAAAAYSLRSLTGGDPKVVRVRRSSGGEKDFTASGV
Ga0098042_115006313300006749MarineMHVSLDSALGRQRRLNSVGESVLQIAPNAKAAYSLRNLTGGDPKVVRVRRDTGGAAGDNDEQDFTVSGISSCALVDFV
Ga0098074_118085513300006790MarineMHISLDSALGQQRRLNQVGESVTQIAPDPAAAYSLRSLTGGDPKVVRVRRESDNHEQDFTASEVSSGAL
Ga0070749_1072333023300006802AqueousMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFRASDVSSGALVDFVNAQVVAPLD
Ga0075467_1066317113300006803AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNATAAYSLRSLTGGDPKVVRVRRGSDNHEQDFTASEVSSGA
Ga0070754_1022608013300006810AqueousMHISLDSALGRQRRLNSVGESALQLAPGATAAYSLRSLTGADPMVVRVRRSSDDAEQDF
Ga0070754_1025151633300006810AqueousMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRASDNSEKDFNSSGVSSGELVNWVN
Ga0070750_1031664113300006916AqueousMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEDFTA
Ga0070746_1023860413300006919AqueousMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRASDNSEKDFNSSGVSSGELVNWVNAQIVPPLDVRE
Ga0070745_135444023300007344AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPTVVRVRRASDNHEQDFI
Ga0070753_129265013300007346AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPTVVRVRRDTDGGAGDNDEQDFTASEVSSGALVDFV
Ga0070753_136971523300007346AqueousMHISLDSALGRQRRLNSVGESVLQIAPNAKAAYSLRSLTGGDPKVVRVRRDTGGG
Ga0099849_119697933300007539AqueousMHISLDSALGRQRRLNSVGESVLQIAPDAAAAYSLRSLTGVDPNVVRVRRETDNTEK
Ga0102861_103412133300007544EstuarineMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDNAERDFNASGVSSGELVNWVNQQITPPLDLRELT
Ga0102861_108198233300007544EstuarineMHVSLDSALGRQRRLNSVGESVLQIAPDAAAAYSLRSLTGGDPKVVRVRRKSDNAEEDFTASGVTSGALTSFVNEDVTIYQSDFSAGIDGFNATSTTTATGNQDGVSDSVGTTKDNVLK
Ga0102820_113167213300007554EstuarineMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDNAERDFNASGVSSGE
Ga0070751_107878033300007640AqueousMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFTASEVSSGALVDFVNAQVVAPLDIQALSATGR
Ga0111032_108192233300007871Marine SedimentMHTSLDSALGRQRRLNQVGESITQIAPDPAAAYSLRSLTGSDPKVVRVRRGSDNHEQDFTASEVSVSYTHLRAHETVLDLVCRLLL
Ga0105741_109224013300007956Estuary WaterMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDN
Ga0105747_112880913300007974Estuary WaterMHVSLDSALGRQRRLNSVGESVLQIAPGATAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEDF
Ga0075480_1023897213300008012AqueousMNLSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFTASEVSSGALT
Ga0114905_115749133300008219Deep OceanMHISLDSALGQQRRLNQVGESITQIAPDPTAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEQDFTASGISSG
Ga0118735_1032805613300009136Marine SedimentMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFTASDVSSGALQDFVNAQVVAPLD
Ga0114903_111841633300009412Deep OceanMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHE
Ga0114903_112234713300009412Deep OceanMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASDVSSGALQDFV
Ga0114998_1060584723300009422MarineMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRDTDGGAGDNDEQ
Ga0115008_1096791933300009436MarineMHISLDSALGRQRRLNSVGDSVLQIAPNAAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFTASGVSSGALTSFVNAQVVAPLDIQALSA
Ga0115006_1066616733300009544MarineMHISLDSALGRQRRLNSVGESVFQIAPDASAGYSLRSLTGGDPSVVRVRRDSDNGERDFRSSEINSGE
Ga0114900_115029913300009602Deep OceanMHISLDSALGQQRRLNSVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASDVSSGALQDFVNAQVVAPLDIQ
Ga0114906_120320733300009605Deep OceanMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNH
Ga0115104_1002018333300009677MarineMHISLDSAIGQQRRLNQVGETISSIAAPAAAYSLRSLTGGDPKVVRVRREGDNGEQDFTVSEINS*ALVDYINTNGVFQN
Ga0098043_121963723300010148MarineMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRDTGGAAGDND
Ga0151671_101013413300011253MarineMHVSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASGVSSGALTSFVNAQVVAPLDIQA
Ga0151661_117444513300011261MarineMHISLDSALGRQRRLNSVGESVLQIAPSATAAYSLRSLTGGDPTVVRLRRPHDDERDFTSS*
Ga0163180_1144663123300012952SeawaterMHISLDSALGQQRRLNSVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRGSESERGELDGRD*
Ga0163179_1116794413300012953SeawaterMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRGSDNSEQDFTVSEINSGALVDFV
Ga0116834_108649433300013188MarineMHISLDQALGRQPRLNRVGQSLLNIASGASAAYSLRSLTGGDPKVVNVRRDADDEER
Ga0181403_101443643300017710SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPTVVRVRRGSDNHEQDVTASEVSA
Ga0181404_118191223300017717SeawaterMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASGVSSGALTSFVIAQVVAPLD
Ga0181390_115802723300017719SeawaterMHISLDSALGQQRRLNSVGESITQIAPDPAAAYSLRSLTGSDPKVVRVRRGSDNHEQDF
Ga0181388_109088833300017724SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRDTDN
Ga0181398_114786213300017725SeawaterMHISLDSALGQQRRLNSVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASDVSSGALLDFVNAQVTAPL
Ga0181381_102896433300017726SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNH
Ga0181416_114301923300017731SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEQDFT
Ga0181415_114203113300017732SeawaterMHLSLDSALGRQRLLSSGDPSALQIAPGATAAYSLRSLTGGDPLAVRVRRSSDDAEADFKVSEITSGALITHVGSGN
Ga0187218_115085023300017737SeawaterMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRKSDNAEEDFT
Ga0181428_101656413300017738SeawaterMHISLDSALGRQRRLNSVGESVLQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASGVSSGALVNFVNAQVTAPLDIQALSAT
Ga0181433_108151033300017739SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRSSDDAEQDFTVSEINSGALV
Ga0181418_1001636113300017740SeawaterMNLSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNHE
Ga0181402_117622913300017743SeawaterMHVSLDSALGRQRRLNQIGESITQIAPDPAAAYSLRSLTGSDPKVVRVRRGSDNHEQDFTASEVSSGALLDFVNAQVVAPL
Ga0181427_116550923300017745SeawaterMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGSDPKVVRVRRGSDNHEQEFTASDVSSGAL
Ga0181389_113872323300017746SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPRVVRVRRDTGGGAGDNDEEDFTASGISSGALV
Ga0181392_101270763300017749SeawaterMHISLDSAIGQQRRLNSLGETITSIAAPAAAYSLRSLTGGDPKVVRVRRESDNTERDFTASDVNSGALVDFVNTQ
Ga0181392_118990923300017749SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAKAAYSLRSLTGGDPKVVRVRRVIDNGESDFTASGISSGALVDFVNQIQTVGTAVNG
Ga0181405_103221913300017750SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPTVVRVRRGSDNHEQDFTASGVSSGALTSFVNAQVVAPLDIQALSATG
Ga0181400_116073613300017752SeawaterMHISLDSALGQQRRLNSVGESITQIAPDPAAAYSLRSLTGSDPKVVRVRRGSDNHEQDFTASDVSSGALLDFVNSQVTAPLDIQALSA
Ga0181400_120107113300017752SeawaterMHISLDSAIGQQRRLNQVGETINSIAAPAAAYSLRSLTGGYPLVVRVRRDSDNTEKDFTA
Ga0181400_121002513300017752SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPGATAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEDFTA
Ga0181407_116837213300017753SeawaterMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRDTGGAAGDNDEQDF
Ga0181407_118810813300017753SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRDTGGAAGDNDEQDF
Ga0181411_115704513300017755SeawaterMHISLDSALGRQRRLNSVGENVLQIAPDAAAAYSLRSLTGGDPKVVRVRRGSDDTEEDFTASGVSSGALTSFVNEDVTIYQSDYSADANGWSGSTSLPTG
Ga0181409_120177223300017758SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNATAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEVFTASGISSGALVDFVGSGNDGFV
Ga0181414_102171513300017759SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPTVVRVRRGSDNHEQDFT
Ga0181410_101997753300017763SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAGYSLRSFTGGDPTVVRVRRGSDNHEQDFTASEVSAGALTSFVNAPVIA
Ga0181385_113262313300017764SeawaterNYTRSNMHISLDSALGQQRRLNQVGETINSIAAPAAAYSLRSLTGGDPKVVRVRRESDNTERDFTA
Ga0181385_119709213300017764SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFTSSEVSSGALLNFVN
Ga0181413_118124123300017765SeawaterMHISLDSALGRDQRLNSLGETINSIAAPAAAYSLRSLTGGDPKVVRVRREGDNGEQDFTVSEINSGALVDYINTNGVFQNTGYESFS
Ga0187220_105984933300017768SeawaterMHISLDSALGRDQRLNSLGETINSIAAPAAAYSLRSLTGGDPKVVRVRREGDNGEQDFTVSEINSGALVDYINTNGVFQNTGYE
Ga0187220_120676813300017768SeawaterMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFT
Ga0181430_113986313300017772SeawaterMHISLDSALGQQRRLNSVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEDFTASGISSGALVDF
Ga0181395_115225313300017779SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPSATAAYSLRSLTGGDPKVVRVRRVIDNAESDFTASGISSGALVDFVNDIQT
Ga0181379_129466613300017783SeawaterMHISLDSALGRQRRLNSVGESALQIAPNAAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFTASEVSSGALTSFTNADYTKYTSDFSAGDDGWGSLD
Ga0181424_1018682033300017786SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPTVVRVRRGSDNHEQDFTASEVSAGALTS
Ga0211678_1010949533300020388MarineMHISLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASDVSSGAL
Ga0211512_1057071523300020419MarineMHISLDSALGQQRRLNQVGESITQIAPNSTAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEED
Ga0213864_1039579733300021379SeawaterMHISLDSALGRQRRLNSVGESVLQIAPDAAAAYSLRSLTGGDPNVVRVRRETDNTEKDFS
Ga0222717_1042275633300021957Estuarine WaterMHVSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRDTDNAWQDFTASGVSSGALTSFTNADYAKYTSDFSSGDDSWGAF
Ga0212024_107027613300022065AqueousMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASDV
Ga0212028_109868823300022071AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGSPKVVRVRRASDNGERDFTSAEINSGEMVSWA
Ga0196889_105849633300022072AqueousMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRGSDNHEQDFTASEVS
Ga0212022_103124933300022164AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPTVVRVRRGSDNH
Ga0196887_112225913300022178AqueousMHTSLDSALGRQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPTVVRVRRGSDNHEQDFTASEVSAGALTSFV
Ga0196899_108251733300022187AqueousMHTSLDSALGRQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPTVVRVRRGSDNHEQDFTASEVSS
(restricted) Ga0233409_1011106433300022938SeawaterMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNERDFNASGVSSGELVNWVNEQITPPL
(restricted) Ga0233405_1002940033300023114SeawaterMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNERDFNASGVSSGELVNWVNEQITPPLDLRELTATGRDG
(restricted) Ga0255040_1019143233300024059SeawaterMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNERDFRSSEINSGG
(restricted) Ga0255040_1032006133300024059SeawaterMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDNAERDFN
(restricted) Ga0255039_1027875023300024062SeawaterMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNERDFNASGVSSGELVNWVNEQITPPLDLRELTATGRDGPIIEAAAAYS
(restricted) Ga0255039_1036626323300024062SeawaterMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDNAERDFNASGVSSGELVNWVNQQITP
Ga0228665_102446333300024235SeawaterMHISLDSALGRQKRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFSGSQIESGEMARWVNEQPTLPLDLRELDTNTGERDGALIEAAAA
Ga0228665_103314513300024235SeawaterMHISLDSALGRQRRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFS
Ga0228656_105663513300024322SeawaterMHISLDSALGRQKRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFS
(restricted) Ga0255043_1015450213300024338SeawaterMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNERDFNASGVSSGELVNWVNEQITPPLDLRELTATGRDGPI
Ga0244777_1094505013300024343EstuarineMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNE
Ga0244776_1078795523300024348EstuarineMHVSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEDFTASG
(restricted) Ga0255048_1055229313300024518SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGSPKVVRVRRASDNGERDFTSAEIN
(restricted) Ga0255047_1006268443300024520SeawaterMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNERDFNASGVSSGELVNWVNEQITPPLDLRELTATGRDGPIIEAAA
(restricted) Ga0255047_1009495913300024520SeawaterMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDNAERDFNASGVSSGELVNWVNQQITPPLDLRELTAT
(restricted) Ga0255047_1063082423300024520SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRKSDNAEEDFTASGISSGALVDFVNEDVTIYQSDFSAGIDGFTATSTTTATGNQ
(restricted) Ga0255044_1019025633300024529SeawaterMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNERDFNASGVSSGELVNWVNEQITP
Ga0207896_100404863300025071MarineMHVSLDSALGRQRRLNSVGESVLQIAPNATAAYSLRSLTGGDPKVVRVRRDTDNAEQDFTVSGVSSGALTSFTNADYAKYTSDFSSGDDSWGSF
Ga0207896_100781613300025071MarineMHISLDSALGRQRRLNSVGDSVLQIAPNASAAYSLRSLTGGDPKVVRVRRDTDNAEQDFTVSGVSSGALTSFTNADYAKYTSDFSSGDDSWGSF
Ga0207890_108056223300025079MarineMHISLDSALGRQRRLNSVGESVLQIAPNATAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASGVSSGALTSFVNAQVAAPLDIQALSATGR
Ga0208666_106260533300025102MarineMHISLDSAIGQQRRLNQVGETITSIAAPVVAYSLRSLTGGDPKVVRVRRSSDNGEQDFTVSGINSG
Ga0209535_121699913300025120MarineMHVSLDSALGRQRRLNSVGESVLQIAPNATAAYSLRSLTGGDPRAVRVRRSSDNAEQDFTSSGVSSGALTS
Ga0209348_102705353300025127MarineMHISLDSALGRQRRLNSVGESVLQIAPDPAAAYSLRSLTGGDPKVVRVRRGSDN
Ga0209336_1002159853300025137MarineMHISLDSALGRQRRLNSVGESALQIAPNAAAAYSLRSLTGGDPKVVRVRRASDN
Ga0209337_132825313300025168MarineMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRSSDNGESDFTVSGVS
Ga0208182_108806423300025251Deep OceanMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASDVSSGALQDFVNAQVTAPLDI
Ga0208684_116043623300025305Deep OceanMHISLDSALGQQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASDVSSGALQDFVNAQVTAPLDIQA
Ga0208149_101030463300025610AqueousMHNSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRSSGGEQDFTASEVASGAMLS
Ga0209504_114591023300025621Pelagic MarineMHISLDSALGRQRRLNSVGESVFQIAPNPSAGYSLRSLTGGDPAVVRVRRASDNSEKDFNSSGVSSGELVNW
Ga0208428_102917513300025653AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGSPKVVRVRRASDN
Ga0208428_107043913300025653AqueousMNLSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRDTDNAEQDFTASGVSSGALTSFTNADYAKYTSDFSSGDDSWGSFDDVTD
Ga0209659_101042113300025658MarineMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDNAE
Ga0208898_117658113300025671AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGSPKVVRVRRASDNGERDFTSAEINSGEMVSW
Ga0208427_117170033300025771AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNHEQDFTASGVSSGAL
Ga0208545_108599033300025806AqueousMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPTVVRVRRGSDNHEQDFTASQVSAGALTSFVNAQVVAPLDIQALEADG
Ga0208645_105006153300025853AqueousMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEEDFTASGIS
Ga0208644_120716413300025889AqueousMHVSLDSALGRQRRLNSVGESVLQIAPSAAAAYSLRSLTGGDPKVVRVRRDTGGGAGDNDEED
Ga0208763_100121683300026136MarineMHISLDSALGRQKRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFSGSQIESGEMARWVNEQPTLPLDLRELD
Ga0247571_101690743300026495SeawaterMHISLDSALGRQRRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFSGSQIESGEMARWVNEQPTLPLDLRELDTNTGERD
Ga0228607_106757113300026517SeawaterMHISLDSALGRQRRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDF
Ga0209710_109983033300027687MarineMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPSVVRVRRESDNGERDFNASGVSSGELVNWVNQQITPPLDLRELTATGRDGPIIEA
Ga0208671_1011855213300027757EstuarineMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPAVVRVRRESDNNERDFRSSEINSGGMVRWVNEQ
Ga0209502_10006980123300027780MarineMHVSLDSALGRQRRLNSVGESVLQIAPNASAAYSLRSLTGGDPRVVRVRRDTGGGAGDNDEQDFTASGISSGAL
Ga0209091_1010056613300027801MarineMHLSLNSALGRQRLLSSGVPSALQIAPGATAAYSLRSLTGGDPLAVRVRRSSDDAEADFKVSEITSGALITHVGSGNDGF
(restricted) Ga0255054_1056848013300027856SeawaterMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVCRASDNGERDFTSS
Ga0209713_1002227783300027883MarineMHISLDSALGRQRRLNSVGESVFQIAPDASAGYSLRSLTGGDPSVVRVRRDSDNGERDFRSSEIN
(restricted) Ga0233413_1003372353300027996SeawaterMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDNAERDFNSSGVSSGE
(restricted) Ga0233414_1026840113300028045SeawaterMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRESDNAERDLTLVA
Ga0256413_104801743300028282SeawaterMHISLDSALGRQRRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFSGSQIESGEMARWVNEQPTLPLDLRELD
Ga0247572_103439513300028290SeawaterMHISLDSALGRQKRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFSGSQIESGEMARWVNEQPTLPLDLRELDTNTGERDGALIEA
Ga0247597_103832633300028334SeawaterMHISLDSALGRQKRLNSVGESVLQIAPDAAAAYSLRSLTGGDPDVVRVRRESDNTEKDFSGSQIESGEMARWVNEQPTL
Ga0265306_1033690413300028598SedimentMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPSVVRVRRESDNGERDFRSSEINSGSMVRWVNE
Ga0265309_1016107013300028599SedimentMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPSVVRVRRESDNGERDFNASGVSS
Ga0307488_1076225813300031519Sackhole BrineMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNGERDFT
Ga0307489_1049332733300031569Sackhole BrineMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNGERDFTSSEITSGEMVSWVNRQV
Ga0302114_1030671513300031621MarineMHISLDSALGRQRRLNSVGESVFQIAPDAAAGYSLRSLTGGDPSVVRVRRESDNGERDFRSSEINSGSMVRWVNEQITPPLDLRELTATGRDGP
Ga0302126_1003059353300031622MarineMHISLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNGERDFTGSEITS
Ga0302126_1004707813300031622MarineMHVSLDSALGRQRRLNSVGESVLQIAPNAAAAYSLRSLTGGDPKVVRVRRASDNGERDFTGSEITS
Ga0302136_120104913300031676MarineMHVSLDSALGRQRRLNSVGESALQIASGATAAYSLRSLTGGDPRVVRVRRSNDDAEQDFTVSEIN
Ga0315321_1057153513300032088SeawaterMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRERDNAERDFNASGVSSGELVNW
Ga0316201_1068640213300032136Worm BurrowMHVSLDSALGRQRRLNSVGESVLQIAPDPAAAYSLRSLTGGDPKVVRVRRASDNGE
Ga0316207_1028660433300032212Microbial MatMHISLDSAIGQQRRLNQVGETINSIATPAAAYSLRSLTGGDPKVVRVRRESDNTERDFNASGVHSGALVD
Ga0316204_1040928613300032373Microbial MatMHISLDSALGRQRRLNSVGESVFQIAPNAAAGYSLRSLTGGDPAVVRVRRASDNSEKDFNSSGVSSGELVNWVNAQIVPPLDVRELVDGER
Ga0348337_199444_308_4993300034418AqueousMHTSLDSALGRQRRLNQVGESITQIAPDPAAAYSLRSLTGGDPTVVRVRRGSDNHEQDFTASEV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.