| Basic Information | |
|---|---|
| Family ID | F038675 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKLYQSKEWLYRRYVVQKKTVTEIGKECKVSAMTIQRYLEQFGLIKKR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 59.76 % |
| % of genes near scaffold ends (potentially truncated) | 43.03 % |
| % of genes from short scaffolds (< 2000 bps) | 67.27 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (63.636 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (11.515 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.121 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.121 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.11% β-sheet: 0.00% Coil/Unstructured: 57.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF02075 | RuvC | 21.21 |
| PF12705 | PDDEXK_1 | 8.48 |
| PF00535 | Glycos_transf_2 | 6.06 |
| PF04488 | Gly_transf_sug | 6.06 |
| PF05050 | Methyltransf_21 | 5.45 |
| PF12804 | NTP_transf_3 | 3.03 |
| PF07235 | DUF1427 | 2.42 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.42 |
| PF08241 | Methyltransf_11 | 2.42 |
| PF01755 | Glyco_transf_25 | 1.82 |
| PF13489 | Methyltransf_23 | 1.82 |
| PF09834 | DUF2061 | 1.82 |
| PF13578 | Methyltransf_24 | 1.21 |
| PF01370 | Epimerase | 1.21 |
| PF00565 | SNase | 1.21 |
| PF05257 | CHAP | 0.61 |
| PF16861 | Carbam_trans_C | 0.61 |
| PF13649 | Methyltransf_25 | 0.61 |
| PF09723 | Zn-ribbon_8 | 0.61 |
| PF00166 | Cpn10 | 0.61 |
| PF00154 | RecA | 0.61 |
| PF03796 | DnaB_C | 0.61 |
| PF01135 | PCMT | 0.61 |
| PF03354 | TerL_ATPase | 0.61 |
| PF07987 | DUF1775 | 0.61 |
| PF01467 | CTP_transf_like | 0.61 |
| PF03819 | MazG | 0.61 |
| PF14579 | HHH_6 | 0.61 |
| PF00011 | HSP20 | 0.61 |
| PF13662 | Toprim_4 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 21.21 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 6.06 |
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 2.42 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.61 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.61 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.61 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.61 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG4549 | Uncharacterized conserved protein YcnI, contains cohesin/reeler-like domain | Function unknown [S] | 0.61 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.00 % |
| Unclassified | root | N/A | 20.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10006733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4522 | Open in IMG/M |
| 3300001282|B570J14230_10206755 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300001838|RCM33_1072905 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300001847|RCM41_1001713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300001851|RCM31_10100690 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300002408|B570J29032_108922505 | Not Available | 541 | Open in IMG/M |
| 3300002835|B570J40625_100026153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9477 | Open in IMG/M |
| 3300002835|B570J40625_100085180 | All Organisms → cellular organisms → Bacteria | 4043 | Open in IMG/M |
| 3300002835|B570J40625_100288027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1676 | Open in IMG/M |
| 3300003277|JGI25908J49247_10085525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300003429|JGI25914J50564_10003986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4962 | Open in IMG/M |
| 3300003430|JGI25921J50272_10096148 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300003650|SLW30_100485 | All Organisms → cellular organisms → Bacteria | 2805 | Open in IMG/M |
| 3300004096|Ga0066177_10226014 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300004804|Ga0007796_10115273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 822 | Open in IMG/M |
| 3300005517|Ga0070374_10127948 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300005517|Ga0070374_10526407 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005527|Ga0068876_10205040 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005527|Ga0068876_10219846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
| 3300005528|Ga0068872_10102887 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300005580|Ga0049083_10000182 | All Organisms → cellular organisms → Bacteria | 19866 | Open in IMG/M |
| 3300005581|Ga0049081_10098872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1089 | Open in IMG/M |
| 3300005583|Ga0049085_10001859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8405 | Open in IMG/M |
| 3300005662|Ga0078894_10007201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8641 | Open in IMG/M |
| 3300005662|Ga0078894_10135579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2201 | Open in IMG/M |
| 3300005662|Ga0078894_10356196 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300005662|Ga0078894_10420327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
| 3300005662|Ga0078894_10815132 | Not Available | 816 | Open in IMG/M |
| 3300005941|Ga0070743_10169461 | Not Available | 722 | Open in IMG/M |
| 3300006030|Ga0075470_10117127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300006484|Ga0070744_10053587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
| 3300006484|Ga0070744_10075391 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300006484|Ga0070744_10106137 | Not Available | 811 | Open in IMG/M |
| 3300006639|Ga0079301_1011397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3296 | Open in IMG/M |
| 3300007551|Ga0102881_1180628 | Not Available | 583 | Open in IMG/M |
| 3300007562|Ga0102915_1069183 | All Organisms → Viruses → Predicted Viral | 1161 | Open in IMG/M |
| 3300007718|Ga0102852_1059776 | Not Available | 729 | Open in IMG/M |
| 3300007861|Ga0105736_1011534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1501 | Open in IMG/M |
| 3300007862|Ga0105737_1052790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300008107|Ga0114340_1004602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8689 | Open in IMG/M |
| 3300008107|Ga0114340_1146025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300008108|Ga0114341_10001123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 86719 | Open in IMG/M |
| 3300008108|Ga0114341_10132436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1472 | Open in IMG/M |
| 3300008110|Ga0114343_1065283 | Not Available | 1354 | Open in IMG/M |
| 3300008110|Ga0114343_1070465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1284 | Open in IMG/M |
| 3300008110|Ga0114343_1150867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 740 | Open in IMG/M |
| 3300008113|Ga0114346_1016450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4060 | Open in IMG/M |
| 3300008113|Ga0114346_1293565 | Not Available | 566 | Open in IMG/M |
| 3300008114|Ga0114347_1077787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2112 | Open in IMG/M |
| 3300008116|Ga0114350_1006898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5404 | Open in IMG/M |
| 3300008119|Ga0114354_1077482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1363 | Open in IMG/M |
| 3300008261|Ga0114336_1017680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6665 | Open in IMG/M |
| 3300008962|Ga0104242_1008461 | Not Available | 1829 | Open in IMG/M |
| 3300008996|Ga0102831_1254434 | Not Available | 580 | Open in IMG/M |
| 3300009026|Ga0102829_1093387 | Not Available | 934 | Open in IMG/M |
| 3300009152|Ga0114980_10193008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1199 | Open in IMG/M |
| 3300009158|Ga0114977_10000059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 73120 | Open in IMG/M |
| 3300009158|Ga0114977_10003088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10689 | Open in IMG/M |
| 3300009159|Ga0114978_10516549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300009159|Ga0114978_10627560 | Not Available | 619 | Open in IMG/M |
| 3300009183|Ga0114974_10002896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13088 | Open in IMG/M |
| 3300009183|Ga0114974_10106664 | All Organisms → Viruses → Predicted Viral | 1796 | Open in IMG/M |
| 3300009183|Ga0114974_10783536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300009419|Ga0114982_1192851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 630 | Open in IMG/M |
| 3300010354|Ga0129333_10504369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1060 | Open in IMG/M |
| 3300010354|Ga0129333_10606756 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300010370|Ga0129336_10487015 | Not Available | 666 | Open in IMG/M |
| 3300010885|Ga0133913_11916897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1476 | Open in IMG/M |
| 3300010885|Ga0133913_12972065 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300010885|Ga0133913_13412760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300010965|Ga0138308_101880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20077 | Open in IMG/M |
| 3300011011|Ga0139556_1000388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7303 | Open in IMG/M |
| 3300012000|Ga0119951_1055978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
| 3300012006|Ga0119955_1000087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 51789 | Open in IMG/M |
| 3300012017|Ga0153801_1012987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1500 | Open in IMG/M |
| 3300012665|Ga0157210_1021590 | Not Available | 1038 | Open in IMG/M |
| 3300012667|Ga0157208_10000846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7775 | Open in IMG/M |
| 3300012667|Ga0157208_10002177 | All Organisms → cellular organisms → Bacteria | 3928 | Open in IMG/M |
| 3300012667|Ga0157208_10009429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
| 3300012667|Ga0157208_10042279 | Not Available | 617 | Open in IMG/M |
| 3300012774|Ga0138283_1215536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300013295|Ga0170791_13136452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10595582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300020141|Ga0211732_1061301 | Not Available | 44174 | Open in IMG/M |
| 3300020141|Ga0211732_1092147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1876 | Open in IMG/M |
| 3300020151|Ga0211736_10200532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1332 | Open in IMG/M |
| 3300020151|Ga0211736_10341962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5617 | Open in IMG/M |
| 3300020151|Ga0211736_10778355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1488 | Open in IMG/M |
| 3300020151|Ga0211736_10906224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3540 | Open in IMG/M |
| 3300020151|Ga0211736_10966384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6088 | Open in IMG/M |
| 3300020159|Ga0211734_10715654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300020159|Ga0211734_10777345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
| 3300020161|Ga0211726_10175689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300020162|Ga0211735_10175976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300020480|Ga0208201_101623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2032 | Open in IMG/M |
| 3300020498|Ga0208050_1000126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16602 | Open in IMG/M |
| 3300020541|Ga0208359_1004800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2436 | Open in IMG/M |
| 3300020541|Ga0208359_1012930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1411 | Open in IMG/M |
| 3300020549|Ga0207942_1031712 | Not Available | 663 | Open in IMG/M |
| 3300020555|Ga0208358_1033121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300020560|Ga0208852_1040307 | Not Available | 807 | Open in IMG/M |
| 3300020570|Ga0208465_1033774 | Not Available | 657 | Open in IMG/M |
| 3300020575|Ga0208053_1063863 | Not Available | 681 | Open in IMG/M |
| 3300021092|Ga0194122_10282213 | Not Available | 856 | Open in IMG/M |
| 3300021519|Ga0194048_10160239 | Not Available | 843 | Open in IMG/M |
| 3300021602|Ga0194060_10502106 | Not Available | 570 | Open in IMG/M |
| 3300021956|Ga0213922_1094750 | Not Available | 608 | Open in IMG/M |
| 3300021962|Ga0222713_10601920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300021963|Ga0222712_10002302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 22049 | Open in IMG/M |
| 3300022752|Ga0214917_10000274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 66214 | Open in IMG/M |
| 3300022752|Ga0214917_10000649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 45158 | Open in IMG/M |
| 3300023184|Ga0214919_10000488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 67721 | Open in IMG/M |
| 3300023184|Ga0214919_10021300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7221 | Open in IMG/M |
| 3300024346|Ga0244775_10211687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1624 | Open in IMG/M |
| 3300024346|Ga0244775_10248598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1482 | Open in IMG/M |
| 3300024346|Ga0244775_10301921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1327 | Open in IMG/M |
| 3300024346|Ga0244775_10329643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 1263 | Open in IMG/M |
| 3300024346|Ga0244775_10505894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 986 | Open in IMG/M |
| 3300024346|Ga0244775_10848250 | Not Available | 728 | Open in IMG/M |
| 3300024346|Ga0244775_11538477 | Not Available | 508 | Open in IMG/M |
| 3300025307|Ga0208566_1136439 | Not Available | 696 | Open in IMG/M |
| 3300026473|Ga0255166_1052196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300027121|Ga0255074_1037509 | Not Available | 602 | Open in IMG/M |
| 3300027123|Ga0255090_1027566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 942 | Open in IMG/M |
| 3300027129|Ga0255067_1030700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300027131|Ga0255066_1010255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1438 | Open in IMG/M |
| 3300027131|Ga0255066_1036774 | Not Available | 687 | Open in IMG/M |
| 3300027142|Ga0255065_1062549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300027151|Ga0255063_1048361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300027416|Ga0207994_1012947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1688 | Open in IMG/M |
| 3300027508|Ga0255072_1014867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1661 | Open in IMG/M |
| 3300027581|Ga0209651_1147420 | Not Available | 639 | Open in IMG/M |
| 3300027621|Ga0208951_1000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115112 | Open in IMG/M |
| 3300027627|Ga0208942_1005291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 4390 | Open in IMG/M |
| 3300027689|Ga0209551_1254121 | Not Available | 526 | Open in IMG/M |
| 3300027733|Ga0209297_1000035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115006 | Open in IMG/M |
| 3300027733|Ga0209297_1007866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 5315 | Open in IMG/M |
| 3300027754|Ga0209596_1003262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12869 | Open in IMG/M |
| 3300027756|Ga0209444_10002638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9810 | Open in IMG/M |
| 3300027759|Ga0209296_1000586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 31699 | Open in IMG/M |
| 3300027759|Ga0209296_1001017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 22732 | Open in IMG/M |
| 3300027770|Ga0209086_10020424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 4165 | Open in IMG/M |
| 3300027782|Ga0209500_10388100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300027793|Ga0209972_10210399 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300027805|Ga0209229_10108837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
| 3300027836|Ga0209230_10118050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1490 | Open in IMG/M |
| 3300027892|Ga0209550_10357777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
| 3300028025|Ga0247723_1001891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11771 | Open in IMG/M |
| 3300028025|Ga0247723_1004169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6955 | Open in IMG/M |
| 3300028025|Ga0247723_1082798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 840 | Open in IMG/M |
| 3300028025|Ga0247723_1114080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300031758|Ga0315907_10087991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2672 | Open in IMG/M |
| 3300031758|Ga0315907_10773488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 720 | Open in IMG/M |
| 3300031951|Ga0315904_10000145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 115273 | Open in IMG/M |
| 3300032050|Ga0315906_10062519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3826 | Open in IMG/M |
| 3300032092|Ga0315905_10519408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1093 | Open in IMG/M |
| 3300032093|Ga0315902_10734168 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300032116|Ga0315903_10185846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1863 | Open in IMG/M |
| 3300032116|Ga0315903_10423913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300034073|Ga0310130_0006204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4570 | Open in IMG/M |
| 3300034101|Ga0335027_0007590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 9483 | Open in IMG/M |
| 3300034104|Ga0335031_0421063 | Not Available | 833 | Open in IMG/M |
| 3300034279|Ga0335052_0099247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1758 | Open in IMG/M |
| 3300034283|Ga0335007_0097813 | All Organisms → Viruses → Predicted Viral | 2178 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.48% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.88% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 7.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.67% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.85% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.03% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.03% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.42% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.82% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.21% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.21% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.21% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.21% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.21% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.21% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.61% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.61% |
| Subglacial Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater | 0.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.61% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.61% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003650 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filter | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025307 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027416 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes) | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_1000673311 | 3300001282 | Freshwater | MKLYQSKDWLYRRYIVQKKTITEIGKECNVSAMTIQRYLEQFGLIKKR* |
| B570J14230_102067552 | 3300001282 | Freshwater | MKLYQSKDWLYRRYIVQKKTVTEIAIECSVSAMTIQRYLDQFGLIKRR* |
| RCM33_10729052 | 3300001838 | Marine Plankton | MKLYQSKEWLYRRYIVQKKTVSEIAIECSVSAMTIQRYLEQFGLIKKR* |
| RCM41_10017132 | 3300001847 | Marine Plankton | MKLYQSKDWLHRKYVVQRKNIVEIAQEAGTSAMTIQRYLEEFGLIKRR* |
| RCM31_101006901 | 3300001851 | Marine Plankton | MATSLKLYQSKDWLYRKYIVQKKTVTEIALECDVSAMTIQRYLEKFG |
| B570J29032_1089225051 | 3300002408 | Freshwater | MKLYQSQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRY |
| B570J40625_1000261539 | 3300002835 | Freshwater | MKLYQSKEWLHRRYLVQKKTVTEIAKEAGTSAMTIQRYLVQFGLIKKR* |
| B570J40625_1000851802 | 3300002835 | Freshwater | MKLYQSKDWLYRRYVVQKKTVTEIGNECGVSAMTIQRYLEQFGLIKKR* |
| B570J40625_1002880273 | 3300002835 | Freshwater | MKMYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR* |
| JGI25908J49247_100855252 | 3300003277 | Freshwater Lake | MKLYQSHPWLYRRYIVQKKTVTEIAIECAVSPMTIQRYLEQFGLIKKR* |
| JGI25914J50564_1000398611 | 3300003429 | Freshwater Lake | MGSPVKLYKNKDWLYRRYVVQKKTMEEIATECGVTMMTIYR |
| JGI25921J50272_100961482 | 3300003430 | Freshwater Lake | MKFYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEKFGIIKK* |
| SLW30_1004852 | 3300003650 | Subglacial Freshwater | MKLYQSKDWLYRRYVVQKKTVTEIGKECEVSAMTIQRYLDKMGLIKKR* |
| Ga0066177_102260142 | 3300004096 | Freshwater Lake | MEHNVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR* |
| Ga0007796_101152732 | 3300004804 | Freshwater | MKLYQSKEWLYRKYVVQKKTVTEIGKECQVSAMTIQRYLEQFQLIKKR* |
| Ga0070374_101279482 | 3300005517 | Freshwater Lake | MKYYQSEEWLHRRYVIQKKSMTEIAIECNTSAMTIQRYLTKFGLIKKR* |
| Ga0070374_105264072 | 3300005517 | Freshwater Lake | MKLYQSKEWLYRRYVVQKKSVTQIAIECKTSAMTIQRYLTKFELIKRR* |
| Ga0068876_102050403 | 3300005527 | Freshwater Lake | MKLYQSQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR* |
| Ga0068876_102198463 | 3300005527 | Freshwater Lake | MAKEKSRRLEKYWVVVYIKLYQSKDWLYRRYIVQKKTVTEISKECKVSAMTIQRYLEQFGLIKKR* |
| Ga0068872_101028872 | 3300005528 | Freshwater Lake | MKLYQSKDWLYRRYIVQKKTVTEIAFECKVSAMTIQRYLEKFELIRRR* |
| Ga0049083_1000018220 | 3300005580 | Freshwater Lentic | MKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR* |
| Ga0049081_100988721 | 3300005581 | Freshwater Lentic | MKLYQSEEWLYRRYVVQKKTVTEIAIECKSSAMTIQRYLTKFGLIKKR* |
| Ga0049085_100018595 | 3300005583 | Freshwater Lentic | MKFYQSKEWLYRRYVVQKKTVTEIGAECSVSAMTIQRYLEKFGLIRK* |
| Ga0078894_1000720114 | 3300005662 | Freshwater Lake | MKLYQDKAWLHNRYVIQKKNIVEIAKECGVSAMTIQRHIDKFGLKIKR* |
| Ga0078894_101355791 | 3300005662 | Freshwater Lake | MKLYQSKEWLYRRYVVQKKTVTEIGKECNVSAMTIQRYL |
| Ga0078894_103561963 | 3300005662 | Freshwater Lake | MKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRHLEKFGLIKKR* |
| Ga0078894_104203271 | 3300005662 | Freshwater Lake | MKLYQSKEWLHRRYVVQKKTVTEIAEECKVSAMTIQR |
| Ga0078894_108151321 | 3300005662 | Freshwater Lake | MKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTIQRY |
| Ga0070743_101694611 | 3300005941 | Estuarine | MKLYQSKDWLHRRYVVQKKTVTEIADECKVSAMTIQRYL |
| Ga0075470_101171272 | 3300006030 | Aqueous | MKLYESQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRHLEKFGLIKKR* |
| Ga0070744_100535874 | 3300006484 | Estuarine | MKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRHLEKF |
| Ga0070744_100753911 | 3300006484 | Estuarine | MKLYQSKDWLYRKYIVQKKTVTEIGKECGVSAMTIQRYL |
| Ga0070744_101061371 | 3300006484 | Estuarine | MKLYQSQTWMYRRYVVQKKTVIEIAEECKVSAMTIQRALDKFGLIKKR* |
| Ga0079301_10113979 | 3300006639 | Deep Subsurface | MKLYQSEEWLYRRYVVQKKSVTEIAIECKTSAMTIQRYLTKFGLIKRR* |
| Ga0102881_11806281 | 3300007551 | Estuarine | MKLYQDKGWLYNRYVIQKKNIVEIAKECNVSAMTI |
| Ga0102915_10691834 | 3300007562 | Estuarine | MKLYQSKEFLHRRYVLQKKTIKEIADECGVSHMTIQ |
| Ga0102852_10597761 | 3300007718 | Estuarine | MKLYQSKDWLYRRYIVQKKTVTEIGKECGVSAMTIQRYL |
| Ga0105736_10115344 | 3300007861 | Estuary Water | MKLYQDKGWLYNRYIIQKKNIVEIAKECNVSAMTIQRYI |
| Ga0105737_10527903 | 3300007862 | Estuary Water | MKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTIQRYL |
| Ga0114340_100460214 | 3300008107 | Freshwater, Plankton | MKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRSLDKFGLIKKR* |
| Ga0114340_11460253 | 3300008107 | Freshwater, Plankton | MKFYQSKEWLYRRYVVQKKTVTEIGKECNVSAMTI |
| Ga0114341_10001123108 | 3300008108 | Freshwater, Plankton | MKLYQSKDWLYRRYIIQKKTVTEIAIECSVSAMTIQRYLDQFGLIKKR* |
| Ga0114341_101324361 | 3300008108 | Freshwater, Plankton | MKLYQSHPWLYKRYVIQKKTVTEIAIECGVSPMTI |
| Ga0114343_10652833 | 3300008110 | Freshwater, Plankton | MLKLYQSKEWLYRRYVVQKKTVTEIGKECGVSAMT |
| Ga0114343_10704652 | 3300008110 | Freshwater, Plankton | MKFYQSKEWLYRRYVVQKKTVTEIGKECGVSAMTIQRHLEQFGLIKKR* |
| Ga0114343_11508672 | 3300008110 | Freshwater, Plankton | MKLYQSQTWLYRRYVVQKKNITEIAAECGVSAMTI |
| Ga0114346_10164502 | 3300008113 | Freshwater, Plankton | MVKLYQSKDWLHRRYVVQKKTVTEIALECGTSAMTIQRYLVQFGLIKKR* |
| Ga0114346_12935652 | 3300008113 | Freshwater, Plankton | MVKFYQSKEWLHRRYVVQKKTVTEIAAECGTSAMTIQRYLVQFGLIKKR* |
| Ga0114347_10777872 | 3300008114 | Freshwater, Plankton | MKLYQSKEWLHRRYIIQKKTVSEIGKECNVSAMTIQRYLDQFGLIKKR* |
| Ga0114350_10068982 | 3300008116 | Freshwater, Plankton | MKLYESQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIRKR* |
| Ga0114354_10774822 | 3300008119 | Freshwater, Plankton | MEHDVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR* |
| Ga0114336_10176808 | 3300008261 | Freshwater, Plankton | MKLYQSKEWLYRRYVVQKKTVIEIGKECNVSAMTIQRYLDQFGLIKKR* |
| Ga0104242_10084612 | 3300008962 | Freshwater | MVKLYQSKDWLHRRYVVQKKTVTEIATECGTSAMTIQRYLVQFGLIKKR* |
| Ga0102831_12544341 | 3300008996 | Estuarine | MLKMYQSKDWLYRRYVVQKKTVTEIGKECGVSAMTI |
| Ga0102829_10933872 | 3300009026 | Estuarine | MKLYQSQTWLYRRYVVQKKTVIEIAEECKVSAMTIQRALDKFGVIKKR* |
| Ga0114980_101930082 | 3300009152 | Freshwater Lake | MKLYQSHPWLYRRYIVQKKTVTEIAIECAVSPMTIQRYLDQFGLIKKR* |
| Ga0114977_1000005958 | 3300009158 | Freshwater Lake | MKLYQSKDWLYRRYVVQKKSITEIAKECNVSAMTIQRHVEQFGLGKKK* |
| Ga0114977_1000308812 | 3300009158 | Freshwater Lake | MKFYQSKEWLYRRYVVQKKTVTEIGKECDVSAMTIQRYLEQFGLIKKR* |
| Ga0114978_105165492 | 3300009159 | Freshwater Lake | YQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRSLDKFGLIKKR* |
| Ga0114978_106275601 | 3300009159 | Freshwater Lake | MKLYQSKDWLYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKR |
| Ga0114974_100028962 | 3300009183 | Freshwater Lake | MKLYQSKDWLYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKRR* |
| Ga0114974_101066644 | 3300009183 | Freshwater Lake | MKLYQSKDWLYRRYVVQKKTVTEIGKECGVSAMTIQRYL |
| Ga0114974_107835361 | 3300009183 | Freshwater Lake | HRRYVIQKKSMTEIAIECNTSAMTIQRYLTKFGLIKKR* |
| Ga0114982_11928512 | 3300009419 | Deep Subsurface | MKFYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEKFGLIKK* |
| Ga0129333_105043692 | 3300010354 | Freshwater To Marine Saline Gradient | MKLYQSQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIRK* |
| Ga0129333_106067562 | 3300010354 | Freshwater To Marine Saline Gradient | MKLYESQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIKKR* |
| Ga0129336_104870152 | 3300010370 | Freshwater To Marine Saline Gradient | MKLYQSKDWLYRRYIVQKKTVTEIAKECNVSAMTKKRYLDQFGLIKKR* |
| Ga0133913_119168971 | 3300010885 | Freshwater Lake | MKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQR |
| Ga0133913_129720651 | 3300010885 | Freshwater Lake | MEHNVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQ |
| Ga0133913_134127603 | 3300010885 | Freshwater Lake | VFNMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRSLDKFGLIKKR* |
| Ga0138308_10188013 | 3300010965 | Lake Chemocline | MKLYQSKDWLYRRYVVQKKNIIEIAKECNVSAMTIQRHIEQFGLGKKK* |
| Ga0139556_10003881 | 3300011011 | Freshwater | MKLYQSHPWLYRRYIVQKKTVTEIAIECAVSPMTIQRYLEQFQLIKRR* |
| Ga0119951_10559782 | 3300012000 | Freshwater | MKLYQSKDWLYRRYIVQKKTVTEIANECKVSAMTIQRYLEKFELIRRR* |
| Ga0119955_100008718 | 3300012006 | Freshwater | MKLYQSKEWLFRRYSVQKKTIVEIAKECNVSAMTIQRHLEQFGLIKKR* |
| Ga0153801_10129871 | 3300012017 | Freshwater | MKLYKNKDWLYRRYVVQKKTMENIAQECGVTVMTIY |
| Ga0157210_10215903 | 3300012665 | Freshwater | YQSKDWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR* |
| Ga0157208_100008465 | 3300012667 | Freshwater | MKLYQSKEWLHRRYLIQRKHINEIAKECGVSAMTIQRYIDQFGLNKKR* |
| Ga0157208_100021774 | 3300012667 | Freshwater | VKLYQSKEWLHRRYLIQRKHINEIAKECGVSAMTIQRYIDQFGLNKKR* |
| Ga0157208_100094292 | 3300012667 | Freshwater | MKFYQSKEWLYRRYVVQKKTVTEIGKECAVSAMTIQRYLEKFGIIKK* |
| Ga0157208_100422791 | 3300012667 | Freshwater | MKLYQDKAWLHNRYIIQKKNIVDIAKECGVSAMTIQRYIE |
| Ga0138283_12155361 | 3300012774 | Freshwater Lake | YRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKRR* |
| Ga0170791_131364521 | 3300013295 | Freshwater | WLYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKRR* |
| (restricted) Ga0172376_105955822 | 3300014720 | Freshwater | YQSQTWLYRRYVVQKRSVTEIAAECGVSAMSIQRHLEKFGLIRK* |
| Ga0211732_106130117 | 3300020141 | Freshwater | MKFYQSKDWLYRRYVVQKKTVTEIGVECQVSAMTIQRYLEKFGLIKK |
| Ga0211732_10921471 | 3300020141 | Freshwater | MKLYQSQTWLYRRYVVQKKTVTEIAYECKVSAMTIQRYLEKFQLIKKR |
| Ga0211736_102005324 | 3300020151 | Freshwater | MKLYQSQTWLYRRYVVQKKAVTEIADECKVSAMTIQRYLEKFQLIKKR |
| Ga0211736_103419624 | 3300020151 | Freshwater | MKLYQSEEWLYRRYVVQKKSVTEIAIECKTSAMTIQRYLTKFGLIKRR |
| Ga0211736_107783552 | 3300020151 | Freshwater | MKYYQSEEWLYRRYVVQKKSITEIAIECKTSAMTIQRYLTKFGLIKKR |
| Ga0211736_109062245 | 3300020151 | Freshwater | MKLYQSEEWLYRRYVVQKKSVTEIAIECKSSAMTIQRYLTKFGLIKKR |
| Ga0211736_1096638413 | 3300020151 | Freshwater | MKLYQSEEWLYRRYVVQKKTVTEIAIECKSSAMTIQRYLTKFGLIKKR |
| Ga0211734_107156542 | 3300020159 | Freshwater | MKLYQSKEWLYRRYVVQKKTVTEIGKECKVSAMTIQRYLEQFGLIKKR |
| Ga0211734_107773451 | 3300020159 | Freshwater | SEEWLYRRYVVQKKSITEIAIECKTSAMTIQRYLTKFGLIKKR |
| Ga0211726_101756891 | 3300020161 | Freshwater | TMKLYQSEEWLYRRYVVQKKTVTEIAIECKSSAMTIQRYLTKFGLIKKR |
| Ga0211735_101759762 | 3300020162 | Freshwater | LFILEMVIMKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0208201_1016232 | 3300020480 | Freshwater | MKLYQSKDWLYRRYIIQKKTVTEIAIECSVSAMTIQRYLDQFGLIKRR |
| Ga0208050_10001262 | 3300020498 | Freshwater | MKLYQSKDWLYRRYIVQKKTITEIGKECNVSAMTIQRYLEQFGLIKKR |
| Ga0208359_10048004 | 3300020541 | Freshwater | MKLYQSKDWLYRRYVVQKKTVTEIGNECGVSAMTIQRYLEQFGLIKKR |
| Ga0208359_10129304 | 3300020541 | Freshwater | MKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQ |
| Ga0207942_10317122 | 3300020549 | Freshwater | VKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0208358_10331212 | 3300020555 | Freshwater | MEHNVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0208852_10403072 | 3300020560 | Freshwater | MKLYQSKEWLHRRYLVQKKTVTEIAKEAGTSAMTIQRYLVQFGLIKKR |
| Ga0208465_10337742 | 3300020570 | Freshwater | MKLYQSQIWLYRRYVVQKKTVTEIADECKVSAMTIQRY |
| Ga0208053_10638632 | 3300020575 | Freshwater | MKMYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRY |
| Ga0194122_102822131 | 3300021092 | Freshwater Lake | MKLYKSKDWLYRRYVVQRKTMEEIAKECGVTIMTIH |
| Ga0194048_101602391 | 3300021519 | Anoxic Zone Freshwater | MKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTIQ |
| Ga0194060_105021063 | 3300021602 | Anoxic Zone Freshwater | MKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTVQRY |
| Ga0213922_10947502 | 3300021956 | Freshwater | MKLYQSKEWLSRRYLYQKKTVTQIAEEAGTSAMTIQ |
| Ga0222713_106019202 | 3300021962 | Estuarine Water | MKLYESQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRHLEKFGLIKKR |
| Ga0222712_1000230210 | 3300021963 | Estuarine Water | MKYYQSEEWLYRRYVIQKKSITEIAIECNTSAMTIQRYLTKFGLIKKR |
| Ga0214917_1000027462 | 3300022752 | Freshwater | MKLYESQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRHLEKFGLIRKR |
| Ga0214917_1000064948 | 3300022752 | Freshwater | MKLYQSKDWLYRRYIVQKKTVTEIAIECSVSAMTIQRYLDQFGLIKRR |
| Ga0214919_1000048862 | 3300023184 | Freshwater | MKFYQSKEWLYRRYVVQKKTVTEIGAECSVSAMTIQRYLEKFGLIRK |
| Ga0214919_1002130013 | 3300023184 | Freshwater | MKLYQSKEWLFRRYSVQKKTIVEIAKECNVSAMTIQRHLEQFGLIKKR |
| Ga0244775_102116872 | 3300024346 | Estuarine | MKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIRKR |
| Ga0244775_102485981 | 3300024346 | Estuarine | IWWVDVNMKLYQSKDWLHRRYVIQKKTMTEIAIECNTSAMTIQRYLTKFGLIKKR |
| Ga0244775_103019213 | 3300024346 | Estuarine | MKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRHLEKFGLIKKR |
| Ga0244775_103296434 | 3300024346 | Estuarine | MKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKK |
| Ga0244775_105058943 | 3300024346 | Estuarine | MKYYQSEEWLHRRYVIQKKSMTEIAIECNTSAMTIQRYLTKFGLIKKR |
| Ga0244775_108482502 | 3300024346 | Estuarine | MKLYQSQTWMYRRYVVQKKTVIEIAEECKVSAMTIQRALDKFGLIKKR |
| Ga0244775_115384772 | 3300024346 | Estuarine | FRRYSVQKKNIVEIAEECKVSAMTIQRYLEKFGLIKKR |
| Ga0208566_11364392 | 3300025307 | Freshwater | MKLYKNKDWLYRRYVVQKKSMEEIATECGVTMMTIYR |
| Ga0255166_10521962 | 3300026473 | Freshwater | YGVNRTMKLYESQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRHLEKFGLIRKR |
| Ga0255074_10375091 | 3300027121 | Freshwater | MKLYQSQTWMYRRYVVQKKTVIEIAKECKVSAMTIQRALDKFGLIKKR |
| Ga0255090_10275661 | 3300027123 | Freshwater | MKLYQSKDWLYRRYVVQKKTVTEIAKECNVSAMTIQR |
| Ga0255067_10307001 | 3300027129 | Freshwater | MLKMYQSKDWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0255066_10102551 | 3300027131 | Freshwater | MKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTI |
| Ga0255066_10367741 | 3300027131 | Freshwater | MKLYQSKDWLYRRYVIQKKTVTEIGKECQVSAMTIQRYLEQFGLIKK |
| Ga0255065_10625491 | 3300027142 | Freshwater | LYQSKDWLYRRYVIQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0255063_10483613 | 3300027151 | Freshwater | MKLYQSKDWLYRRYVIQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0207994_10129474 | 3300027416 | Estuarine | MKLYQSQTWLHRRYVVQKKTVTEIAEECKVSAMTI |
| Ga0255072_10148674 | 3300027508 | Freshwater | RYVIQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0209651_11474201 | 3300027581 | Freshwater Lake | MKLYQNKDWLFRRYSVQKKTIVEIAEECKVSAMTIQ |
| Ga0208951_100000420 | 3300027621 | Freshwater Lentic | MKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0208942_10052911 | 3300027627 | Freshwater Lentic | MKFYQSKEWLYRRYVVQKKTVTEIGAECSVSAMTIQRY |
| Ga0209551_12541211 | 3300027689 | Freshwater Lake | MKLYQNKDWLFRRYSVQKKTVVEIAEECKVSAMTI |
| Ga0209297_1000035174 | 3300027733 | Freshwater Lake | MKLYQSKDWLYRRYVVQKKSITEIAKECNVSAMTIQRHVEQFGLGKKK |
| Ga0209297_10078668 | 3300027733 | Freshwater Lake | MKFYQSKEWLYRRYVVQKKTVTEIGKECDVSAMTIQRYLEQFGLIKKR |
| Ga0209596_100326217 | 3300027754 | Freshwater Lake | MKLYQSKDWLHRRYIVQKKTVTEIGKECRVSAMTIQRYLQEFGLLRKK |
| Ga0209444_1000263814 | 3300027756 | Freshwater Lake | MKLYQSKDWLHRRYVIQKKSMTEIAIECNTSAMTIQRYLTKFGLIKKR |
| Ga0209296_10005866 | 3300027759 | Freshwater Lake | MKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRSLDKFGLIKKR |
| Ga0209296_100101722 | 3300027759 | Freshwater Lake | MKLYQSKDWLYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKRR |
| Ga0209086_100204241 | 3300027770 | Freshwater Lake | MKLYQSHPWLYRRYIVQKKTVTEIAIECAVSPMTIQRYLDQFGLIKKR |
| Ga0209500_103881002 | 3300027782 | Freshwater Lake | FYQSKEWLYRRYVVQKKTVTEIGKECDVSAMTIQRYLEQFGLIKKR |
| Ga0209972_102103992 | 3300027793 | Freshwater Lake | RRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR |
| Ga0209229_101088372 | 3300027805 | Freshwater And Sediment | MKMYQSKEWLYRRYVVQKKTITEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0209230_101180504 | 3300027836 | Freshwater And Sediment | MKLYQDKAWLYNRYIIQKKNIVEIAKECGVSAMTIQRYIDK |
| Ga0209550_103577771 | 3300027892 | Freshwater Lake | MKLYQSKDWLYRRYIVQKKTVTEIGKECGVSAMTI |
| Ga0247723_100189110 | 3300028025 | Deep Subsurface Sediment | MKLYQSKEWLYRRYIVQKKTVTEIGKECNVSAMTIQRYLDQFGLIKKR |
| Ga0247723_10041692 | 3300028025 | Deep Subsurface Sediment | MKFYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEKFGLIKK |
| Ga0247723_10827983 | 3300028025 | Deep Subsurface Sediment | MKLYQSKDWLHRRYVVQKKTVIEIAKECNVSAMTIQRYLE |
| Ga0247723_11140802 | 3300028025 | Deep Subsurface Sediment | VKLYKNKEWLYRRYVVQKKTMESIAQECGVTVMTIY |
| Ga0315907_100879918 | 3300031758 | Freshwater | MKLYQSKEWLHRRYIIQKKTVSEIGKECNVSAMTIQR |
| Ga0315907_107734882 | 3300031758 | Freshwater | MKLYESQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIRKR |
| Ga0315904_1000014560 | 3300031951 | Freshwater | MKLYQSKDWLYRRYIIQKKTVTEIAIECSVSAMTIQRYLDQFGLIKKR |
| Ga0315906_100625191 | 3300032050 | Freshwater | WLYRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR |
| Ga0315905_105194083 | 3300032092 | Freshwater | MKLYQDKAWLHNRYVIQKKNIVEIAKESGVSAMTIQRYIDKFGLKIKR |
| Ga0315902_107341682 | 3300032093 | Freshwater | QSQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR |
| Ga0315903_101858465 | 3300032116 | Freshwater | RTMKLYQSQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR |
| Ga0315903_104239134 | 3300032116 | Freshwater | MKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRYL |
| Ga0310130_0006204_922_1065 | 3300034073 | Fracking Water | MKLYQSQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIKK |
| Ga0335027_0007590_247_393 | 3300034101 | Freshwater | MKLYQSKEWLYRRYVVQKKTVTEIAIECNTSAMTIQRYLTKFGLIKKR |
| Ga0335031_0421063_1_108 | 3300034104 | Freshwater | MKLYQSKDWLHRRYVVQKKTVTEIAKECNVSAMTIQ |
| Ga0335052_0099247_1640_1756 | 3300034279 | Freshwater | YRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0335007_0097813_2065_2178 | 3300034283 | Freshwater | RRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR |
| Ga0335048_0167705_1119_1238 | 3300034356 | Freshwater | MGSSVKMYKNKDWLHRRYVVQRKSMEEIAQECGVTVMTIY |
| ⦗Top⦘ |