NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F038675

Metagenome / Metatranscriptome Family F038675

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F038675
Family Type Metagenome / Metatranscriptome
Number of Sequences 165
Average Sequence Length 45 residues
Representative Sequence MKLYQSKEWLYRRYVVQKKTVTEIGKECKVSAMTIQRYLEQFGLIKKR
Number of Associated Samples 116
Number of Associated Scaffolds 165

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 59.76 %
% of genes near scaffold ends (potentially truncated) 43.03 %
% of genes from short scaffolds (< 2000 bps) 67.27 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (63.636 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(11.515 % of family members)
Environment Ontology (ENVO) Unclassified
(52.121 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(72.121 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.11%    β-sheet: 0.00%    Coil/Unstructured: 57.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 165 Family Scaffolds
PF02075RuvC 21.21
PF12705PDDEXK_1 8.48
PF00535Glycos_transf_2 6.06
PF04488Gly_transf_sug 6.06
PF05050Methyltransf_21 5.45
PF12804NTP_transf_3 3.03
PF07235DUF1427 2.42
PF136402OG-FeII_Oxy_3 2.42
PF08241Methyltransf_11 2.42
PF01755Glyco_transf_25 1.82
PF13489Methyltransf_23 1.82
PF09834DUF2061 1.82
PF13578Methyltransf_24 1.21
PF01370Epimerase 1.21
PF00565SNase 1.21
PF05257CHAP 0.61
PF16861Carbam_trans_C 0.61
PF13649Methyltransf_25 0.61
PF09723Zn-ribbon_8 0.61
PF00166Cpn10 0.61
PF00154RecA 0.61
PF03796DnaB_C 0.61
PF01135PCMT 0.61
PF03354TerL_ATPase 0.61
PF07987DUF1775 0.61
PF01467CTP_transf_like 0.61
PF03819MazG 0.61
PF14579HHH_6 0.61
PF00011HSP20 0.61
PF13662Toprim_4 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 165 Family Scaffolds
COG0817Holliday junction resolvasome RuvABC endonuclease subunit RuvCReplication, recombination and repair [L] 21.21
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 6.06
COG4317Xanthosine utilization system component, XapX domainNucleotide transport and metabolism [F] 2.42
COG3306Glycosyltransferase involved in LPS biosynthesis, GR25 familyCell wall/membrane/envelope biogenesis [M] 1.82
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.61
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.61
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.61
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.61
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.61
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.61
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.61
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.61
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.61
COG4549Uncharacterized conserved protein YcnI, contains cohesin/reeler-like domainFunction unknown [S] 0.61
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.00 %
UnclassifiedrootN/A20.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10006733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4522Open in IMG/M
3300001282|B570J14230_10206755All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300001838|RCM33_1072905All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300001847|RCM41_1001713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300001851|RCM31_10100690All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300002408|B570J29032_108922505Not Available541Open in IMG/M
3300002835|B570J40625_100026153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9477Open in IMG/M
3300002835|B570J40625_100085180All Organisms → cellular organisms → Bacteria4043Open in IMG/M
3300002835|B570J40625_100288027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1676Open in IMG/M
3300003277|JGI25908J49247_10085525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300003429|JGI25914J50564_10003986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4962Open in IMG/M
3300003430|JGI25921J50272_10096148All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300003650|SLW30_100485All Organisms → cellular organisms → Bacteria2805Open in IMG/M
3300004096|Ga0066177_10226014All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300004804|Ga0007796_10115273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes822Open in IMG/M
3300005517|Ga0070374_10127948All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300005517|Ga0070374_10526407All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005527|Ga0068876_10205040All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300005527|Ga0068876_10219846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1097Open in IMG/M
3300005528|Ga0068872_10102887All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300005580|Ga0049083_10000182All Organisms → cellular organisms → Bacteria19866Open in IMG/M
3300005581|Ga0049081_10098872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1089Open in IMG/M
3300005583|Ga0049085_10001859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8405Open in IMG/M
3300005662|Ga0078894_10007201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes8641Open in IMG/M
3300005662|Ga0078894_10135579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2201Open in IMG/M
3300005662|Ga0078894_10356196All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300005662|Ga0078894_10420327All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1206Open in IMG/M
3300005662|Ga0078894_10815132Not Available816Open in IMG/M
3300005941|Ga0070743_10169461Not Available722Open in IMG/M
3300006030|Ga0075470_10117127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300006484|Ga0070744_10053587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1181Open in IMG/M
3300006484|Ga0070744_10075391All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300006484|Ga0070744_10106137Not Available811Open in IMG/M
3300006639|Ga0079301_1011397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3296Open in IMG/M
3300007551|Ga0102881_1180628Not Available583Open in IMG/M
3300007562|Ga0102915_1069183All Organisms → Viruses → Predicted Viral1161Open in IMG/M
3300007718|Ga0102852_1059776Not Available729Open in IMG/M
3300007861|Ga0105736_1011534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1501Open in IMG/M
3300007862|Ga0105737_1052790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage987Open in IMG/M
3300008107|Ga0114340_1004602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8689Open in IMG/M
3300008107|Ga0114340_1146025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300008108|Ga0114341_10001123All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes86719Open in IMG/M
3300008108|Ga0114341_10132436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1472Open in IMG/M
3300008110|Ga0114343_1065283Not Available1354Open in IMG/M
3300008110|Ga0114343_1070465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1284Open in IMG/M
3300008110|Ga0114343_1150867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes740Open in IMG/M
3300008113|Ga0114346_1016450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4060Open in IMG/M
3300008113|Ga0114346_1293565Not Available566Open in IMG/M
3300008114|Ga0114347_1077787All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2112Open in IMG/M
3300008116|Ga0114350_1006898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5404Open in IMG/M
3300008119|Ga0114354_1077482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1363Open in IMG/M
3300008261|Ga0114336_1017680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes6665Open in IMG/M
3300008962|Ga0104242_1008461Not Available1829Open in IMG/M
3300008996|Ga0102831_1254434Not Available580Open in IMG/M
3300009026|Ga0102829_1093387Not Available934Open in IMG/M
3300009152|Ga0114980_10193008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1199Open in IMG/M
3300009158|Ga0114977_10000059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes73120Open in IMG/M
3300009158|Ga0114977_10003088All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10689Open in IMG/M
3300009159|Ga0114978_10516549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300009159|Ga0114978_10627560Not Available619Open in IMG/M
3300009183|Ga0114974_10002896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes13088Open in IMG/M
3300009183|Ga0114974_10106664All Organisms → Viruses → Predicted Viral1796Open in IMG/M
3300009183|Ga0114974_10783536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300009419|Ga0114982_1192851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102630Open in IMG/M
3300010354|Ga0129333_10504369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1060Open in IMG/M
3300010354|Ga0129333_10606756All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300010370|Ga0129336_10487015Not Available666Open in IMG/M
3300010885|Ga0133913_11916897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1476Open in IMG/M
3300010885|Ga0133913_12972065All Organisms → Viruses → Predicted Viral1132Open in IMG/M
3300010885|Ga0133913_13412760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300010965|Ga0138308_101880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage20077Open in IMG/M
3300011011|Ga0139556_1000388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7303Open in IMG/M
3300012000|Ga0119951_1055978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1099Open in IMG/M
3300012006|Ga0119955_1000087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage51789Open in IMG/M
3300012017|Ga0153801_1012987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1500Open in IMG/M
3300012665|Ga0157210_1021590Not Available1038Open in IMG/M
3300012667|Ga0157208_10000846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7775Open in IMG/M
3300012667|Ga0157208_10002177All Organisms → cellular organisms → Bacteria3928Open in IMG/M
3300012667|Ga0157208_10009429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1396Open in IMG/M
3300012667|Ga0157208_10042279Not Available617Open in IMG/M
3300012774|Ga0138283_1215536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300013295|Ga0170791_13136452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage868Open in IMG/M
(restricted) 3300014720|Ga0172376_10595582All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300020141|Ga0211732_1061301Not Available44174Open in IMG/M
3300020141|Ga0211732_1092147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1876Open in IMG/M
3300020151|Ga0211736_10200532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1332Open in IMG/M
3300020151|Ga0211736_10341962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5617Open in IMG/M
3300020151|Ga0211736_10778355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1488Open in IMG/M
3300020151|Ga0211736_10906224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3540Open in IMG/M
3300020151|Ga0211736_10966384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes6088Open in IMG/M
3300020159|Ga0211734_10715654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300020159|Ga0211734_10777345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium732Open in IMG/M
3300020161|Ga0211726_10175689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300020162|Ga0211735_10175976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300020480|Ga0208201_101623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2032Open in IMG/M
3300020498|Ga0208050_1000126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes16602Open in IMG/M
3300020541|Ga0208359_1004800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2436Open in IMG/M
3300020541|Ga0208359_1012930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1411Open in IMG/M
3300020549|Ga0207942_1031712Not Available663Open in IMG/M
3300020555|Ga0208358_1033121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300020560|Ga0208852_1040307Not Available807Open in IMG/M
3300020570|Ga0208465_1033774Not Available657Open in IMG/M
3300020575|Ga0208053_1063863Not Available681Open in IMG/M
3300021092|Ga0194122_10282213Not Available856Open in IMG/M
3300021519|Ga0194048_10160239Not Available843Open in IMG/M
3300021602|Ga0194060_10502106Not Available570Open in IMG/M
3300021956|Ga0213922_1094750Not Available608Open in IMG/M
3300021962|Ga0222713_10601920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage641Open in IMG/M
3300021963|Ga0222712_10002302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes22049Open in IMG/M
3300022752|Ga0214917_10000274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage66214Open in IMG/M
3300022752|Ga0214917_10000649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage45158Open in IMG/M
3300023184|Ga0214919_10000488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes67721Open in IMG/M
3300023184|Ga0214919_10021300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7221Open in IMG/M
3300024346|Ga0244775_10211687All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1624Open in IMG/M
3300024346|Ga0244775_10248598All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1482Open in IMG/M
3300024346|Ga0244775_10301921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1327Open in IMG/M
3300024346|Ga0244775_10329643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay1263Open in IMG/M
3300024346|Ga0244775_10505894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium986Open in IMG/M
3300024346|Ga0244775_10848250Not Available728Open in IMG/M
3300024346|Ga0244775_11538477Not Available508Open in IMG/M
3300025307|Ga0208566_1136439Not Available696Open in IMG/M
3300026473|Ga0255166_1052196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage802Open in IMG/M
3300027121|Ga0255074_1037509Not Available602Open in IMG/M
3300027123|Ga0255090_1027566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay942Open in IMG/M
3300027129|Ga0255067_1030700All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300027131|Ga0255066_1010255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1438Open in IMG/M
3300027131|Ga0255066_1036774Not Available687Open in IMG/M
3300027142|Ga0255065_1062549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300027151|Ga0255063_1048361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300027416|Ga0207994_1012947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1688Open in IMG/M
3300027508|Ga0255072_1014867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1661Open in IMG/M
3300027581|Ga0209651_1147420Not Available639Open in IMG/M
3300027621|Ga0208951_1000004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae115112Open in IMG/M
3300027627|Ga0208942_1005291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay4390Open in IMG/M
3300027689|Ga0209551_1254121Not Available526Open in IMG/M
3300027733|Ga0209297_1000035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae115006Open in IMG/M
3300027733|Ga0209297_1007866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay5315Open in IMG/M
3300027754|Ga0209596_1003262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12869Open in IMG/M
3300027756|Ga0209444_10002638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes9810Open in IMG/M
3300027759|Ga0209296_1000586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes31699Open in IMG/M
3300027759|Ga0209296_1001017All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes22732Open in IMG/M
3300027770|Ga0209086_10020424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay4165Open in IMG/M
3300027782|Ga0209500_10388100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300027793|Ga0209972_10210399All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300027805|Ga0209229_10108837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1249Open in IMG/M
3300027836|Ga0209230_10118050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1490Open in IMG/M
3300027892|Ga0209550_10357777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage917Open in IMG/M
3300028025|Ga0247723_1001891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11771Open in IMG/M
3300028025|Ga0247723_1004169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6955Open in IMG/M
3300028025|Ga0247723_1082798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes840Open in IMG/M
3300028025|Ga0247723_1114080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300031758|Ga0315907_10087991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2672Open in IMG/M
3300031758|Ga0315907_10773488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes720Open in IMG/M
3300031951|Ga0315904_10000145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales115273Open in IMG/M
3300032050|Ga0315906_10062519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3826Open in IMG/M
3300032092|Ga0315905_10519408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1093Open in IMG/M
3300032093|Ga0315902_10734168All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300032116|Ga0315903_10185846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1863Open in IMG/M
3300032116|Ga0315903_10423913All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1075Open in IMG/M
3300034073|Ga0310130_0006204All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4570Open in IMG/M
3300034101|Ga0335027_0007590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay9483Open in IMG/M
3300034104|Ga0335031_0421063Not Available833Open in IMG/M
3300034279|Ga0335052_0099247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1758Open in IMG/M
3300034283|Ga0335007_0097813All Organisms → Viruses → Predicted Viral2178Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake11.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake11.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.30%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater8.48%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton7.88%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine7.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.67%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater5.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.85%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater3.03%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.03%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment2.42%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.82%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.21%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.21%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.21%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.21%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.21%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.21%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.61%
Lake ChemoclineEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline0.61%
Subglacial FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.61%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.61%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.61%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001838Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2aEnvironmentalOpen in IMG/M
3300001847Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2aEnvironmentalOpen in IMG/M
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003429Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300003650Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filterEnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010965Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621EnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300012774Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020480Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020541Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020555Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020560Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020575Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025307Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m (SPAdes)EnvironmentalOpen in IMG/M
3300026473Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027123Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027129Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8hEnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027151Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027508Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027627Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027689Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_10006733113300001282FreshwaterMKLYQSKDWLYRRYIVQKKTITEIGKECNVSAMTIQRYLEQFGLIKKR*
B570J14230_1020675523300001282FreshwaterMKLYQSKDWLYRRYIVQKKTVTEIAIECSVSAMTIQRYLDQFGLIKRR*
RCM33_107290523300001838Marine PlanktonMKLYQSKEWLYRRYIVQKKTVSEIAIECSVSAMTIQRYLEQFGLIKKR*
RCM41_100171323300001847Marine PlanktonMKLYQSKDWLHRKYVVQRKNIVEIAQEAGTSAMTIQRYLEEFGLIKRR*
RCM31_1010069013300001851Marine PlanktonMATSLKLYQSKDWLYRKYIVQKKTVTEIALECDVSAMTIQRYLEKFG
B570J29032_10892250513300002408FreshwaterMKLYQSQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRY
B570J40625_10002615393300002835FreshwaterMKLYQSKEWLHRRYLVQKKTVTEIAKEAGTSAMTIQRYLVQFGLIKKR*
B570J40625_10008518023300002835FreshwaterMKLYQSKDWLYRRYVVQKKTVTEIGNECGVSAMTIQRYLEQFGLIKKR*
B570J40625_10028802733300002835FreshwaterMKMYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR*
JGI25908J49247_1008552523300003277Freshwater LakeMKLYQSHPWLYRRYIVQKKTVTEIAIECAVSPMTIQRYLEQFGLIKKR*
JGI25914J50564_10003986113300003429Freshwater LakeMGSPVKLYKNKDWLYRRYVVQKKTMEEIATECGVTMMTIYR
JGI25921J50272_1009614823300003430Freshwater LakeMKFYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEKFGIIKK*
SLW30_10048523300003650Subglacial FreshwaterMKLYQSKDWLYRRYVVQKKTVTEIGKECEVSAMTIQRYLDKMGLIKKR*
Ga0066177_1022601423300004096Freshwater LakeMEHNVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR*
Ga0007796_1011527323300004804FreshwaterMKLYQSKEWLYRKYVVQKKTVTEIGKECQVSAMTIQRYLEQFQLIKKR*
Ga0070374_1012794823300005517Freshwater LakeMKYYQSEEWLHRRYVIQKKSMTEIAIECNTSAMTIQRYLTKFGLIKKR*
Ga0070374_1052640723300005517Freshwater LakeMKLYQSKEWLYRRYVVQKKSVTQIAIECKTSAMTIQRYLTKFELIKRR*
Ga0068876_1020504033300005527Freshwater LakeMKLYQSQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR*
Ga0068876_1021984633300005527Freshwater LakeMAKEKSRRLEKYWVVVYIKLYQSKDWLYRRYIVQKKTVTEISKECKVSAMTIQRYLEQFGLIKKR*
Ga0068872_1010288723300005528Freshwater LakeMKLYQSKDWLYRRYIVQKKTVTEIAFECKVSAMTIQRYLEKFELIRRR*
Ga0049083_10000182203300005580Freshwater LenticMKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR*
Ga0049081_1009887213300005581Freshwater LenticMKLYQSEEWLYRRYVVQKKTVTEIAIECKSSAMTIQRYLTKFGLIKKR*
Ga0049085_1000185953300005583Freshwater LenticMKFYQSKEWLYRRYVVQKKTVTEIGAECSVSAMTIQRYLEKFGLIRK*
Ga0078894_10007201143300005662Freshwater LakeMKLYQDKAWLHNRYVIQKKNIVEIAKECGVSAMTIQRHIDKFGLKIKR*
Ga0078894_1013557913300005662Freshwater LakeMKLYQSKEWLYRRYVVQKKTVTEIGKECNVSAMTIQRYL
Ga0078894_1035619633300005662Freshwater LakeMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRHLEKFGLIKKR*
Ga0078894_1042032713300005662Freshwater LakeMKLYQSKEWLHRRYVVQKKTVTEIAEECKVSAMTIQR
Ga0078894_1081513213300005662Freshwater LakeMKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTIQRY
Ga0070743_1016946113300005941EstuarineMKLYQSKDWLHRRYVVQKKTVTEIADECKVSAMTIQRYL
Ga0075470_1011712723300006030AqueousMKLYESQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRHLEKFGLIKKR*
Ga0070744_1005358743300006484EstuarineMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRHLEKF
Ga0070744_1007539113300006484EstuarineMKLYQSKDWLYRKYIVQKKTVTEIGKECGVSAMTIQRYL
Ga0070744_1010613713300006484EstuarineMKLYQSQTWMYRRYVVQKKTVIEIAEECKVSAMTIQRALDKFGLIKKR*
Ga0079301_101139793300006639Deep SubsurfaceMKLYQSEEWLYRRYVVQKKSVTEIAIECKTSAMTIQRYLTKFGLIKRR*
Ga0102881_118062813300007551EstuarineMKLYQDKGWLYNRYVIQKKNIVEIAKECNVSAMTI
Ga0102915_106918343300007562EstuarineMKLYQSKEFLHRRYVLQKKTIKEIADECGVSHMTIQ
Ga0102852_105977613300007718EstuarineMKLYQSKDWLYRRYIVQKKTVTEIGKECGVSAMTIQRYL
Ga0105736_101153443300007861Estuary WaterMKLYQDKGWLYNRYIIQKKNIVEIAKECNVSAMTIQRYI
Ga0105737_105279033300007862Estuary WaterMKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTIQRYL
Ga0114340_1004602143300008107Freshwater, PlanktonMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRSLDKFGLIKKR*
Ga0114340_114602533300008107Freshwater, PlanktonMKFYQSKEWLYRRYVVQKKTVTEIGKECNVSAMTI
Ga0114341_100011231083300008108Freshwater, PlanktonMKLYQSKDWLYRRYIIQKKTVTEIAIECSVSAMTIQRYLDQFGLIKKR*
Ga0114341_1013243613300008108Freshwater, PlanktonMKLYQSHPWLYKRYVIQKKTVTEIAIECGVSPMTI
Ga0114343_106528333300008110Freshwater, PlanktonMLKLYQSKEWLYRRYVVQKKTVTEIGKECGVSAMT
Ga0114343_107046523300008110Freshwater, PlanktonMKFYQSKEWLYRRYVVQKKTVTEIGKECGVSAMTIQRHLEQFGLIKKR*
Ga0114343_115086723300008110Freshwater, PlanktonMKLYQSQTWLYRRYVVQKKNITEIAAECGVSAMTI
Ga0114346_101645023300008113Freshwater, PlanktonMVKLYQSKDWLHRRYVVQKKTVTEIALECGTSAMTIQRYLVQFGLIKKR*
Ga0114346_129356523300008113Freshwater, PlanktonMVKFYQSKEWLHRRYVVQKKTVTEIAAECGTSAMTIQRYLVQFGLIKKR*
Ga0114347_107778723300008114Freshwater, PlanktonMKLYQSKEWLHRRYIIQKKTVSEIGKECNVSAMTIQRYLDQFGLIKKR*
Ga0114350_100689823300008116Freshwater, PlanktonMKLYESQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIRKR*
Ga0114354_107748223300008119Freshwater, PlanktonMEHDVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR*
Ga0114336_101768083300008261Freshwater, PlanktonMKLYQSKEWLYRRYVVQKKTVIEIGKECNVSAMTIQRYLDQFGLIKKR*
Ga0104242_100846123300008962FreshwaterMVKLYQSKDWLHRRYVVQKKTVTEIATECGTSAMTIQRYLVQFGLIKKR*
Ga0102831_125443413300008996EstuarineMLKMYQSKDWLYRRYVVQKKTVTEIGKECGVSAMTI
Ga0102829_109338723300009026EstuarineMKLYQSQTWLYRRYVVQKKTVIEIAEECKVSAMTIQRALDKFGVIKKR*
Ga0114980_1019300823300009152Freshwater LakeMKLYQSHPWLYRRYIVQKKTVTEIAIECAVSPMTIQRYLDQFGLIKKR*
Ga0114977_10000059583300009158Freshwater LakeMKLYQSKDWLYRRYVVQKKSITEIAKECNVSAMTIQRHVEQFGLGKKK*
Ga0114977_10003088123300009158Freshwater LakeMKFYQSKEWLYRRYVVQKKTVTEIGKECDVSAMTIQRYLEQFGLIKKR*
Ga0114978_1051654923300009159Freshwater LakeYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRSLDKFGLIKKR*
Ga0114978_1062756013300009159Freshwater LakeMKLYQSKDWLYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKR
Ga0114974_1000289623300009183Freshwater LakeMKLYQSKDWLYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKRR*
Ga0114974_1010666443300009183Freshwater LakeMKLYQSKDWLYRRYVVQKKTVTEIGKECGVSAMTIQRYL
Ga0114974_1078353613300009183Freshwater LakeHRRYVIQKKSMTEIAIECNTSAMTIQRYLTKFGLIKKR*
Ga0114982_119285123300009419Deep SubsurfaceMKFYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEKFGLIKK*
Ga0129333_1050436923300010354Freshwater To Marine Saline GradientMKLYQSQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIRK*
Ga0129333_1060675623300010354Freshwater To Marine Saline GradientMKLYESQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIKKR*
Ga0129336_1048701523300010370Freshwater To Marine Saline GradientMKLYQSKDWLYRRYIVQKKTVTEIAKECNVSAMTKKRYLDQFGLIKKR*
Ga0133913_1191689713300010885Freshwater LakeMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQR
Ga0133913_1297206513300010885Freshwater LakeMEHNVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQ
Ga0133913_1341276033300010885Freshwater LakeVFNMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRSLDKFGLIKKR*
Ga0138308_101880133300010965Lake ChemoclineMKLYQSKDWLYRRYVVQKKNIIEIAKECNVSAMTIQRHIEQFGLGKKK*
Ga0139556_100038813300011011FreshwaterMKLYQSHPWLYRRYIVQKKTVTEIAIECAVSPMTIQRYLEQFQLIKRR*
Ga0119951_105597823300012000FreshwaterMKLYQSKDWLYRRYIVQKKTVTEIANECKVSAMTIQRYLEKFELIRRR*
Ga0119955_1000087183300012006FreshwaterMKLYQSKEWLFRRYSVQKKTIVEIAKECNVSAMTIQRHLEQFGLIKKR*
Ga0153801_101298713300012017FreshwaterMKLYKNKDWLYRRYVVQKKTMENIAQECGVTVMTIY
Ga0157210_102159033300012665FreshwaterYQSKDWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR*
Ga0157208_1000084653300012667FreshwaterMKLYQSKEWLHRRYLIQRKHINEIAKECGVSAMTIQRYIDQFGLNKKR*
Ga0157208_1000217743300012667FreshwaterVKLYQSKEWLHRRYLIQRKHINEIAKECGVSAMTIQRYIDQFGLNKKR*
Ga0157208_1000942923300012667FreshwaterMKFYQSKEWLYRRYVVQKKTVTEIGKECAVSAMTIQRYLEKFGIIKK*
Ga0157208_1004227913300012667FreshwaterMKLYQDKAWLHNRYIIQKKNIVDIAKECGVSAMTIQRYIE
Ga0138283_121553613300012774Freshwater LakeYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKRR*
Ga0170791_1313645213300013295FreshwaterWLYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKRR*
(restricted) Ga0172376_1059558223300014720FreshwaterYQSQTWLYRRYVVQKRSVTEIAAECGVSAMSIQRHLEKFGLIRK*
Ga0211732_1061301173300020141FreshwaterMKFYQSKDWLYRRYVVQKKTVTEIGVECQVSAMTIQRYLEKFGLIKK
Ga0211732_109214713300020141FreshwaterMKLYQSQTWLYRRYVVQKKTVTEIAYECKVSAMTIQRYLEKFQLIKKR
Ga0211736_1020053243300020151FreshwaterMKLYQSQTWLYRRYVVQKKAVTEIADECKVSAMTIQRYLEKFQLIKKR
Ga0211736_1034196243300020151FreshwaterMKLYQSEEWLYRRYVVQKKSVTEIAIECKTSAMTIQRYLTKFGLIKRR
Ga0211736_1077835523300020151FreshwaterMKYYQSEEWLYRRYVVQKKSITEIAIECKTSAMTIQRYLTKFGLIKKR
Ga0211736_1090622453300020151FreshwaterMKLYQSEEWLYRRYVVQKKSVTEIAIECKSSAMTIQRYLTKFGLIKKR
Ga0211736_10966384133300020151FreshwaterMKLYQSEEWLYRRYVVQKKTVTEIAIECKSSAMTIQRYLTKFGLIKKR
Ga0211734_1071565423300020159FreshwaterMKLYQSKEWLYRRYVVQKKTVTEIGKECKVSAMTIQRYLEQFGLIKKR
Ga0211734_1077734513300020159FreshwaterSEEWLYRRYVVQKKSITEIAIECKTSAMTIQRYLTKFGLIKKR
Ga0211726_1017568913300020161FreshwaterTMKLYQSEEWLYRRYVVQKKTVTEIAIECKSSAMTIQRYLTKFGLIKKR
Ga0211735_1017597623300020162FreshwaterLFILEMVIMKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0208201_10162323300020480FreshwaterMKLYQSKDWLYRRYIIQKKTVTEIAIECSVSAMTIQRYLDQFGLIKRR
Ga0208050_100012623300020498FreshwaterMKLYQSKDWLYRRYIVQKKTITEIGKECNVSAMTIQRYLEQFGLIKKR
Ga0208359_100480043300020541FreshwaterMKLYQSKDWLYRRYVVQKKTVTEIGNECGVSAMTIQRYLEQFGLIKKR
Ga0208359_101293043300020541FreshwaterMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQ
Ga0207942_103171223300020549FreshwaterVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0208358_103312123300020555FreshwaterMEHNVKLYQSKEWLYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0208852_104030723300020560FreshwaterMKLYQSKEWLHRRYLVQKKTVTEIAKEAGTSAMTIQRYLVQFGLIKKR
Ga0208465_103377423300020570FreshwaterMKLYQSQIWLYRRYVVQKKTVTEIADECKVSAMTIQRY
Ga0208053_106386323300020575FreshwaterMKMYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRY
Ga0194122_1028221313300021092Freshwater LakeMKLYKSKDWLYRRYVVQRKTMEEIAKECGVTIMTIH
Ga0194048_1016023913300021519Anoxic Zone FreshwaterMKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTIQ
Ga0194060_1050210633300021602Anoxic Zone FreshwaterMKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTVQRY
Ga0213922_109475023300021956FreshwaterMKLYQSKEWLSRRYLYQKKTVTQIAEEAGTSAMTIQ
Ga0222713_1060192023300021962Estuarine WaterMKLYESQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRHLEKFGLIKKR
Ga0222712_10002302103300021963Estuarine WaterMKYYQSEEWLYRRYVIQKKSITEIAIECNTSAMTIQRYLTKFGLIKKR
Ga0214917_10000274623300022752FreshwaterMKLYESQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRHLEKFGLIRKR
Ga0214917_10000649483300022752FreshwaterMKLYQSKDWLYRRYIVQKKTVTEIAIECSVSAMTIQRYLDQFGLIKRR
Ga0214919_10000488623300023184FreshwaterMKFYQSKEWLYRRYVVQKKTVTEIGAECSVSAMTIQRYLEKFGLIRK
Ga0214919_10021300133300023184FreshwaterMKLYQSKEWLFRRYSVQKKTIVEIAKECNVSAMTIQRHLEQFGLIKKR
Ga0244775_1021168723300024346EstuarineMKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIRKR
Ga0244775_1024859813300024346EstuarineIWWVDVNMKLYQSKDWLHRRYVIQKKTMTEIAIECNTSAMTIQRYLTKFGLIKKR
Ga0244775_1030192133300024346EstuarineMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRHLEKFGLIKKR
Ga0244775_1032964343300024346EstuarineMKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKK
Ga0244775_1050589433300024346EstuarineMKYYQSEEWLHRRYVIQKKSMTEIAIECNTSAMTIQRYLTKFGLIKKR
Ga0244775_1084825023300024346EstuarineMKLYQSQTWMYRRYVVQKKTVIEIAEECKVSAMTIQRALDKFGLIKKR
Ga0244775_1153847723300024346EstuarineFRRYSVQKKNIVEIAEECKVSAMTIQRYLEKFGLIKKR
Ga0208566_113643923300025307FreshwaterMKLYKNKDWLYRRYVVQKKSMEEIATECGVTMMTIYR
Ga0255166_105219623300026473FreshwaterYGVNRTMKLYESQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRHLEKFGLIRKR
Ga0255074_103750913300027121FreshwaterMKLYQSQTWMYRRYVVQKKTVIEIAKECKVSAMTIQRALDKFGLIKKR
Ga0255090_102756613300027123FreshwaterMKLYQSKDWLYRRYVVQKKTVTEIAKECNVSAMTIQR
Ga0255067_103070013300027129FreshwaterMLKMYQSKDWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0255066_101025513300027131FreshwaterMKLYQSKDWLHRRYVVQKKTVTEIAEECKVSAMTI
Ga0255066_103677413300027131FreshwaterMKLYQSKDWLYRRYVIQKKTVTEIGKECQVSAMTIQRYLEQFGLIKK
Ga0255065_106254913300027142FreshwaterLYQSKDWLYRRYVIQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0255063_104836133300027151FreshwaterMKLYQSKDWLYRRYVIQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0207994_101294743300027416EstuarineMKLYQSQTWLHRRYVVQKKTVTEIAEECKVSAMTI
Ga0255072_101486743300027508FreshwaterRYVIQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0209651_114742013300027581Freshwater LakeMKLYQNKDWLFRRYSVQKKTIVEIAEECKVSAMTIQ
Ga0208951_1000004203300027621Freshwater LenticMKLYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0208942_100529113300027627Freshwater LenticMKFYQSKEWLYRRYVVQKKTVTEIGAECSVSAMTIQRY
Ga0209551_125412113300027689Freshwater LakeMKLYQNKDWLFRRYSVQKKTVVEIAEECKVSAMTI
Ga0209297_10000351743300027733Freshwater LakeMKLYQSKDWLYRRYVVQKKSITEIAKECNVSAMTIQRHVEQFGLGKKK
Ga0209297_100786683300027733Freshwater LakeMKFYQSKEWLYRRYVVQKKTVTEIGKECDVSAMTIQRYLEQFGLIKKR
Ga0209596_1003262173300027754Freshwater LakeMKLYQSKDWLHRRYIVQKKTVTEIGKECRVSAMTIQRYLQEFGLLRKK
Ga0209444_10002638143300027756Freshwater LakeMKLYQSKDWLHRRYVIQKKSMTEIAIECNTSAMTIQRYLTKFGLIKKR
Ga0209296_100058663300027759Freshwater LakeMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRSLDKFGLIKKR
Ga0209296_1001017223300027759Freshwater LakeMKLYQSKDWLYRRYIVQKKTVTEIAIECSVSPMTIQRYLDQFGLIKRR
Ga0209086_1002042413300027770Freshwater LakeMKLYQSHPWLYRRYIVQKKTVTEIAIECAVSPMTIQRYLDQFGLIKKR
Ga0209500_1038810023300027782Freshwater LakeFYQSKEWLYRRYVVQKKTVTEIGKECDVSAMTIQRYLEQFGLIKKR
Ga0209972_1021039923300027793Freshwater LakeRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR
Ga0209229_1010883723300027805Freshwater And SedimentMKMYQSKEWLYRRYVVQKKTITEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0209230_1011805043300027836Freshwater And SedimentMKLYQDKAWLYNRYIIQKKNIVEIAKECGVSAMTIQRYIDK
Ga0209550_1035777713300027892Freshwater LakeMKLYQSKDWLYRRYIVQKKTVTEIGKECGVSAMTI
Ga0247723_1001891103300028025Deep Subsurface SedimentMKLYQSKEWLYRRYIVQKKTVTEIGKECNVSAMTIQRYLDQFGLIKKR
Ga0247723_100416923300028025Deep Subsurface SedimentMKFYQSKEWLYRRYVVQKKTVTEIGKECQVSAMTIQRYLEKFGLIKK
Ga0247723_108279833300028025Deep Subsurface SedimentMKLYQSKDWLHRRYVVQKKTVIEIAKECNVSAMTIQRYLE
Ga0247723_111408023300028025Deep Subsurface SedimentVKLYKNKEWLYRRYVVQKKTMESIAQECGVTVMTIY
Ga0315907_1008799183300031758FreshwaterMKLYQSKEWLHRRYIIQKKTVSEIGKECNVSAMTIQR
Ga0315907_1077348823300031758FreshwaterMKLYESQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIRKR
Ga0315904_10000145603300031951FreshwaterMKLYQSKDWLYRRYIIQKKTVTEIAIECSVSAMTIQRYLDQFGLIKKR
Ga0315906_1006251913300032050FreshwaterWLYRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR
Ga0315905_1051940833300032092FreshwaterMKLYQDKAWLHNRYVIQKKNIVEIAKESGVSAMTIQRYIDKFGLKIKR
Ga0315902_1073416823300032093FreshwaterQSQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR
Ga0315903_1018584653300032116FreshwaterRTMKLYQSQTWLYRRYVVQKKTVTEIAEECKVSAMTIQRSLDKFGLIKKR
Ga0315903_1042391343300032116FreshwaterMKLYQSQTWLYRRYVVQKKTVTEIADECKVSAMTIQRYL
Ga0310130_0006204_922_10653300034073Fracking WaterMKLYQSQTWLYRRYVVQKKTVTEIAAECKVSAMTIQRHLEKFGLIKK
Ga0335027_0007590_247_3933300034101FreshwaterMKLYQSKEWLYRRYVVQKKTVTEIAIECNTSAMTIQRYLTKFGLIKKR
Ga0335031_0421063_1_1083300034104FreshwaterMKLYQSKDWLHRRYVVQKKTVTEIAKECNVSAMTIQ
Ga0335052_0099247_1640_17563300034279FreshwaterYRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0335007_0097813_2065_21783300034283FreshwaterRRYVVQRKTVTEIGKECQVSAMTIQRYLEQFGLIKKR
Ga0335048_0167705_1119_12383300034356FreshwaterMGSSVKMYKNKDWLHRRYVVQRKSMEEIAQECGVTVMTIY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.