| Basic Information | |
|---|---|
| Family ID | F038632 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MQGMVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGPGRAGEQPDA |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.85 % |
| % of genes near scaffold ends (potentially truncated) | 24.24 % |
| % of genes from short scaffolds (< 2000 bps) | 88.48 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.424 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (17.576 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.485 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.970 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF08768 | THAP4_heme-bd | 65.45 |
| PF02635 | DrsE | 14.55 |
| PF07685 | GATase_3 | 5.45 |
| PF07282 | OrfB_Zn_ribbon | 2.42 |
| PF08353 | MurT_C | 1.82 |
| PF01475 | FUR | 1.82 |
| PF01571 | GCV_T | 0.61 |
| PF04185 | Phosphoesterase | 0.61 |
| PF01797 | Y1_Tnp | 0.61 |
| PF00691 | OmpA | 0.61 |
| PF01740 | STAS | 0.61 |
| PF12728 | HTH_17 | 0.61 |
| PF00903 | Glyoxalase | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 1.82 |
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.61 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.03 % |
| Unclassified | root | N/A | 36.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004479|Ga0062595_101774737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 585 | Open in IMG/M |
| 3300004633|Ga0066395_10327734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 845 | Open in IMG/M |
| 3300004633|Ga0066395_11000046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 510 | Open in IMG/M |
| 3300005162|Ga0066814_10078136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300005168|Ga0066809_10119913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300005172|Ga0066683_10163717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1369 | Open in IMG/M |
| 3300005332|Ga0066388_100846877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1500 | Open in IMG/M |
| 3300005332|Ga0066388_101353046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1232 | Open in IMG/M |
| 3300005332|Ga0066388_101591043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1149 | Open in IMG/M |
| 3300005332|Ga0066388_102427596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 951 | Open in IMG/M |
| 3300005332|Ga0066388_107495309 | Not Available | 547 | Open in IMG/M |
| 3300005336|Ga0070680_101823855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 527 | Open in IMG/M |
| 3300005355|Ga0070671_100077688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2774 | Open in IMG/M |
| 3300005367|Ga0070667_101015524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 774 | Open in IMG/M |
| 3300005406|Ga0070703_10586431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 513 | Open in IMG/M |
| 3300005434|Ga0070709_10506873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
| 3300005434|Ga0070709_10825748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix obliqua | 729 | Open in IMG/M |
| 3300005436|Ga0070713_101262188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 716 | Open in IMG/M |
| 3300005437|Ga0070710_10212288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1227 | Open in IMG/M |
| 3300005456|Ga0070678_100644104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 950 | Open in IMG/M |
| 3300005544|Ga0070686_101196204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300005545|Ga0070695_100319973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1153 | Open in IMG/M |
| 3300005549|Ga0070704_100214774 | Not Available | 1560 | Open in IMG/M |
| 3300005553|Ga0066695_10683578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 604 | Open in IMG/M |
| 3300005554|Ga0066661_10876395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300005560|Ga0066670_10557523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300005615|Ga0070702_100654128 | Not Available | 795 | Open in IMG/M |
| 3300005618|Ga0068864_101319505 | Not Available | 722 | Open in IMG/M |
| 3300005713|Ga0066905_100001109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura rifamycini | 8889 | Open in IMG/M |
| 3300005764|Ga0066903_100123369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3611 | Open in IMG/M |
| 3300005764|Ga0066903_101566957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1247 | Open in IMG/M |
| 3300005764|Ga0066903_101643765 | Not Available | 1220 | Open in IMG/M |
| 3300005764|Ga0066903_101721293 | Not Available | 1195 | Open in IMG/M |
| 3300006028|Ga0070717_10971462 | Not Available | 773 | Open in IMG/M |
| 3300006028|Ga0070717_11633905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 584 | Open in IMG/M |
| 3300006049|Ga0075417_10033899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2131 | Open in IMG/M |
| 3300006755|Ga0079222_10212616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1176 | Open in IMG/M |
| 3300006854|Ga0075425_100231478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2126 | Open in IMG/M |
| 3300006904|Ga0075424_101704015 | Not Available | 667 | Open in IMG/M |
| 3300006954|Ga0079219_10492696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 855 | Open in IMG/M |
| 3300009012|Ga0066710_100368664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2130 | Open in IMG/M |
| 3300009012|Ga0066710_104896029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 501 | Open in IMG/M |
| 3300009137|Ga0066709_101447328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
| 3300009137|Ga0066709_102665847 | Not Available | 667 | Open in IMG/M |
| 3300009137|Ga0066709_104559677 | Not Available | 506 | Open in IMG/M |
| 3300009162|Ga0075423_12759188 | Not Available | 538 | Open in IMG/M |
| 3300009177|Ga0105248_12261186 | Not Available | 619 | Open in IMG/M |
| 3300009792|Ga0126374_10397605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300009792|Ga0126374_10552752 | Not Available | 840 | Open in IMG/M |
| 3300010043|Ga0126380_10112672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1661 | Open in IMG/M |
| 3300010043|Ga0126380_10129413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1576 | Open in IMG/M |
| 3300010043|Ga0126380_10557796 | Not Available | 892 | Open in IMG/M |
| 3300010046|Ga0126384_10254281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1422 | Open in IMG/M |
| 3300010048|Ga0126373_10430155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1351 | Open in IMG/M |
| 3300010154|Ga0127503_10345307 | Not Available | 734 | Open in IMG/M |
| 3300010154|Ga0127503_10721962 | Not Available | 760 | Open in IMG/M |
| 3300010154|Ga0127503_11282772 | Not Available | 1040 | Open in IMG/M |
| 3300010358|Ga0126370_10452219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1071 | Open in IMG/M |
| 3300010358|Ga0126370_12259916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 537 | Open in IMG/M |
| 3300010359|Ga0126376_11718052 | Not Available | 663 | Open in IMG/M |
| 3300010360|Ga0126372_10316737 | Not Available | 1380 | Open in IMG/M |
| 3300010360|Ga0126372_10363861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
| 3300010360|Ga0126372_10674321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1005 | Open in IMG/M |
| 3300010360|Ga0126372_11700473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 672 | Open in IMG/M |
| 3300010360|Ga0126372_12955055 | Not Available | 527 | Open in IMG/M |
| 3300010361|Ga0126378_10685744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1137 | Open in IMG/M |
| 3300010361|Ga0126378_11314639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 818 | Open in IMG/M |
| 3300010366|Ga0126379_10097535 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
| 3300010366|Ga0126379_10168680 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300010366|Ga0126379_10859711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
| 3300010366|Ga0126379_13696327 | Not Available | 513 | Open in IMG/M |
| 3300010376|Ga0126381_101650513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 926 | Open in IMG/M |
| 3300010396|Ga0134126_10078603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4086 | Open in IMG/M |
| 3300010398|Ga0126383_10765637 | Not Available | 1047 | Open in IMG/M |
| 3300010398|Ga0126383_11232766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 838 | Open in IMG/M |
| 3300010398|Ga0126383_11656015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 729 | Open in IMG/M |
| 3300010401|Ga0134121_10233135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1604 | Open in IMG/M |
| 3300011107|Ga0151490_1547342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 652 | Open in IMG/M |
| 3300012198|Ga0137364_10026643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3638 | Open in IMG/M |
| 3300012198|Ga0137364_10072379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2362 | Open in IMG/M |
| 3300012199|Ga0137383_10908055 | Not Available | 643 | Open in IMG/M |
| 3300012200|Ga0137382_10216322 | Not Available | 1320 | Open in IMG/M |
| 3300012201|Ga0137365_10020451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora | 5153 | Open in IMG/M |
| 3300012208|Ga0137376_10303835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix obliqua | 1385 | Open in IMG/M |
| 3300012208|Ga0137376_10506738 | Not Available | 1047 | Open in IMG/M |
| 3300012211|Ga0137377_10113277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2578 | Open in IMG/M |
| 3300012349|Ga0137387_10571436 | Not Available | 820 | Open in IMG/M |
| 3300012350|Ga0137372_10114873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2238 | Open in IMG/M |
| 3300012356|Ga0137371_10337298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300012356|Ga0137371_10343294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1161 | Open in IMG/M |
| 3300012356|Ga0137371_10348235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1151 | Open in IMG/M |
| 3300012356|Ga0137371_11337448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 528 | Open in IMG/M |
| 3300012948|Ga0126375_10300215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1115 | Open in IMG/M |
| 3300012955|Ga0164298_11303691 | Not Available | 556 | Open in IMG/M |
| 3300012961|Ga0164302_11955778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 500 | Open in IMG/M |
| 3300012971|Ga0126369_10166829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2089 | Open in IMG/M |
| 3300012971|Ga0126369_11133339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300012971|Ga0126369_12821944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 569 | Open in IMG/M |
| 3300012984|Ga0164309_10522494 | Not Available | 913 | Open in IMG/M |
| 3300012988|Ga0164306_10180286 | Not Available | 1466 | Open in IMG/M |
| 3300012989|Ga0164305_11010779 | Not Available | 707 | Open in IMG/M |
| 3300013100|Ga0157373_10317782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
| 3300013307|Ga0157372_10805704 | Not Available | 1091 | Open in IMG/M |
| 3300015200|Ga0173480_10960711 | Not Available | 560 | Open in IMG/M |
| 3300015374|Ga0132255_100654295 | Not Available | 1557 | Open in IMG/M |
| 3300016422|Ga0182039_10558442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
| 3300017657|Ga0134074_1160813 | Not Available | 788 | Open in IMG/M |
| 3300017939|Ga0187775_10211808 | Not Available | 725 | Open in IMG/M |
| 3300017944|Ga0187786_10290470 | Not Available | 666 | Open in IMG/M |
| 3300017947|Ga0187785_10036829 | Not Available | 1791 | Open in IMG/M |
| 3300017947|Ga0187785_10319592 | Not Available | 720 | Open in IMG/M |
| 3300017966|Ga0187776_11092967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 592 | Open in IMG/M |
| 3300017999|Ga0187767_10282217 | Not Available | 559 | Open in IMG/M |
| 3300018058|Ga0187766_10514308 | Not Available | 807 | Open in IMG/M |
| 3300018060|Ga0187765_10214056 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300018064|Ga0187773_10239796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
| 3300018064|Ga0187773_10265614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300018089|Ga0187774_10169498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1165 | Open in IMG/M |
| 3300018431|Ga0066655_11141450 | Not Available | 548 | Open in IMG/M |
| 3300018433|Ga0066667_12070266 | Not Available | 525 | Open in IMG/M |
| 3300018482|Ga0066669_10307860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1290 | Open in IMG/M |
| 3300020581|Ga0210399_11405892 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 545 | Open in IMG/M |
| 3300021559|Ga0210409_11350425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300025885|Ga0207653_10447512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 507 | Open in IMG/M |
| 3300025906|Ga0207699_10009039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4944 | Open in IMG/M |
| 3300025906|Ga0207699_10768017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300025926|Ga0207659_10232236 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300025927|Ga0207687_11717395 | Not Available | 538 | Open in IMG/M |
| 3300025931|Ga0207644_10136205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1886 | Open in IMG/M |
| 3300025933|Ga0207706_11093008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 667 | Open in IMG/M |
| 3300026095|Ga0207676_11602490 | Not Available | 649 | Open in IMG/M |
| 3300027646|Ga0209466_1045566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300027787|Ga0209074_10326442 | Not Available | 622 | Open in IMG/M |
| 3300027787|Ga0209074_10514656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 522 | Open in IMG/M |
| 3300027873|Ga0209814_10077737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300027874|Ga0209465_10131679 | Not Available | 1237 | Open in IMG/M |
| 3300028710|Ga0307322_10226634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 515 | Open in IMG/M |
| 3300028792|Ga0307504_10272396 | Not Available | 627 | Open in IMG/M |
| 3300028828|Ga0307312_10971099 | Not Available | 563 | Open in IMG/M |
| 3300028884|Ga0307308_10632398 | Not Available | 513 | Open in IMG/M |
| 3300031231|Ga0170824_123742050 | Not Available | 694 | Open in IMG/M |
| 3300031421|Ga0308194_10053170 | Not Available | 1043 | Open in IMG/M |
| 3300031543|Ga0318516_10344123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 861 | Open in IMG/M |
| 3300031720|Ga0307469_10895752 | Not Available | 821 | Open in IMG/M |
| 3300031740|Ga0307468_100076969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1882 | Open in IMG/M |
| 3300031748|Ga0318492_10281825 | Not Available | 863 | Open in IMG/M |
| 3300031770|Ga0318521_10727004 | Not Available | 603 | Open in IMG/M |
| 3300031781|Ga0318547_10930498 | Not Available | 543 | Open in IMG/M |
| 3300031890|Ga0306925_10489669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1311 | Open in IMG/M |
| 3300032174|Ga0307470_10024345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2787 | Open in IMG/M |
| 3300032783|Ga0335079_10192158 | Not Available | 2269 | Open in IMG/M |
| 3300032783|Ga0335079_10559401 | Not Available | 1212 | Open in IMG/M |
| 3300032805|Ga0335078_10530875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1503 | Open in IMG/M |
| 3300032805|Ga0335078_10550942 | Not Available | 1468 | Open in IMG/M |
| 3300032805|Ga0335078_10707366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1247 | Open in IMG/M |
| 3300032805|Ga0335078_10827396 | Not Available | 1124 | Open in IMG/M |
| 3300032805|Ga0335078_11328980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 818 | Open in IMG/M |
| 3300032828|Ga0335080_10483780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1316 | Open in IMG/M |
| 3300032892|Ga0335081_11947368 | Not Available | 629 | Open in IMG/M |
| 3300032954|Ga0335083_10488597 | Not Available | 1033 | Open in IMG/M |
| 3300032955|Ga0335076_10011420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 8937 | Open in IMG/M |
| 3300032955|Ga0335076_10511391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
| 3300032955|Ga0335076_10557738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300033158|Ga0335077_10470517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1335 | Open in IMG/M |
| 3300033803|Ga0314862_0031017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1095 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.42% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.61% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062595_1017747372 | 3300004479 | Soil | MISGVLVVGAFAAVAAAAGFVATRLYRVSRWAPPGGPGGPGQAGEPTDA* |
| Ga0066395_103277342 | 3300004633 | Tropical Forest Soil | GMQGMVSGVLVVAAFAAVTAAAAFVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0066395_110000462 | 3300004633 | Tropical Forest Soil | MQGMVSGVLVIAAFAAVAAAAGFVAQRLYRASRRVRPGAGSPAQESPDA* |
| Ga0066814_100781361 | 3300005162 | Soil | MQGMLSGVLVVAAFAVVTASAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0066809_101199131 | 3300005168 | Soil | MQGMISGVLVVAAFAAVAAAAGFVATRLYRVSRWAPPGGPAGAGQAGEPTDA* |
| Ga0066683_101637173 | 3300005172 | Soil | MQGMVSGVLVVAAFAVVAAAAAFVATRLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0066388_1008468774 | 3300005332 | Tropical Forest Soil | MISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGPGQAGEPTDA* |
| Ga0066388_1013530463 | 3300005332 | Tropical Forest Soil | MVGAFAAVAAAAGFVAVRLYRVSRWAQPGGAGPAGEPPDA* |
| Ga0066388_1015910433 | 3300005332 | Tropical Forest Soil | MQGMVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGPAPAGEQPDA* |
| Ga0066388_1024275962 | 3300005332 | Tropical Forest Soil | MQGMISGVLVVAAFAAVAAAAGFVAMRLYRVSRWAPPGGPDGPGQAGEPTDA* |
| Ga0066388_1074953092 | 3300005332 | Tropical Forest Soil | MISGVLVVAAFAVVAAAAGFVATRLYRVSRWAPPGEPGGPGQAGEPADA* |
| Ga0070680_1018238552 | 3300005336 | Corn Rhizosphere | MISGVLVVAAFAAVAAAAGFVTARLYRVSRWAPPGGPGGAGGQAGEPTDA* |
| Ga0070671_1000776884 | 3300005355 | Switchgrass Rhizosphere | MISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGAGGQAGEPTDA* |
| Ga0070667_1010155241 | 3300005367 | Switchgrass Rhizosphere | MQGMISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPRGPGGAGGQAGEPTDA* |
| Ga0070703_105864312 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMISGVLVVAAFAAVAAAAGFVTARLYRVSRWAPPGGPGGAGGQAGEPTDA* |
| Ga0070709_105068732 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMISGVLVVAAFAAVAAAAGFVTARLYRVSRWAPPRGPGGAGGQAGEPTDA* |
| Ga0070709_108257482 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRCRRRSARRAAYTAGMQGMISGVLVVGAFAAVAAAAGFVATRLYRVSRWAPPGGPGGRDQAGEPTDA* |
| Ga0070713_1012621882 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMLSGVLVVAAFAVVTAAAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0070710_102122881 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MISGVLVVAAFAAVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGEPTDA* |
| Ga0070678_1006441043 | 3300005456 | Miscanthus Rhizosphere | AFAAVAAAAGFVTARLYRVSRWAPPGGPGGAGQAGEPTDA* |
| Ga0070686_1011962043 | 3300005544 | Switchgrass Rhizosphere | MISGVLVVAAFAAVAAAAGFVTARLYRVSRWAPPRGPGGAGGQAGEP |
| Ga0070695_1003199732 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMISGVLVVAAFAAVAAAAGFVATRLYRVSRWAPPGGPGGRDQAGEPTDA* |
| Ga0070704_1002147743 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MISGVLVVAAFAAVAAAAGFVAARLYRVSRWAPPGGPGGAGGQAGEPTDA* |
| Ga0066695_106835782 | 3300005553 | Soil | MLGVVSGVLMVGAFAAVAVAAGFVAVRLYRVSRWVRPSGPGSAGEPPDA* |
| Ga0066661_108763952 | 3300005554 | Soil | MQGMVSGVLVVAAFAVVAAAAAFVAARLYRVSRWAPPGGPAGPGRAGEQADA* |
| Ga0066670_105575232 | 3300005560 | Soil | MQGMVSGVLVVAAFAAVAAAAAFVATRLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0070702_1006541281 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSGVLVIAAFAVVAAAAGFVVMRLYRVSRRVRPGAGAAAQESPDA* |
| Ga0068864_1013195052 | 3300005618 | Switchgrass Rhizosphere | MQGMISGVLVVAAFAAVAAAAGFVATRLYRVSRWAPPGGPGGRDQAG |
| Ga0066905_1000011094 | 3300005713 | Tropical Forest Soil | MQGMVSGVLVVAAFAVVAAAAGFVAQRLYRASRRARPGAGSPAQESPDA* |
| Ga0066903_1001233696 | 3300005764 | Tropical Forest Soil | MVGAFAAVAAAAGFVAVRLYRVSRWAPPGGAGPAGEPHDA* |
| Ga0066903_1015669574 | 3300005764 | Tropical Forest Soil | MQGMIGGVLVVAAFAAVAAAAGFVAMRLYRVSRWAPPGGPDGPGQAGEPTDA* |
| Ga0066903_1016437653 | 3300005764 | Tropical Forest Soil | MISGVLVVAAFAVVAAAAGFVATRLYRVSRWAPPGETGGPGQAGEPADA* |
| Ga0066903_1017212932 | 3300005764 | Tropical Forest Soil | MQGMVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGPARAGEQPDA* |
| Ga0070717_109714622 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGEPTDA* |
| Ga0070717_116339052 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMISGVLVVGAFAAVAAAAGFVATRLYRVSRWAPPGGPGGRGQAGEPTDA* |
| Ga0075417_100338994 | 3300006049 | Populus Rhizosphere | MVSGVLVIAAFAVVAAAAGFVVMRLYRVSRRVRPGAGGPAQESPDA* |
| Ga0079222_102126162 | 3300006755 | Agricultural Soil | MLSGVLVVAAFAVVTAAAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0075425_1002314782 | 3300006854 | Populus Rhizosphere | MQGMISGVLVVGAFAAVAAAAGFVATRLYRVSRWAPPGGPGGPGQAGEPTDA* |
| Ga0075424_1017040151 | 3300006904 | Populus Rhizosphere | AAFAVVAAAAGFVVMRLYRVSRRVRPGAGGPAQESPDA* |
| Ga0079219_104926962 | 3300006954 | Agricultural Soil | MSRVPPRARARRPAYTSGMQGMLSGVLVVAAFAVVTAAAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0066710_1003686642 | 3300009012 | Grasslands Soil | MVSGVLVIAAFAVVAAAAGFVVMRLYRVSRRVRPGAGGPAQGSPDA |
| Ga0066710_1048960292 | 3300009012 | Grasslands Soil | MQGMLSGVLVVAAFAVVTAAAAVVAARLYRVSRWAPPGGPGGPGRADEQGDA |
| Ga0066709_1014473281 | 3300009137 | Grasslands Soil | MQGMVSGVLVVAAFAVVAAAAAFVATRLYRVSRWAPPGGPGGPGRAG* |
| Ga0066709_1026658472 | 3300009137 | Grasslands Soil | VAPAAAFVAARLYRVSRWAPPGVPACPGRAGEQADA* |
| Ga0066709_1045596772 | 3300009137 | Grasslands Soil | MQGMVSGVLVIAAFAVVAAAAGFVVMRLYRVSRRVRPGAGGPAQESPDA* |
| Ga0075423_127591881 | 3300009162 | Populus Rhizosphere | MVSGVLVIAAFAVVAAAAGFVIMRLYRVSRRVRPGASGPAQESPDA* |
| Ga0105248_122611861 | 3300009177 | Switchgrass Rhizosphere | MISGVLVVAAFAAVAAAAGFVTARLYRVSRWAPPGGPGGAGQAGEPTDA* |
| Ga0126374_103976052 | 3300009792 | Tropical Forest Soil | MQGMISGGLVVAAFAVVAAAAGFVATRLYRVSRWAPAGEPGGPGQAGEPADA* |
| Ga0126374_105527521 | 3300009792 | Tropical Forest Soil | MVSGVLVIAAFAAVAAAAGFVAQRLYRASRRVRPDAGSPAQESPDA* |
| Ga0126380_101126722 | 3300010043 | Tropical Forest Soil | MVSGVLVVAAFAAVAAAAGFVAQRLYRASRRARPGAGSQAQESPDA* |
| Ga0126380_101294131 | 3300010043 | Tropical Forest Soil | MQGMVSGVLVVAAFAVAAAAAGFVAARLYRVSRWAPPGAPGGPARAGEQPDA* |
| Ga0126380_105577962 | 3300010043 | Tropical Forest Soil | MVSGVLVVAAFAVVAAAAGFVAQRLYRASRRARPGAGSPAQESPDA* |
| Ga0126384_102542812 | 3300010046 | Tropical Forest Soil | MQGMVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGPGQAGEPADA* |
| Ga0126373_104301553 | 3300010048 | Tropical Forest Soil | MPGIVGGLLMVGAFAAVAAAAGFVAVRLYRVSRWAQPGGAGPAGEPPDA* |
| Ga0127503_103453071 | 3300010154 | Soil | AFAVVTAAAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0127503_107219621 | 3300010154 | Soil | GVLVVAAFAVVAAAAGFVAARLYRVSRWASPGGPGGPGRAGEQGDA* |
| Ga0127503_112827721 | 3300010154 | Soil | AERPAYTSGMQGMISGVLVVAAFAAVAAAAGFVATRLYRVSRWAPPGGPAGAGQASEPTDA* |
| Ga0126370_104522191 | 3300010358 | Tropical Forest Soil | MQGMVSGVLVVATFAAVTAAAAFVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0126370_122599162 | 3300010358 | Tropical Forest Soil | MQGMVSGVLVVAAFAVIAAAAGIVAARLYRVSRWVPPDGPGDPGPGGEQTDA* |
| Ga0126376_117180522 | 3300010359 | Tropical Forest Soil | RGMQGMVSGVLVIAAFAAVAAAAGFVAQRLYRASRRVRPDAGSPAQESPDA* |
| Ga0126372_103167373 | 3300010360 | Tropical Forest Soil | MISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGPAQAGEQPDA* |
| Ga0126372_103638611 | 3300010360 | Tropical Forest Soil | MQGMVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGEGRAGGVLPSGLRE* |
| Ga0126372_106743212 | 3300010360 | Tropical Forest Soil | MISGGLVVAAFAVVAAAAGFVATRLYRVSRWAPAGEPGGPGQAGEPADA* |
| Ga0126372_117004732 | 3300010360 | Tropical Forest Soil | MVSGLLMVGAFAAVAAAAGFVAVRLYRVSRWAPPGGAGPAGEPPDA* |
| Ga0126372_129550552 | 3300010360 | Tropical Forest Soil | VSGVLVVATFAAVTAAAAFVAARLYRVSRWAPPGGPGGPGRAGEQTDA* |
| Ga0126378_106857442 | 3300010361 | Tropical Forest Soil | MQGMLSGVLVVAAFAAVTVAAAFVAARLYRVSRWVPPDGPGEPGRAGEQTDA* |
| Ga0126378_113146392 | 3300010361 | Tropical Forest Soil | MISGVLVVAAFAAVAAAAGFVAMRLYRVSRWAPPGGPDGPGQAGEPTDA* |
| Ga0126379_100975351 | 3300010366 | Tropical Forest Soil | MLGTVSGVMVVAAFAAVAWAAGFVAVRLYRVSRWAPPGGAGPAGEPHDA* |
| Ga0126379_101686802 | 3300010366 | Tropical Forest Soil | MQGMVSGVLVVATFAAVTAAAAFVAARLYRVSRWAPPGGPGGPGRAGEQTDA* |
| Ga0126379_108597111 | 3300010366 | Tropical Forest Soil | MISGVLVVAAFAVVAAAAGFVATRLYRVSRWAPPGGPGGPGQAGEP |
| Ga0126379_136963271 | 3300010366 | Tropical Forest Soil | GMQGMISGVLVVAAFAAVAAAAGFVAMRLYRVSRWAPPGGPDGPGQAGEPTDA* |
| Ga0126381_1016505132 | 3300010376 | Tropical Forest Soil | MISGLLVVAAFAAVAAAAGFIAMRLYRVSRWAPPGGPDGPGQAGEPTDA* |
| Ga0134126_100786035 | 3300010396 | Terrestrial Soil | MQGMISGVLVVAAFAAVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGEPTDA* |
| Ga0126383_107656372 | 3300010398 | Tropical Forest Soil | MVSGLLMAGAFAAVAAAAGFVAVRLYRVSRWAPPGGAGPAGEPPDA* |
| Ga0126383_112327662 | 3300010398 | Tropical Forest Soil | MQGMISGVLVVAAFAVVAAAAGFVATRLYRVSRWAPPGGPGGPGQAGEPTGA* |
| Ga0126383_116560152 | 3300010398 | Tropical Forest Soil | MQGMISGVPVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGPGQAGEPTDA* |
| Ga0134121_102331351 | 3300010401 | Terrestrial Soil | MISGVLVVAAFAVVAAAAGFVAARLYRVSRWAAPGGPGGAGQAGEPTDA* |
| Ga0151490_15473422 | 3300011107 | Soil | MVSGVLVVAVFAVVAAAAGFVAARLYRVSRWAPPGAPGGPARAGEQPDA* |
| Ga0137364_100266435 | 3300012198 | Vadose Zone Soil | MVSGVLVVAAFAVVAAAAAFVAARLYRVSRWVPPGGPGGPGRAGEQADA* |
| Ga0137364_100723793 | 3300012198 | Vadose Zone Soil | MVSGVLVVAAFAVVAAAAGFVVMRLYRVSRRVRPGAAGPAQESPDA* |
| Ga0137383_109080552 | 3300012199 | Vadose Zone Soil | MQGMVSGVLVVAAFAVVAAAAAFVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0137382_102163223 | 3300012200 | Vadose Zone Soil | MVSGVLVVAAFAVVASAAAFVAARLYRVSRWVPPGGPGGPGRAGEQADA* |
| Ga0137365_100204513 | 3300012201 | Vadose Zone Soil | MQGMVGGVLVVAAFAVVAAAAAFVAARLYRVSRWVPPGEPGGAGRAGEQPDA* |
| Ga0137376_103038352 | 3300012208 | Vadose Zone Soil | MQGMVSGVLVVAAFAVVAAAAGFVAARLYQVSRWAPPGGPGGPGRADEQGDA* |
| Ga0137376_105067383 | 3300012208 | Vadose Zone Soil | MVSGVLVVAAFAVVAAAAGFVVMRLYRVSRRVRPGAGGPAQESPDA* |
| Ga0137377_101132774 | 3300012211 | Vadose Zone Soil | MQGMVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0137387_105714362 | 3300012349 | Vadose Zone Soil | MVSGVLVVAAFAVVAAAAAFVAARLYRVSRWAPPGGPGGPGRAGEQADA* |
| Ga0137372_101148732 | 3300012350 | Vadose Zone Soil | MVSGVLVVAAFAVVAAAAGFVVLRLYRVTRRARPGASGPAQESPDA* |
| Ga0137371_103372982 | 3300012356 | Vadose Zone Soil | MQGMVGGVLVVAAFAVVAAAAAFVAARLYRVSRWVPPGGPGGPGRAGEQADA* |
| Ga0137371_103432943 | 3300012356 | Vadose Zone Soil | MQGMVSGVLVVAAFAVVAAASAFVAARLYRVSRWVPPGGPGGPGRAGEQADA* |
| Ga0137371_103482353 | 3300012356 | Vadose Zone Soil | MVSGLLMVGAFAAVAAAAGFVAVRLYRVSRWAQPGGPGPAGEPPDA* |
| Ga0137371_113374481 | 3300012356 | Vadose Zone Soil | MVSGVLVVAAFAVVAAVAGFVALRLYRVTRRARPGAAGPARESPDA* |
| Ga0126375_103002153 | 3300012948 | Tropical Forest Soil | MVSGVLVIAAFAAVAAAAGFVAQRLYRASRRVRPDAGSP |
| Ga0164298_113036912 | 3300012955 | Soil | MQGMISGVLVVAAFAVVVAAAGFVAARLYRVSRWAPPGAPGGAGGQAGEPTDA* |
| Ga0164302_119557781 | 3300012961 | Soil | RSARRAAYTAGMQGMISGVLVVGAFAAVAAAAGLVATRLYRVSRWAPPGGPGGPGQAGEPTDA* |
| Ga0126369_101668293 | 3300012971 | Tropical Forest Soil | MVSGLLMVGAFAAVAAAAGFVAVRLYRVSRWAPPGGAGPAGEPHDA* |
| Ga0126369_111333393 | 3300012971 | Tropical Forest Soil | MVSGVLVVAAFAAVTAAAAFVAARLYRVSRWAPPGGPGGPGQAGEP |
| Ga0126369_128219442 | 3300012971 | Tropical Forest Soil | MVSGVLVVAAFAAVTVAAAFVAARLYRVSRWVPPDEPGGPGPAGERTDA* |
| Ga0164309_105224941 | 3300012984 | Soil | MISGVLVVGAFAAVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGEPTDA* |
| Ga0164306_101802862 | 3300012988 | Soil | MQGMISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGEPTDA* |
| Ga0164305_110107792 | 3300012989 | Soil | MLSGVLVVAAFAVVTASAAIVAARLYRVSRWAPPGGPGGPGRA |
| Ga0157373_103177822 | 3300013100 | Corn Rhizosphere | MQGMISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGESTDA* |
| Ga0157372_108057041 | 3300013307 | Corn Rhizosphere | TSGMQGMISGVLVVAAFAAVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGEPTDA* |
| Ga0173480_109607112 | 3300015200 | Soil | AAAGFVAARLYRVSRWAPPGAPGGPAQAGEQPDA* |
| Ga0132255_1006542952 | 3300015374 | Arabidopsis Rhizosphere | MVSGVLVIAAFAVVAAAAGFGVMRLYRVSRRVRPGAGAAAQESPDA* |
| Ga0182039_105584423 | 3300016422 | Soil | MQGMLSGVLVVAAFAVVTAAAAIVAVRLYRVSRWAPPGGPGGPGRAGEQTDA |
| Ga0134074_11608132 | 3300017657 | Grasslands Soil | GMQGMVSGVLVVAAFAVVAAAAGFVVMRLYRVSRRVRPGAAGPAQESPDA |
| Ga0187775_102118082 | 3300017939 | Tropical Peatland | MQGMVSGVLVVAAFAVVAAAAGIVAARLYRVSRWAPPGAPGGPAQAGEQPDA |
| Ga0187786_102904701 | 3300017944 | Tropical Peatland | MQGMVSGVLVVAAFAVVAAAAGIVAARLYRVSRWAPPGAPGGPAQAGKQPDA |
| Ga0187785_100368293 | 3300017947 | Tropical Peatland | MQGMVSGVLLVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGPAQAGEQPDA |
| Ga0187785_103195922 | 3300017947 | Tropical Peatland | GMQGMVSGVLVVAAFAAVTVAAAFVATRLYRVSRWVPPGGPDGPGRAGEQTDA |
| Ga0187776_110929671 | 3300017966 | Tropical Peatland | MVSGVLVVAAFAVVTAAAAFVAARLYRVSRWAPPGGPGGPGRAGEQTDA |
| Ga0187767_102822172 | 3300017999 | Tropical Peatland | GMQGMVSGVLVVAAFAAVTVAAAFVATRLYRVSRWAPPGGPGGPGRAGEQPDA |
| Ga0187766_105143081 | 3300018058 | Tropical Peatland | AMVASAAGFVAVRLYRVSRRAQPSGPLPGVAGGASEAPDA |
| Ga0187765_102140562 | 3300018060 | Tropical Peatland | MQGMVSGVLVVAAFAAVTVAAAFVATRLYRVSRWVPPGGPGPGPADEQTDA |
| Ga0187773_102397962 | 3300018064 | Tropical Peatland | MQGMVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGPAQAGEQPDA |
| Ga0187773_102656142 | 3300018064 | Tropical Peatland | MVSGLLVVAAFAVVTAAAAFVAARLYRVSRWAPPGGPGGPGRAGEQTDA |
| Ga0187774_101694982 | 3300018089 | Tropical Peatland | MVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGPAQAGEQPDA |
| Ga0066655_111414501 | 3300018431 | Grasslands Soil | MQGLVSGVLVVAAFAVVAAAAGFGVMRLYRVSRRVRPGAAGPAQASPDA |
| Ga0066667_120702662 | 3300018433 | Grasslands Soil | MQGMVSGVLVVAAFAVVAAAAAFVATRLYRVSRWAPPGGPGGPGRAG |
| Ga0066669_103078601 | 3300018482 | Grasslands Soil | GMVSGVLVVAAFAVVAAAAGFVVMRLYRVSRRARPGAAGPAQESPDA |
| Ga0210399_114058922 | 3300020581 | Soil | MQGMLSGVLVVAAFAVVTASAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA |
| Ga0210409_113504252 | 3300021559 | Soil | MQGMLSGVLVVAAFAVVTAAAAVVAARLYRVSRWAPPGGPGGPGRAGEQADA |
| Ga0207653_104475121 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MISGVLVVAAFAAVAAAAGFVTARLYRVSRWAAPGGPGGAGGQAGEPTDA |
| Ga0207699_100090392 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGEPTDA |
| Ga0207699_107680173 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMISGVLVVGAFAAVAAAAGFVATRLYRVSRWAPPGGPGGRGQAGEPTDA |
| Ga0207659_102322361 | 3300025926 | Miscanthus Rhizosphere | MQGMVSGVLVIAAFAVVAAAAGFVVMRLYRVSRRVRPGAGAAAQESPDA |
| Ga0207687_117173951 | 3300025927 | Miscanthus Rhizosphere | GCRRERARWRSAYTSGMQGMISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGAGQAGEPTDA |
| Ga0207644_101362054 | 3300025931 | Switchgrass Rhizosphere | MISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGAGGQAGEPTDA |
| Ga0207706_110930082 | 3300025933 | Corn Rhizosphere | MVSGVLVIAAFAVVAAAAGFVVMRLYRVSRRVRPGAGAAAQESPDA |
| Ga0207676_116024901 | 3300026095 | Switchgrass Rhizosphere | MISGVLVVAAFAAVAAAAGFVATRLYRVSRWAPPGGPGGRDQAGEPTDA |
| Ga0209466_10455663 | 3300027646 | Tropical Forest Soil | MQGMVSGVLVVAAFAVVAAAAGFVAQRLYRASRRARPGAGSPAQESPDA |
| Ga0209074_103264421 | 3300027787 | Agricultural Soil | MISGVLVVAAFAAVAAAAGFVTARLYRVSRWAPPGGPGGAGG |
| Ga0209074_105146562 | 3300027787 | Agricultural Soil | MQGMLSGVLVVAAFAVVTAAAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA |
| Ga0209814_100777373 | 3300027873 | Populus Rhizosphere | MVSGVLVIAAFAVVAAAAGFVVMRLYRVSRRVRPGAGGPAQESPDA |
| Ga0209465_101316792 | 3300027874 | Tropical Forest Soil | MVGAFAAVAAAAGFVAERLYRVSRWAPPGGAGPAGEPPDA |
| Ga0307322_102266341 | 3300028710 | Soil | MVSGVLVVAAFAVVAAAAGFVVMRLYRVSRRVRPGAAGPAQESSDA |
| Ga0307504_102723962 | 3300028792 | Soil | MLSGVLVVAAFAVVTAAAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA |
| Ga0307312_109710992 | 3300028828 | Soil | ISGVLVVAAFAAVAAAAGFVATRLYRVSRWAPPGGPAGAGQAGEPTDA |
| Ga0307308_106323981 | 3300028884 | Soil | MVSGMLVVAAFAVVAGAAGWVAVRLYRVSRRAEAGGPGPARESPD |
| Ga0170824_1237420502 | 3300031231 | Forest Soil | FAVVAAAAGFVAARLYRVSRWAPPGGPGGPGRAGEQGDA |
| Ga0308194_100531702 | 3300031421 | Soil | RKLRGMQGMVSGVLVIAAFAVVAAAAGFVVMRLYRVSRRVRPGAGGPAQESPDA |
| Ga0318516_103441232 | 3300031543 | Soil | MQGMLSGVLVVAAFGAVAAAAVFVAARLYRVSRWVPPGGPGRPGRPGEPTDA |
| Ga0307469_108957521 | 3300031720 | Hardwood Forest Soil | YTSGMQGMLSGVLVVAAFAVVTAAAAVVAARLYRVSRWAPPGGPGGAGQAGEPTDA |
| Ga0307468_1000769693 | 3300031740 | Hardwood Forest Soil | MVSGVLVVAAFAVVAAAAGFVVMRLYRVSRRVRPGAGAAAQESPDA |
| Ga0318492_102818251 | 3300031748 | Soil | MLSGVLVVAAFAVVTAAAAIVAVRLYRVSRWAPPGGPGGPGRAGEQADA |
| Ga0318521_107270041 | 3300031770 | Soil | TAGMQGMLSGVLVVAAFGAVAAAAVFVAARLYRVSRWVPPGGPGRPGRPGEPTDA |
| Ga0318547_109304981 | 3300031781 | Soil | RARRPAYTSGMQGMLSGVLVVAAFAVVTAAAAIVAARLYRVSRWAPPGGPGGPGRAGEQADA |
| Ga0306925_104896692 | 3300031890 | Soil | MLSGVLVVAAFGAVAAAAVFVAARLYRVSRWVPPGGPGRPGRPGEPTDA |
| Ga0307470_100243451 | 3300032174 | Hardwood Forest Soil | MISGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGAGGQAGEPTDA |
| Ga0335079_101921583 | 3300032783 | Soil | MSRVPPRVRARRPAYTAGMQGMVSGVLVVAAFAVVAAAAGFVAVRLYRVSRWAPPGGPGGPGRAGEQADA |
| Ga0335079_105594012 | 3300032783 | Soil | GMVSGVLVVAAFAAVTVAAAFVATRLYRVSRWVPPGEPGPGPAGGQTDA |
| Ga0335078_105308752 | 3300032805 | Soil | MQGMVSGVLVVAAFAVVAAAAGFVAVRLYRVSRWAPPGGPGGPGRAGEQADA |
| Ga0335078_105509422 | 3300032805 | Soil | MQGMVSGVLVVAAFAAVTVAAAFVATRLYRVSRWVPPGGPGPGPAGEQTDA |
| Ga0335078_107073661 | 3300032805 | Soil | MQGMVSGVLVVAAFAAVAAAAGFVAARLYRVSRWAPPGEPGGPGRAGEQPDA |
| Ga0335078_108273961 | 3300032805 | Soil | MQGMVSGVLVVAAFAVVAAAAGFVAARLYRVSRWAPPGGPGGPGRAGEQPDA |
| Ga0335078_113289802 | 3300032805 | Soil | MQGMISGVLVVAAFAAVAAAAGFVAVRLYRVSRWAPPGGPGGAGQAGGATDA |
| Ga0335080_104837802 | 3300032828 | Soil | MQGMVSGVLVVAAFAAVTVAAAFVATRLYRVSRWVPPGEPGPGPAGGQTDA |
| Ga0335081_119473681 | 3300032892 | Soil | MSRVPPRVRARRPAYTAGMQGMVSGVLVVAAFAVVAAAAGFVAVRLYRVSRWAPPGGPGGPGRAGE |
| Ga0335083_104885971 | 3300032954 | Soil | VLVVAAFAVVAAAAGFVAARLYRVSRWAPPGAPGGPARAGEQPDA |
| Ga0335076_100114203 | 3300032955 | Soil | MQGIVSGVLVVAAFAAVTVAAAFVAARLYRVSRWAPPGGPGGDGRAGEQPDA |
| Ga0335076_105113913 | 3300032955 | Soil | MVSGVLVVAAFAAVTVAAAFVATRLYRVSRWVPPGGPGPGPAGEQTDA |
| Ga0335076_105577382 | 3300032955 | Soil | MQGMISGVLVVAAFAVVAAAAGFVATRLYRVSRWAPPGGPGGPGQAGEPTDA |
| Ga0335077_104705173 | 3300033158 | Soil | MISGVLVVAAFAVVAAAAGFVATRLYRVSRWAPPGGPGGPGQAGEPTDA |
| Ga0314862_0031017_184_330 | 3300033803 | Peatland | MVSGVLVVAAFAAVTVAAAFVATRLYRVSRWVPPGEPGSGPAGGQTDA |
| ⦗Top⦘ |