| Basic Information | |
|---|---|
| Family ID | F038613 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RLFPLTYAVCPACRHRQGFESDVKELICERCKKVGALAWDELS |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 85.45 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.242 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.515 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.72% Coil/Unstructured: 80.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF03473 | MOSC | 12.73 |
| PF12802 | MarR_2 | 10.30 |
| PF00224 | PK | 2.42 |
| PF02887 | PK_C | 1.82 |
| PF16962 | ABC_export | 0.61 |
| PF02575 | YbaB_DNA_bd | 0.61 |
| PF12706 | Lactamase_B_2 | 0.61 |
| PF00005 | ABC_tran | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 4.24 |
| COG0718 | DNA-binding nucleoid-associated protein YbaB/EfbC | Transcription [K] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002560|JGI25383J37093_10138978 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300002562|JGI25382J37095_10112027 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300002908|JGI25382J43887_10041602 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
| 3300002917|JGI25616J43925_10011064 | All Organisms → cellular organisms → Bacteria | 3959 | Open in IMG/M |
| 3300005174|Ga0066680_10069233 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300005177|Ga0066690_10228161 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300005178|Ga0066688_10161090 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300005205|Ga0068999_10064388 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005345|Ga0070692_10196582 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300005438|Ga0070701_10056850 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300005439|Ga0070711_100056977 | All Organisms → cellular organisms → Bacteria | 2704 | Open in IMG/M |
| 3300005441|Ga0070700_100341822 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300005446|Ga0066686_10746306 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005447|Ga0066689_10925059 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005450|Ga0066682_10111860 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300005468|Ga0070707_101367578 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005536|Ga0070697_101165359 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005540|Ga0066697_10008195 | All Organisms → cellular organisms → Bacteria | 5260 | Open in IMG/M |
| 3300005552|Ga0066701_10585568 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005555|Ga0066692_10090866 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300005555|Ga0066692_10926678 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005561|Ga0066699_10392774 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005566|Ga0066693_10043261 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300005568|Ga0066703_10564211 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005569|Ga0066705_10011005 | All Organisms → cellular organisms → Bacteria | 4312 | Open in IMG/M |
| 3300005576|Ga0066708_10323699 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005576|Ga0066708_10338533 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300005598|Ga0066706_10293600 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300005598|Ga0066706_10942628 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005836|Ga0074470_10028029 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300006032|Ga0066696_10143420 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300006032|Ga0066696_10211828 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300006034|Ga0066656_10977657 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006046|Ga0066652_100041521 | All Organisms → cellular organisms → Bacteria | 3395 | Open in IMG/M |
| 3300006796|Ga0066665_10413121 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300006800|Ga0066660_11338066 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006806|Ga0079220_11040735 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006847|Ga0075431_100659705 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300006847|Ga0075431_101515191 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006854|Ga0075425_101795425 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300006871|Ga0075434_100543634 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300006903|Ga0075426_10153560 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300006954|Ga0079219_11962704 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300007255|Ga0099791_10114221 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300009012|Ga0066710_103585140 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009012|Ga0066710_104107930 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009089|Ga0099828_10344557 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300009089|Ga0099828_10790401 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300009090|Ga0099827_11719062 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009100|Ga0075418_12855199 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300009147|Ga0114129_12532829 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010301|Ga0134070_10034065 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300010304|Ga0134088_10592889 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010321|Ga0134067_10144164 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010323|Ga0134086_10001561 | All Organisms → cellular organisms → Bacteria | 6354 | Open in IMG/M |
| 3300010323|Ga0134086_10222368 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010329|Ga0134111_10010725 | All Organisms → cellular organisms → Bacteria | 2928 | Open in IMG/M |
| 3300010329|Ga0134111_10047129 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300010333|Ga0134080_10347560 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010358|Ga0126370_11960628 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010366|Ga0126379_12964426 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010371|Ga0134125_12253164 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010373|Ga0134128_12959939 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010403|Ga0134123_13057318 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300011414|Ga0137442_1089224 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300011443|Ga0137457_1032470 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300012038|Ga0137431_1089499 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012189|Ga0137388_10585028 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300012200|Ga0137382_10756934 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012200|Ga0137382_10833238 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012206|Ga0137380_10067348 | All Organisms → cellular organisms → Bacteria | 3274 | Open in IMG/M |
| 3300012207|Ga0137381_10055484 | All Organisms → cellular organisms → Bacteria | 3281 | Open in IMG/M |
| 3300012208|Ga0137376_10259385 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300012208|Ga0137376_10644430 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300012209|Ga0137379_10916755 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012209|Ga0137379_11296937 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012210|Ga0137378_10156108 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300012211|Ga0137377_11332432 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012285|Ga0137370_10001302 | All Organisms → cellular organisms → Bacteria | 10301 | Open in IMG/M |
| 3300012285|Ga0137370_10334077 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300012349|Ga0137387_10462066 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012349|Ga0137387_10997414 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300012350|Ga0137372_10636610 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012351|Ga0137386_10563702 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300012353|Ga0137367_10032616 | All Organisms → cellular organisms → Bacteria | 4011 | Open in IMG/M |
| 3300012355|Ga0137369_10874275 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012355|Ga0137369_10896252 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012359|Ga0137385_10872298 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012361|Ga0137360_10431726 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300012410|Ga0134060_1448765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
| 3300012917|Ga0137395_10019387 | All Organisms → cellular organisms → Bacteria | 3923 | Open in IMG/M |
| 3300012917|Ga0137395_10311731 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300012918|Ga0137396_10044323 | All Organisms → cellular organisms → Bacteria | 3022 | Open in IMG/M |
| 3300012918|Ga0137396_10387782 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300012918|Ga0137396_10610820 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300012918|Ga0137396_11111706 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012918|Ga0137396_11126937 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012925|Ga0137419_10709656 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012925|Ga0137419_11896186 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012927|Ga0137416_11938208 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012927|Ga0137416_12054457 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012929|Ga0137404_10344772 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300012930|Ga0137407_11986831 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012972|Ga0134077_10229355 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300012976|Ga0134076_10573712 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012977|Ga0134087_10002582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 5457 | Open in IMG/M |
| 3300014150|Ga0134081_10320874 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300014166|Ga0134079_10424905 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300014883|Ga0180086_1145165 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300015359|Ga0134085_10026478 | All Organisms → cellular organisms → Bacteria | 2239 | Open in IMG/M |
| 3300015359|Ga0134085_10223261 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300015359|Ga0134085_10250171 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300015373|Ga0132257_104475654 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300017654|Ga0134069_1020777 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300017656|Ga0134112_10102777 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300017656|Ga0134112_10300322 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300017657|Ga0134074_1170640 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300018012|Ga0187810_10327235 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300018032|Ga0187788_10111816 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300018071|Ga0184618_10274175 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300018433|Ga0066667_10137264 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300018433|Ga0066667_11983240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
| 3300018468|Ga0066662_11680719 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300018482|Ga0066669_10628735 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300019879|Ga0193723_1000197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 22234 | Open in IMG/M |
| 3300021046|Ga0215015_11070252 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300021081|Ga0210379_10209621 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300025322|Ga0209641_10194180 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300025922|Ga0207646_10763590 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300026297|Ga0209237_1189910 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300026298|Ga0209236_1052965 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300026320|Ga0209131_1185306 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300026323|Ga0209472_1265658 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300026324|Ga0209470_1052202 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300026334|Ga0209377_1029237 | All Organisms → cellular organisms → Bacteria | 2662 | Open in IMG/M |
| 3300026343|Ga0209159_1220041 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300026524|Ga0209690_1220059 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300026529|Ga0209806_1089608 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300026529|Ga0209806_1222906 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300026530|Ga0209807_1192857 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300026536|Ga0209058_1030031 | All Organisms → cellular organisms → Bacteria | 3370 | Open in IMG/M |
| 3300026536|Ga0209058_1108144 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300026540|Ga0209376_1067522 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| 3300026540|Ga0209376_1364345 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026550|Ga0209474_10714832 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026552|Ga0209577_10589162 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300026552|Ga0209577_10703041 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300027643|Ga0209076_1088637 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300027655|Ga0209388_1044304 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10127781 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300027862|Ga0209701_10023708 | All Organisms → cellular organisms → Bacteria | 3995 | Open in IMG/M |
| 3300027875|Ga0209283_10356470 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300027882|Ga0209590_10868897 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027909|Ga0209382_10526411 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300028072|Ga0247675_1049751 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300028791|Ga0307290_10046282 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300028828|Ga0307312_10107006 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300031949|Ga0214473_10564321 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300031965|Ga0326597_11061092 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300032205|Ga0307472_100450870 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300032782|Ga0335082_10248750 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300033417|Ga0214471_10597212 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300033417|Ga0214471_11206252 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300033480|Ga0316620_10203704 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300034178|Ga0364934_0403084 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.03% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.21% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.21% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.61% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25383J37093_101389781 | 3300002560 | Grasslands Soil | EIQRVGXPFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKSAGLAWDELS* |
| JGI25382J37095_101120272 | 3300002562 | Grasslands Soil | RLFPLTYAVCPACRHRQAFESDVKELVCERCKKAGALAWDEMS* |
| JGI25382J43887_100416021 | 3300002908 | Grasslands Soil | VGRPFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKSAGLAWDELS* |
| JGI25616J43925_100110641 | 3300002917 | Grasslands Soil | RLFPLTYGVCPTCRHRQAFDAGLTELACDRCHAAAGLAWDEVN* |
| Ga0066680_100692335 | 3300005174 | Soil | FPLTYAVCPACRHRQAFESDVKELSCERCKKAATLAWDEMS* |
| Ga0066690_102281611 | 3300005177 | Soil | FPLTYAVCPACRHRQAFAAQTSELTCDRCHTIAPLSWDETLS* |
| Ga0066688_101610903 | 3300005178 | Soil | IQRVGRLFPLTYAVCPACRHRQGFGTEVKDLTCERCKKQATLAWDEMS* |
| Ga0068999_100643881 | 3300005205 | Natural And Restored Wetlands | LGRIFPLTYAVCPSCRHRQGIEARTNEMTCDRCKKSASMAWDELS* |
| Ga0070692_101965823 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRIFPLTYAVCPACRHRQGIEARTNEMTCDRCKKTAAMAWDELS* |
| Ga0070701_100568501 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | FPLTYAVCPACRHRQGIEARTNEMTCDRCKKTAAMAWDELS* |
| Ga0070711_1000569771 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EFPLTYGVCPACRHRQGFEMRPAELTCDRCHQRANVAWDELS* |
| Ga0070700_1003418221 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | IFPLTYAVCPACRHRQGIEARTNEMTCDRCKKTAAMAWDELS* |
| Ga0066686_107463062 | 3300005446 | Soil | FPLTYAVCPTCRHRQAFESEVKELACERCKKSAAMAWDELS* |
| Ga0066689_109250592 | 3300005447 | Soil | FPLTYAVCPACRHRQGFESDVKELICERCKKTGALAWDEMS* |
| Ga0066682_101118601 | 3300005450 | Soil | LTYAVCPSCRHRQGIEARTNEMTCDRCHKTAVMAWDELS* |
| Ga0070707_1013675781 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FPLTYAVCPACRHRQGFGSDAKDLTCERCKKQATLAWDEMG* |
| Ga0070697_1011653592 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EIQRVGRLFPLTYAVCPACRHRQAFESDVKELSCERCKKAATLAWDEMS* |
| Ga0066697_100081957 | 3300005540 | Soil | IERLGRIFPLTYAVCPSCRHRQGIEARVNDMTCDRCHKSAAMAWDELS* |
| Ga0066701_105855681 | 3300005552 | Soil | PLTYAVCPSCRHRQGFGTDTKELACERCKKSAALAWDELS* |
| Ga0066692_100908664 | 3300005555 | Soil | FPLTYAVCPSCRHRQGIEARTNDMTCDRCHKTAGMAWDELS* |
| Ga0066692_109266782 | 3300005555 | Soil | RPFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKSAGLAWDELS* |
| Ga0066699_103927743 | 3300005561 | Soil | EPRVIERLGRIFPLTYAVCPSCRHRQGIEARTNDMTCDRCHKTAGMAWDELT* |
| Ga0066693_100432611 | 3300005566 | Soil | LTYAVCPSCRHRQAFEADSKALSCERCKKMAGLAWDELS* |
| Ga0066703_105642112 | 3300005568 | Soil | PFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKGAGLAWDELS* |
| Ga0066705_100110051 | 3300005569 | Soil | QRVGRLFPLTYAVCPACRHRQGFESDVKELSCERCKKVGALAWDEMS* |
| Ga0066708_103236991 | 3300005576 | Soil | VGRLFPLTYAVCPACRHRQGFESDVKELICERCKKVGALAWDEMS* |
| Ga0066708_103385331 | 3300005576 | Soil | IQRVGRLFPLTYAVCPACRHRQGFGTDVRDLTCERCKKQATLAWDEMS* |
| Ga0066706_102936001 | 3300005598 | Soil | REIQRVGRPFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKSAGLAWDELS* |
| Ga0066706_109426281 | 3300005598 | Soil | REIQRVGRPFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKGAGLAWDELS* |
| Ga0074470_100280291 | 3300005836 | Sediment (Intertidal) | LIERIGRVFPLTYAVCPTCRHRQAFGTDAKRLNCERCHAAASLAWDELS* |
| Ga0066696_101434204 | 3300006032 | Soil | RIFPLTYAVCPTCRHREAFPADAKELTCERCKKTALLAWEEMS* |
| Ga0066696_102118281 | 3300006032 | Soil | YAVCPACRHRQGFESDVKELICERCKKAGALAWDEMS* |
| Ga0066656_109776572 | 3300006034 | Soil | QRVGRLFPLTYAVCPACRHRQAFESDVKELSCERCKKAATLAWDEMS* |
| Ga0066652_1000415215 | 3300006046 | Soil | FPLTYAVCPSCRHRQGIEARVNEMTCDRCHKSAAMAWDELS* |
| Ga0066665_104131211 | 3300006796 | Soil | TYGVCPSCRHRQAFDGDAKELTCDRCHKSAGLAWDELS* |
| Ga0066660_113380661 | 3300006800 | Soil | RIFPLTYAVCPSCRHRQAFEADSKELSCERCKKMAGLAWDELS* |
| Ga0079220_110407352 | 3300006806 | Agricultural Soil | YAVCPACRHRQGFESDVKELICERCKKVGALAWDELS* |
| Ga0075431_1006597053 | 3300006847 | Populus Rhizosphere | PFPLTYAVCPTCRHRQGFQSRIDEMNCDRCHKAAGLAWDELS* |
| Ga0075431_1015151911 | 3300006847 | Populus Rhizosphere | RVGRPFPLTYAVCPSCRHRQGFQSRIDEMNCDRCHKAAGLAWDELS* |
| Ga0075425_1017954252 | 3300006854 | Populus Rhizosphere | IERIGRIFPLTYAVCPACRHRQAFGADSKRLACDRCHNSAILAWDELS* |
| Ga0075434_1005436343 | 3300006871 | Populus Rhizosphere | RLFPLTYAVCPACRHRQAFEADVKELSCERCKKAATLAWDEMS* |
| Ga0075426_101535601 | 3300006903 | Populus Rhizosphere | CEPRLIERIGRIFPLTYAVCPACRHRQAFGADSKRLACDRCHNSAILAWDELS* |
| Ga0079219_119627042 | 3300006954 | Agricultural Soil | AVCPACRHRQGFGTDVKELSCERCKKLAALAWDELS* |
| Ga0099791_101142211 | 3300007255 | Vadose Zone Soil | EKLGRAIPLTYAVCPACRHRQGFQAGSDEMTCDRCKKSAGLAWDELS* |
| Ga0066710_1035851401 | 3300009012 | Grasslands Soil | LTYGVCPSCRHRQAFDGDAKELTCDRCHKSAGLAWDELS |
| Ga0066710_1041079302 | 3300009012 | Grasslands Soil | LFPLTYAVCPACRHRQGFESDVKELICERCKKTGALAWDEMS |
| Ga0099828_103445571 | 3300009089 | Vadose Zone Soil | TYAVCPACRHRQAFEAKVDELSCDRCHKVATMAWDELS* |
| Ga0099828_107904011 | 3300009089 | Vadose Zone Soil | RVMERLGRIFPLTYAVCPACRHRQAFEGGAEELTCDKCHKAAGLAWEDLS* |
| Ga0099827_117190621 | 3300009090 | Vadose Zone Soil | EPRVIERLGRIFPLTYAVCPACRHRQGIEARTNEMTCDRCHKAATMAWDELS* |
| Ga0075418_128551992 | 3300009100 | Populus Rhizosphere | RCEPRMIERLGRIFPLTYAVCPSCRHRQGIEARTNDMTCDRCKKTAAMAWDELS* |
| Ga0114129_125328292 | 3300009147 | Populus Rhizosphere | GRPFPLTYAVCPSCRHRQGFQSRIDEMNCDRCHKAAGLAWDELS* |
| Ga0134070_100340651 | 3300010301 | Grasslands Soil | AVCPSCRHRQAFEADSRELSCERCKKMAGLAWDELS* |
| Ga0134088_105928892 | 3300010304 | Grasslands Soil | CPACRHRQGFESDVKEMICERCKKAGALAWDEMS* |
| Ga0134067_101441641 | 3300010321 | Grasslands Soil | RLFPLTYAVCPACRHRQGFGTDVRDLTCERCKKQASLAWDEMS* |
| Ga0134086_100015611 | 3300010323 | Grasslands Soil | QRVGRPFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKSAGLAWDELS* |
| Ga0134086_102223682 | 3300010323 | Grasslands Soil | RLFPLTYAVCPACRHRQGFESDVKELICERCKKTGALAWDEMS* |
| Ga0134111_100107251 | 3300010329 | Grasslands Soil | VCPTCRHREAFPADAKELTCERCKKTALLAWEEMS* |
| Ga0134111_100471294 | 3300010329 | Grasslands Soil | PREIQRVGRLFPLTYAVCPACRHRQGFESDVKEMICERCKKAGALAWDEMS* |
| Ga0134080_103475602 | 3300010333 | Grasslands Soil | QCEPRVIERLGRIFPLTYAVCPSCRHRQGIEARTNDMACARCYKTSAMAWDELS* |
| Ga0126370_119606282 | 3300010358 | Tropical Forest Soil | ERIGRIFPLTYAVCPACRHRQAFGADSKRLTCDRCHNSAILAWDELS* |
| Ga0126379_129644261 | 3300010366 | Tropical Forest Soil | PRLIERIGRIFPLTYAVCPACRHRQAFGADSKRLTCDRCHNSAILAWDELS* |
| Ga0134125_122531642 | 3300010371 | Terrestrial Soil | VGRLFPLTYAVCPACRHRQGFESDVKELVCDRCKKAGALAWDEMS* |
| Ga0134128_129599391 | 3300010373 | Terrestrial Soil | AVCPSCRHRQGFQAGNDEMTCDRCKKSAGLAWDELS* |
| Ga0134123_130573182 | 3300010403 | Terrestrial Soil | VRCEPRVIERLGRIFPLTYAVCPACRHRQGIEARTNEMACDRCHKSAAMAWDELS* |
| Ga0137442_10892242 | 3300011414 | Soil | EKLGRVIPLTYAVCPACRHRQGFQAGSDEMTCDRCKKAAGLAWDELS* |
| Ga0137457_10324704 | 3300011443 | Soil | AVCPICRHRQAFESRIDEMVCDKCHKAAPLAWDELS* |
| Ga0137431_10894992 | 3300012038 | Soil | VRCEPRVIERLGRIFPLTYAVCPSCRHRQGIEARTNDMTCDRCKKTAAMAWDELS* |
| Ga0137388_105850281 | 3300012189 | Vadose Zone Soil | PLTYAVCPACRHRQGFEAEVKELVCERCKKVGALAWDEMS* |
| Ga0137382_107569341 | 3300012200 | Vadose Zone Soil | RIFPLTYAVCPACRHRQGIEARTNDMTCDRCHKAAGMAWDELS* |
| Ga0137382_108332382 | 3300012200 | Vadose Zone Soil | PRVIERLGRIFPLTYAVCPACRHRQGIEARTNDMTCDRCHKSAAMAWDELS* |
| Ga0137380_100673481 | 3300012206 | Vadose Zone Soil | VIERLGRIFPLTYAVCPACRHRQGIEARTNDMTCDRCHKSAAMAWDELS* |
| Ga0137381_100554846 | 3300012207 | Vadose Zone Soil | RLFPLTYAVCPACRHRQGFGTDVKDMTCERCKKQASLAWDEMS* |
| Ga0137376_102593851 | 3300012208 | Vadose Zone Soil | AVCPACRHRQGFESDVKEMICERCKKTGALAWDEMS* |
| Ga0137376_106444301 | 3300012208 | Vadose Zone Soil | YAVCPACRHRQGIEARTNDMTCDRCHKSAAMAWDELS* |
| Ga0137379_109167552 | 3300012209 | Vadose Zone Soil | LTYAVCPACRHRQGFESDVKELICERCKKIGALAWDEMS* |
| Ga0137379_112969371 | 3300012209 | Vadose Zone Soil | EPRVIERLGRIFPLTYAVCPACRHRQGIEARTNDMTCDRCHKSAAMAWDELS* |
| Ga0137378_101561084 | 3300012210 | Vadose Zone Soil | REIQRVGRLFPLTYAVCPACRHRQGFESDVKELICERCKKTGALAWDEMS* |
| Ga0137377_113324322 | 3300012211 | Vadose Zone Soil | VCPACRHRQGFESDVKELVCDRRKKTGALAWDEMS* |
| Ga0137370_1000130211 | 3300012285 | Vadose Zone Soil | IEKLGRIFPLTYAVCPSCRHRQGIEARTNEMTCDRCHKTAAMAWDELS* |
| Ga0137370_103340772 | 3300012285 | Vadose Zone Soil | RCEPRVIERLGRIFPLTYAVCPACRHRQGIEARTNDMTCDRCHKAAGMAWDELS* |
| Ga0137387_104620661 | 3300012349 | Vadose Zone Soil | AVCPACRHRQAFESDVKELICERCKKAGALAWDEMS* |
| Ga0137387_109974141 | 3300012349 | Vadose Zone Soil | IQRVGRLFPLTYAVCPACRHRQGFESDVKEMICERCKKTGALAWDEMS* |
| Ga0137372_106366101 | 3300012350 | Vadose Zone Soil | LFPLTYAVCPACRHRQGFDAQAQELTCERCKKTAVVAWDEPG* |
| Ga0137386_105637023 | 3300012351 | Vadose Zone Soil | VFPLTYAVCPACRHRQAFAAQTGQLTCDRCHTVAPLSWDETLS* |
| Ga0137367_100326166 | 3300012353 | Vadose Zone Soil | PLTYAVCPTCRHRQAFESEVKELACERCKKSAAMAWDEMS* |
| Ga0137369_108742751 | 3300012355 | Vadose Zone Soil | VIPLTYAVCPSCRHRQGFQAGSNDMTCDRCKKSAGLAWDELS* |
| Ga0137369_108962521 | 3300012355 | Vadose Zone Soil | PLTYAVCPACRHRQGFESDVKELACERCKKTGALAWDEMS* |
| Ga0137385_108722982 | 3300012359 | Vadose Zone Soil | RIFPLTYAVCPSCRHRQSFETESKELTCERCKKIAGLAWDELS* |
| Ga0137360_104317263 | 3300012361 | Vadose Zone Soil | CEPREIQRVGRLFPLTYAVCPACRHRQGFESDVKELICERCKKTGALAWDEMS* |
| Ga0134060_14487652 | 3300012410 | Grasslands Soil | AVCPVCRHRQSFEADSKELNCDRCKKAAALAWDELS* |
| Ga0137395_100193876 | 3300012917 | Vadose Zone Soil | RVGRLFPLTYAVCPACRHRQGFESDVKELICERCKKTGALAWDEMS* |
| Ga0137395_103117313 | 3300012917 | Vadose Zone Soil | IQRVGRLFPLTYGVCPTCRHRQAFDAGLTELACDRCHAAAGLAWDEVN* |
| Ga0137396_100443235 | 3300012918 | Vadose Zone Soil | PLTYAVCPACRHRQGFESDVKDLVCERCKKAGALAWDEMS* |
| Ga0137396_103877821 | 3300012918 | Vadose Zone Soil | RVMERLGRIFPLSYAVFPACRHLQAFEGGQQELTCDKCHKAAGLAWDELS* |
| Ga0137396_106108201 | 3300012918 | Vadose Zone Soil | LGRVIPLTYAVCPSCRHRQGFQAGSNDMMCDRCKKPAGLAWDELS* |
| Ga0137396_111117061 | 3300012918 | Vadose Zone Soil | PRVIERLGRIFPLTYAVCPACRHRQGIEARTNEMACDRCHKSAAMAWDELS* |
| Ga0137396_111269371 | 3300012918 | Vadose Zone Soil | RCEPRVIERLGRIFPLTYAVCPACRHRQGIEARTNEMECDRCHKAAAMAWDELS* |
| Ga0137419_107096562 | 3300012925 | Vadose Zone Soil | CEPRVIERLGRIFPLTYAVCPACRHRQGIEARTNEMACDRCHKSAAMAWDELS* |
| Ga0137419_118961861 | 3300012925 | Vadose Zone Soil | VIERLGRIFPLTYAVCPACRHRQGIEARTNEMICDRCHKSAAMAWDELS* |
| Ga0137416_119382082 | 3300012927 | Vadose Zone Soil | FPLTYAVCPACRHRQGIEARTNEMICDRCHKSAAMAWDELS* |
| Ga0137416_120544572 | 3300012927 | Vadose Zone Soil | ERLGRIFPLTYAVCPACRHRQGIEARTNEMICDRCHKSAAMAWDELS* |
| Ga0137404_103447723 | 3300012929 | Vadose Zone Soil | TYAVCPACRHRQGFESDVKELICERCKKVGALAWDEMS* |
| Ga0137407_119868311 | 3300012930 | Vadose Zone Soil | LTYAVCPACRHRQGIEARTNDMTCDRCHKAAGMAWDELS* |
| Ga0134077_102293552 | 3300012972 | Grasslands Soil | LFPLTYAVCPACRHRQGFESDVKELICERCKKVGALAWDEMS* |
| Ga0134076_105737122 | 3300012976 | Grasslands Soil | PRDVERVGRPFPLTYAVCPSCRHRQGFQSRVDEMGCDRCHKTAGLAWDELS* |
| Ga0134087_100025821 | 3300012977 | Grasslands Soil | EIQRVGRLFPLTYAVCPACRHRQGFGTEVKDLTCERCKKQATLAWDEMS* |
| Ga0134081_103208742 | 3300014150 | Grasslands Soil | TYAVCPSCRHRQAFEADSKELSCERCKKMAGLAWDELS* |
| Ga0134079_104249051 | 3300014166 | Grasslands Soil | RLFPLTYAVCPACRHRQGFESDVKELICERCKKVGALAWDELS* |
| Ga0180086_11451652 | 3300014883 | Soil | AVCPACRHRQAFGADAKRLACDRCHNAAPLAWDELS* |
| Ga0134085_100264785 | 3300015359 | Grasslands Soil | CPSCRHRQGFEARIDQMTCDKCHKEAGLAWDELS* |
| Ga0134085_102232612 | 3300015359 | Grasslands Soil | GRLFPLTYAVCPACRHRQGFESDVKEMICERCKKTGALAWDEMS* |
| Ga0134085_102501711 | 3300015359 | Grasslands Soil | PLTYAVCPACRHRQGFESDVKELICERCKKTGALAWDEMS* |
| Ga0132257_1044756542 | 3300015373 | Arabidopsis Rhizosphere | GRIFPLTYAVCPNCRHRQGIEARTNEMACDRCHKSATMAWDELS* |
| Ga0134069_10207774 | 3300017654 | Grasslands Soil | VCPACRHRQAFAAQTGQLTCDRCHTVAPLSWDETLS |
| Ga0134112_101027771 | 3300017656 | Grasslands Soil | RLFPLTYAVCPACRHRQGFESDVKELICERCKKAGALAWDEMS |
| Ga0134112_103003222 | 3300017656 | Grasslands Soil | AVCPACRHRQAFESDVKELSCERCKKAATLAWDEMS |
| Ga0134074_11706402 | 3300017657 | Grasslands Soil | GRLFPLTYAVCPACRHRQGFESDVKELICERCKKAGALAWDEMS |
| Ga0187810_103272351 | 3300018012 | Freshwater Sediment | REIERLGRTFPLTYAVCPRCRHRQAFNGDSRELVCDRCHVAAPLAWDEMS |
| Ga0187788_101118161 | 3300018032 | Tropical Peatland | YAVCPRCRHRQAFEGDSKELTCDRCHATSALAWDDMS |
| Ga0184618_102741752 | 3300018071 | Groundwater Sediment | PLTYAVCPACRHRQGFQAGGDEMTCDRCKKTAGLAWDELS |
| Ga0066667_101372644 | 3300018433 | Grasslands Soil | PLTYAVCPACRHRQGFESDVKELICERCKKVGALAWDELS |
| Ga0066667_119832401 | 3300018433 | Grasslands Soil | QRVGRLFPLTYAVCPTCRHRQAFGADVKELSCERCKKTAALAWDELS |
| Ga0066662_116807191 | 3300018468 | Grasslands Soil | QRGRRLFPLTYAVGPACRHRQGFESDVKELICERCKKVGALAWDELS |
| Ga0066669_106287353 | 3300018482 | Grasslands Soil | CEAREIQRVGRLFPLTYAVCPACRHRQGFGTEVKDLTCERCKKQATLAWDEMS |
| Ga0193723_100019725 | 3300019879 | Soil | IVKCEPRVMEKLGRAIPLTYAVCPACRHRQGFQAGSDEMTCDRCKKSAGLAWDELS |
| Ga0215015_110702523 | 3300021046 | Soil | TYGVCPRCRHRQGFNSSSPELTCDRCHNTASMAWDEMS |
| Ga0210379_102096211 | 3300021081 | Groundwater Sediment | IPLTYAVCPACRHRQGFQAGSDEMTCDRCKKSAGLAWDELS |
| Ga0209641_101941804 | 3300025322 | Soil | IQRVGRLFPLTYAVCPACRHRQAFEADTKELTCERCKKVAALAWDELS |
| Ga0207646_107635902 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLLFPLTYAVCPSCRHRQGIEARTNEMTCARCHKTAAMAWDELS |
| Ga0209237_11899102 | 3300026297 | Grasslands Soil | RLFPLTYAVCPACRHRQGFESDVKELICERCKKVGALAWDEMS |
| Ga0209236_10529651 | 3300026298 | Grasslands Soil | FPLTYAVCPTCRHRQAFGADVKELSCERCKKTAGLAWDELS |
| Ga0209131_11853063 | 3300026320 | Grasslands Soil | YAVCPACRHRQGFEAEVKELVCERCKKTGALAWDEMS |
| Ga0209472_12656582 | 3300026323 | Soil | FPLTYAVCPACRHRQGFGTDVRDLTCERCKKQASLAWDEMS |
| Ga0209470_10522021 | 3300026324 | Soil | IERLGRIFPLTYAVCPSCRHRQGIEARVNEMMCDRCHKSAAMAWDELS |
| Ga0209377_10292374 | 3300026334 | Soil | QRVGRIFPLTYAVCPSCRHRQAFEADSKELSCERCKKMAGLAWDELS |
| Ga0209159_12200411 | 3300026343 | Soil | VGRLFPLTYAVCPACRHRQGFESDVKELICERCKKTGALAWDEMS |
| Ga0209690_12200592 | 3300026524 | Soil | LTYAVCPACRHRQAFQAGAQQLTCDKCHQAAALAWDELS |
| Ga0209806_10896081 | 3300026529 | Soil | VGRPFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKSAGLAWDELS |
| Ga0209806_12229062 | 3300026529 | Soil | VGRPFPLTYGVCPSCRHRQAFDGDAKELTCDRCHKGAGLAWDELS |
| Ga0209807_11928571 | 3300026530 | Soil | MQRVGRLFPLTYAVCPACRHRQGFESDVKELSCERCKKVGALAWDEMS |
| Ga0209058_10300311 | 3300026536 | Soil | GRLFPLTYAVCPACRHRQAFESDVKELICERCKKAGALAWDEMS |
| Ga0209058_11081441 | 3300026536 | Soil | RLFPLTYAVCPACRHRQGFESDVKEMICERCKKAGALAWDEMS |
| Ga0209376_10675221 | 3300026540 | Soil | RLFPLTYAVCPACRHRQAFESDVKELICERCKKAGALAWDEMS |
| Ga0209376_13643452 | 3300026540 | Soil | YAVCPACRHRQGFESDVKELICERCKKVGALAWDEMS |
| Ga0209474_107148322 | 3300026550 | Soil | LTYAVCPACRHRQGFGTEVKDLTCERCKKQATLAWDEMS |
| Ga0209577_105891622 | 3300026552 | Soil | AVCPSCRHRQGIEARTNDMTCDRCHKMAGMAWDELS |
| Ga0209577_107030411 | 3300026552 | Soil | LTYAVCPACRHRQAFGSEVKDLTCERCKKHATLAWDEMS |
| Ga0209076_10886372 | 3300027643 | Vadose Zone Soil | VCPACRHRQGFEAEVKELVCERCKKTGALAWDEMS |
| Ga0209388_10443043 | 3300027655 | Vadose Zone Soil | YAVCPACRHRQGFQAGSDEMTCDRCKKSAGLAWDELS |
| (restricted) Ga0233416_101277812 | 3300027799 | Sediment | LGRVFPLTYAVCPSCRHRQAFEARVDHMTCDRCRKVASLAWDELS |
| Ga0209701_100237081 | 3300027862 | Vadose Zone Soil | SYAMCPACRHRQAFEGGQQELTCDKCHKSAGLAWDELS |
| Ga0209283_103564701 | 3300027875 | Vadose Zone Soil | TYAVCPACRHRQAFEAKVDELSCDRCHKVATMAWDELS |
| Ga0209590_108688971 | 3300027882 | Vadose Zone Soil | EPRVIERLGRIFPLTYAVCPACRHRQGIEARTNEMTCDRCHKAATMAWDELS |
| Ga0209382_105264113 | 3300027909 | Populus Rhizosphere | FPLTYAVCPACRHRQAFGADAKRLTCDRCHNLAALAWDELS |
| Ga0247675_10497512 | 3300028072 | Soil | GPRLIERIGRIFPLTYAVCPACRHRQAFGADSKRLTCDRCHNSAILAWDELS |
| Ga0307290_100462821 | 3300028791 | Soil | IVKCEPRVMEKLGRVIPLTYAVCPACRHRQGFQAGSDEMTCARCKKSAGLAWDELS |
| Ga0307312_101070061 | 3300028828 | Soil | EPREIQRVGRLFPLTYAVCPACRHRQAFESDVKDLTCDRCKKAATLAWDEMS |
| Ga0214473_105643213 | 3300031949 | Soil | TYAVCPSCRHRQLFDADRRELTCDRCHQAATLAWDELS |
| Ga0326597_110610921 | 3300031965 | Soil | EKLGRTFPLTYAVCPSCRNRQGFEARIDEMTCNRCKKTAGLAWDELS |
| Ga0307472_1004508701 | 3300032205 | Hardwood Forest Soil | EPREIQRVGRLFPLTYAVCPACRHRQGFESDVKEMICERCKKTGALAWDEMS |
| Ga0335082_102487501 | 3300032782 | Soil | YGVCPACRHRQGFEARPTELACDRCHQRANVAWDELS |
| Ga0214471_105972123 | 3300033417 | Soil | RVIEKLGRTFPLTYAVCPSCRNRQGFEARIDEMTCNRCKKIAGLAWDELS |
| Ga0214471_112062522 | 3300033417 | Soil | MIERLGRIFPLTYAVCPACRHRQGIEARTNEMTCDRCKKTAAMAWDELS |
| Ga0316620_102037041 | 3300033480 | Soil | TYAVCPACRHRQAFGADAKRLTCDRCHNLATLAWDELS |
| Ga0364934_0403084_1_111 | 3300034178 | Sediment | AVCPSCRHRQGFQAGGDEMTCDRCKKAAGLAWDELS |
| ⦗Top⦘ |