| Basic Information | |
|---|---|
| Family ID | F038581 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFILVAGFAILTFAR |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.48 % |
| % of genes near scaffold ends (potentially truncated) | 19.39 % |
| % of genes from short scaffolds (< 2000 bps) | 82.42 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.394 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.758 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.08% β-sheet: 0.00% Coil/Unstructured: 68.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 13.94 |
| PF13561 | adh_short_C2 | 7.88 |
| PF05163 | DinB | 7.88 |
| PF03641 | Lysine_decarbox | 4.24 |
| PF12681 | Glyoxalase_2 | 1.82 |
| PF04209 | HgmA_C | 1.21 |
| PF01035 | DNA_binding_1 | 1.21 |
| PF00300 | His_Phos_1 | 0.61 |
| PF01425 | Amidase | 0.61 |
| PF07179 | SseB | 0.61 |
| PF12840 | HTH_20 | 0.61 |
| PF01022 | HTH_5 | 0.61 |
| PF00005 | ABC_tran | 0.61 |
| PF08327 | AHSA1 | 0.61 |
| PF02481 | DNA_processg_A | 0.61 |
| PF10079 | BshC | 0.61 |
| PF00293 | NUDIX | 0.61 |
| PF02511 | Thy1 | 0.61 |
| PF02805 | Ada_Zn_binding | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 7.88 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 4.24 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 1.21 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.21 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.21 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 1.21 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.61 |
| COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.39 % |
| Unclassified | root | N/A | 0.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig187797 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig63577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig68354 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300000956|JGI10216J12902_106358384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2292 | Open in IMG/M |
| 3300001535|A3PFW1_10096735 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300001535|A3PFW1_10137459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 814 | Open in IMG/M |
| 3300002120|C687J26616_10012367 | All Organisms → cellular organisms → Bacteria | 3333 | Open in IMG/M |
| 3300002121|C687J26615_10101602 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300002122|C687J26623_10029758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1453 | Open in IMG/M |
| 3300002407|C687J29651_10283299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300002503|C687J35164_10173323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
| 3300003203|JGI25406J46586_10093178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 906 | Open in IMG/M |
| 3300003349|JGI26129J50193_1018476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 516 | Open in IMG/M |
| 3300003987|Ga0055471_10060380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1046 | Open in IMG/M |
| 3300003993|Ga0055468_10257985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300003998|Ga0055472_10086757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 857 | Open in IMG/M |
| 3300004002|Ga0055477_10203961 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300004002|Ga0055477_10350483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300004013|Ga0055465_10247193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300004020|Ga0055440_10212876 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300004114|Ga0062593_100356458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1282 | Open in IMG/M |
| 3300004114|Ga0062593_100541390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1092 | Open in IMG/M |
| 3300004114|Ga0062593_102243529 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300004156|Ga0062589_102118298 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300004157|Ga0062590_101657654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
| 3300004463|Ga0063356_104734505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
| 3300004463|Ga0063356_104861432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300004479|Ga0062595_100069317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1722 | Open in IMG/M |
| 3300004479|Ga0062595_101281878 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005093|Ga0062594_101328487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 724 | Open in IMG/M |
| 3300005172|Ga0066683_10559211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 697 | Open in IMG/M |
| 3300005294|Ga0065705_10220441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1321 | Open in IMG/M |
| 3300005294|Ga0065705_10649230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 678 | Open in IMG/M |
| 3300005440|Ga0070705_100003258 | All Organisms → cellular organisms → Bacteria | 7979 | Open in IMG/M |
| 3300005440|Ga0070705_100936961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
| 3300005444|Ga0070694_100833166 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005445|Ga0070708_100092274 | All Organisms → cellular organisms → Bacteria | 2759 | Open in IMG/M |
| 3300005445|Ga0070708_100402395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1291 | Open in IMG/M |
| 3300005445|Ga0070708_100731031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 931 | Open in IMG/M |
| 3300005467|Ga0070706_101780213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300005471|Ga0070698_100024732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6263 | Open in IMG/M |
| 3300005556|Ga0066707_10304093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1044 | Open in IMG/M |
| 3300005557|Ga0066704_10127814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1691 | Open in IMG/M |
| 3300005558|Ga0066698_10074824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2192 | Open in IMG/M |
| 3300005586|Ga0066691_10480863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 742 | Open in IMG/M |
| 3300005875|Ga0075293_1069737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300005876|Ga0075300_1046459 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005878|Ga0075297_1031008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 607 | Open in IMG/M |
| 3300005879|Ga0075295_1012670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 909 | Open in IMG/M |
| 3300005886|Ga0075286_1004199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1636 | Open in IMG/M |
| 3300006854|Ga0075425_100010252 | All Organisms → cellular organisms → Bacteria | 9991 | Open in IMG/M |
| 3300006894|Ga0079215_10360115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 837 | Open in IMG/M |
| 3300007740|Ga0104326_118295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1435 | Open in IMG/M |
| 3300009012|Ga0066710_100312229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2308 | Open in IMG/M |
| 3300009137|Ga0066709_100773927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1388 | Open in IMG/M |
| 3300009162|Ga0075423_10366099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1512 | Open in IMG/M |
| 3300009162|Ga0075423_11579340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 705 | Open in IMG/M |
| 3300009166|Ga0105100_10267961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1022 | Open in IMG/M |
| 3300009553|Ga0105249_13454205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
| 3300010041|Ga0126312_11381748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300010391|Ga0136847_11158873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1153 | Open in IMG/M |
| 3300012010|Ga0120118_1104124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 688 | Open in IMG/M |
| 3300012014|Ga0120159_1056199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1223 | Open in IMG/M |
| 3300012019|Ga0120139_1139290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 627 | Open in IMG/M |
| 3300012204|Ga0137374_10169496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1922 | Open in IMG/M |
| 3300012355|Ga0137369_10173223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1693 | Open in IMG/M |
| 3300012360|Ga0137375_10305333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1437 | Open in IMG/M |
| 3300012914|Ga0157297_10307867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 599 | Open in IMG/M |
| 3300012931|Ga0153915_10001148 | All Organisms → cellular organisms → Bacteria | 24417 | Open in IMG/M |
| 3300012931|Ga0153915_10427547 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300013294|Ga0120150_1060097 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 729 | Open in IMG/M |
| 3300013772|Ga0120158_10420306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 609 | Open in IMG/M |
| 3300015209|Ga0167629_1025849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2109 | Open in IMG/M |
| 3300015253|Ga0180081_1041928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 763 | Open in IMG/M |
| 3300015371|Ga0132258_10123409 | All Organisms → cellular organisms → Bacteria | 6158 | Open in IMG/M |
| 3300015371|Ga0132258_10981110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2135 | Open in IMG/M |
| 3300015373|Ga0132257_100384207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1704 | Open in IMG/M |
| 3300015374|Ga0132255_100329638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2205 | Open in IMG/M |
| 3300017659|Ga0134083_10079692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1270 | Open in IMG/M |
| 3300017997|Ga0184610_1077218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1027 | Open in IMG/M |
| 3300017997|Ga0184610_1125617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 829 | Open in IMG/M |
| 3300018052|Ga0184638_1206880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 689 | Open in IMG/M |
| 3300018052|Ga0184638_1228815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300018053|Ga0184626_10172296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 919 | Open in IMG/M |
| 3300018053|Ga0184626_10408448 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300018063|Ga0184637_10204795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1210 | Open in IMG/M |
| 3300018063|Ga0184637_10225595 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300018071|Ga0184618_10000731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 7765 | Open in IMG/M |
| 3300018071|Ga0184618_10030474 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300018075|Ga0184632_10003645 | All Organisms → cellular organisms → Bacteria | 6411 | Open in IMG/M |
| 3300018076|Ga0184609_10577780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300018082|Ga0184639_10395188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 715 | Open in IMG/M |
| 3300018429|Ga0190272_13198690 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018469|Ga0190270_12938405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300019255|Ga0184643_1384494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300019888|Ga0193751_1000641 | All Organisms → cellular organisms → Bacteria | 25854 | Open in IMG/M |
| 3300020059|Ga0193745_1072969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 748 | Open in IMG/M |
| 3300021080|Ga0210382_10056643 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300021344|Ga0193719_10325345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 642 | Open in IMG/M |
| 3300022213|Ga0224500_10021795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2738 | Open in IMG/M |
| 3300022214|Ga0224505_10050323 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300025002|Ga0209001_1072612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
| 3300025159|Ga0209619_10445859 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300025160|Ga0209109_10004099 | All Organisms → cellular organisms → Bacteria | 7924 | Open in IMG/M |
| 3300025160|Ga0209109_10016556 | All Organisms → cellular organisms → Bacteria | 3967 | Open in IMG/M |
| 3300025160|Ga0209109_10331744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 720 | Open in IMG/M |
| 3300025318|Ga0209519_10727680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300025325|Ga0209341_10081844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2727 | Open in IMG/M |
| 3300025325|Ga0209341_10257246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1447 | Open in IMG/M |
| 3300025325|Ga0209341_10758707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 740 | Open in IMG/M |
| 3300025538|Ga0210132_1077481 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025796|Ga0210113_1113170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300025817|Ga0210144_1186894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300025885|Ga0207653_10420548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300025912|Ga0207707_11186750 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300025922|Ga0207646_10026551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5284 | Open in IMG/M |
| 3300025922|Ga0207646_11528678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300025932|Ga0207690_11765245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 517 | Open in IMG/M |
| 3300026089|Ga0207648_10372112 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300026089|Ga0207648_11689118 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026535|Ga0256867_10025069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2528 | Open in IMG/M |
| 3300027526|Ga0209968_1083997 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300027636|Ga0214469_1044530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1400 | Open in IMG/M |
| 3300027647|Ga0214468_1030950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1431 | Open in IMG/M |
| 3300027650|Ga0256866_1058731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1022 | Open in IMG/M |
| 3300028708|Ga0307295_10075927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 888 | Open in IMG/M |
| 3300028717|Ga0307298_10202195 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300028722|Ga0307319_10133038 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300028771|Ga0307320_10169826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 848 | Open in IMG/M |
| 3300028784|Ga0307282_10099989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1345 | Open in IMG/M |
| 3300028792|Ga0307504_10001246 | All Organisms → cellular organisms → Bacteria | 4971 | Open in IMG/M |
| 3300028793|Ga0307299_10061817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1386 | Open in IMG/M |
| 3300028807|Ga0307305_10435564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 591 | Open in IMG/M |
| 3300028814|Ga0307302_10067640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1679 | Open in IMG/M |
| 3300028819|Ga0307296_10194907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1099 | Open in IMG/M |
| 3300028824|Ga0307310_10344706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 731 | Open in IMG/M |
| 3300028828|Ga0307312_10216926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1232 | Open in IMG/M |
| 3300028828|Ga0307312_10330637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 995 | Open in IMG/M |
| 3300028828|Ga0307312_10365894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 944 | Open in IMG/M |
| 3300028828|Ga0307312_11171691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 508 | Open in IMG/M |
| 3300028878|Ga0307278_10315900 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300028884|Ga0307308_10568997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300030006|Ga0299907_10073378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2772 | Open in IMG/M |
| 3300030006|Ga0299907_10524071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 933 | Open in IMG/M |
| 3300030006|Ga0299907_10971487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 626 | Open in IMG/M |
| 3300030619|Ga0268386_10797162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 604 | Open in IMG/M |
| 3300031229|Ga0299913_10009031 | All Organisms → cellular organisms → Bacteria | 8795 | Open in IMG/M |
| 3300031229|Ga0299913_10288539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1626 | Open in IMG/M |
| 3300031229|Ga0299913_10778980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 931 | Open in IMG/M |
| 3300031716|Ga0310813_11083452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 734 | Open in IMG/M |
| 3300031740|Ga0307468_102433648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
| 3300031949|Ga0214473_11037980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 862 | Open in IMG/M |
| 3300031965|Ga0326597_11322305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 703 | Open in IMG/M |
| 3300031965|Ga0326597_12014785 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032061|Ga0315540_10270651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 712 | Open in IMG/M |
| 3300032075|Ga0310890_11327734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 589 | Open in IMG/M |
| 3300032163|Ga0315281_10005598 | All Organisms → cellular organisms → Bacteria | 17962 | Open in IMG/M |
| 3300032163|Ga0315281_10048394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5201 | Open in IMG/M |
| 3300033407|Ga0214472_10007440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 11458 | Open in IMG/M |
| 3300033417|Ga0214471_10001362 | All Organisms → cellular organisms → Bacteria | 19415 | Open in IMG/M |
| 3300033433|Ga0326726_10356027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1382 | Open in IMG/M |
| 3300033433|Ga0326726_11234429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 727 | Open in IMG/M |
| 3300033812|Ga0364926_149869 | Not Available | 501 | Open in IMG/M |
| 3300033814|Ga0364930_0188474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
| 3300034773|Ga0364936_107331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 4.85% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.42% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.82% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.21% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.21% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.21% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.21% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.21% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.21% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.61% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.61% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.61% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.61% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
| 3300002503 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Host-Associated | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004002 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
| 3300015253 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025002 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025817 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_03421640 | 2124908032 | Soil | MSRRSSRRGRPYQPLPDHRSNWGAKLVVVFVAFILVAGFAILTFAR |
| A5_c1_00998800 | 2124908044 | Soil | VSRRSSRRGRPYQPLPDRRSNWGAKLVVIFVALILVAGFAILTFAR |
| A5_c1_00537900 | 2124908044 | Soil | MSRRSQRRGRPYQPLPERHINWGARLTVVVIAFILVIGFAILAFAR |
| JGI10216J12902_1063583842 | 3300000956 | Soil | VTRRRQRGRPYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFAR* |
| A3PFW1_100967351 | 3300001535 | Permafrost | GRPYQPLPARQVNWGARLVIVVVAVVLVAGFAILSFAR* |
| A3PFW1_101374591 | 3300001535 | Permafrost | MSRRSQRRGRPYQPLPARQVNWGARLVIVFVAFVLVAGFAILSFAR* |
| C687J26616_100123676 | 3300002120 | Soil | MSRRSSRRGRPYQPLPRRRVNWGARLLVVFVAFILVAGFAILTFAR* |
| C687J26615_101016023 | 3300002121 | Soil | MSRRSSRRGRPYQPLPVRRVNWVARLVVVFVAFILVAGFAILTFAR* |
| C687J26623_100297584 | 3300002122 | Soil | MSRRSSRRGRPYQPLPRRRVNWGARLLVVFVAFILVAGFAILTFA |
| C687J29651_102832992 | 3300002407 | Soil | MSRRSSRRGRPYQPLPRRRVNWGARLLVVFVAFILVAGFAIL |
| C687J35164_101733232 | 3300002503 | Soil | MSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFILVAGFAILTFAR* |
| JGI25406J46586_100931782 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MTRRRRGRPYQPYPVRSVNWGARLIIVAVGFIMIVGFAILTFTH* |
| JGI26129J50193_10184761 | 3300003349 | Arabidopsis Thaliana Rhizosphere | MSRRSSRKGRPYQPLPVRHTNWGARLVIISVAFILVAGFAILSFSR* |
| Ga0055471_100603802 | 3300003987 | Natural And Restored Wetlands | MSRRNRKRGRSYQPYPERNVNWGARLMIVAVAFIMVAGIAILTFAR* |
| Ga0055468_102579852 | 3300003993 | Natural And Restored Wetlands | MSRSRRSGRRGRPYQPYPERRTNWAARLIIVVVAFIMVAGIAVLTFTQ* |
| Ga0055472_100867571 | 3300003998 | Natural And Restored Wetlands | MSRRSGRKGRPYQPYPERRTNWAARLVIVVVAFIMVAGIAVLTFIR* |
| Ga0055477_102039612 | 3300004002 | Natural And Restored Wetlands | MSRRNRRGRVYQPLPKRQVNWGARLLIVVIGFVMVAGIAILAFAR* |
| Ga0055477_103504832 | 3300004002 | Natural And Restored Wetlands | VSRRGNRRGRPYQPYPDRRVNWGARLLIVAIAFVMVAGIAILAFAR* |
| Ga0055465_102471931 | 3300004013 | Natural And Restored Wetlands | MTRRRGRGRPYQPYPERRTNWGARLLVVFVGFVLIAGFAILTFAR* |
| Ga0055440_102128762 | 3300004020 | Natural And Restored Wetlands | VSRRSSRRGRPYQPLPPRRTNWGARLVIVFVAFILVAGFAVLTFVK* |
| Ga0062593_1003564583 | 3300004114 | Soil | MSRRSQRRGRPYQPLPTRRVNWGARLVIISVAFVLVAGFAILSFAR* |
| Ga0062593_1005413902 | 3300004114 | Soil | LTRRRRGRPYQPYPTRSVNWGARLLIVVIGFIMVLGIAILTFTR* |
| Ga0062593_1022435292 | 3300004114 | Soil | MSRRSQRRGRPYQPLPERQVNWGARLVIIFVAFVLIAGFAILSFAR* |
| Ga0062589_1021182981 | 3300004156 | Soil | MSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR* |
| Ga0062590_1016576542 | 3300004157 | Soil | LTRRRRGRPYQPYPTRSVDWGARLLIVVIGFIMVLGIAILTFTR* |
| Ga0063356_1047345052 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRRSNRRGRPYQPLPTRRVNWGARLVIIFVAFVLVAGFAILSFAR* |
| Ga0063356_1048614321 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RRRRGRPYQPYPTRSVNWGARLLIVVIGFIMVVGIAILTFTR* |
| Ga0062595_1000693172 | 3300004479 | Soil | MSRRSPRRGRPYQPLPARSVNWGARLVIVVVAVVLVAGFAILSFAR* |
| Ga0062595_1012818782 | 3300004479 | Soil | VGPMSRRSQRRGRPYQPLPTRRVNWGARLVIISVAFVLVAGFAILSFAR* |
| Ga0062594_1013284872 | 3300005093 | Soil | MSRRSQRRGRPYQPLPTRRVNWGARLVIVIVAFVLVAGFAILSFAR* |
| Ga0066683_105592112 | 3300005172 | Soil | VSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAILTFSK* |
| Ga0065705_102204413 | 3300005294 | Switchgrass Rhizosphere | HSRGADDPVPAPPRVGPMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR* |
| Ga0065705_106492301 | 3300005294 | Switchgrass Rhizosphere | MSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFAR* |
| Ga0070705_1000032584 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSSRKGRPYQPLPERRVNWGARLVIIFVAFILVAGFAILSFAR* |
| Ga0070705_1009369612 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSSRRGRPYQPLPERRVNWGARLVIVVVAFILVAGIAVLSFAR* |
| Ga0070694_1008331661 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | APRVGPMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR* |
| Ga0070708_1000922745 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSPRRGRPYQPLPTRTVNWGARLVIVIVAVVLVAGFAILSFAR* |
| Ga0070708_1004023952 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRRSTRKGRPYQPLPERRGSWVAKIVVLFVAFILVIGFAILTFAK* |
| Ga0070708_1007310312 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAVLTFSR* |
| Ga0070706_1017802131 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFAR* |
| Ga0070698_1000247325 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSSRRGRPYQPLPERRVNWGARLVIVVVAFILVAGFAILSFAR* |
| Ga0066707_103040932 | 3300005556 | Soil | VSRRSARRGRPYQPLPERRGNWVAKLVVLFVAFILVVGFAVLTFSR* |
| Ga0066704_101278142 | 3300005557 | Soil | VSRRSARRGRPYQPLPERRGNWAAKLVVLFVAFILVVGFAVLTFSR* |
| Ga0066698_100748244 | 3300005558 | Soil | MSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAILTFSK* |
| Ga0066691_104808632 | 3300005586 | Soil | RGRPYQPLPERRGNWAAKLVVLFVAFILVVGFAVLTFSR* |
| Ga0075293_10697372 | 3300005875 | Rice Paddy Soil | VSRRSQRRGRPYQPLPSRRTNWTARLVVVFVAFILVAGFAILTFAR* |
| Ga0075300_10464592 | 3300005876 | Rice Paddy Soil | RSQRRGRPYQPLPSRRTNWTARLVVVFVAFILVAGFAILTFAR* |
| Ga0075297_10310082 | 3300005878 | Rice Paddy Soil | MSRRSNRRGRPYQPLPERHVNWGARLTVVLVALVLVIGFAILTFAR* |
| Ga0075295_10126702 | 3300005879 | Rice Paddy Soil | VSRRSRRRGRPYQPLPSRRTNWTARLVVVFVAFILVAGFAILTFAR* |
| Ga0075286_10041991 | 3300005886 | Rice Paddy Soil | MSRRSGRRGRPYQPYPERRVNWGARLLVVFVAFVMIASIAILTFVR* |
| Ga0075425_1000102524 | 3300006854 | Populus Rhizosphere | MTRRSSRRGRPYQPLPEKRSNWGARLLVLLVAVILVGGFAVLTFTH* |
| Ga0079215_103601151 | 3300006894 | Agricultural Soil | MSRRRRGRPYQPYPTRNVNWGARLLIVLVGFIMVVGIAILTFTR* |
| Ga0104326_1182953 | 3300007740 | Soil | VSRRSSRRGRPYQPLPDRRSNWGAKLVVIFVALILVAGFAILTFAR* |
| Ga0066710_1003122295 | 3300009012 | Grasslands Soil | SRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAILTFSK |
| Ga0066709_1007739272 | 3300009137 | Grasslands Soil | MSRRSSRRGRPYQPLPVRRVNWAARLVIVVVAVVLVAGFAILSFAR* |
| Ga0075423_103660992 | 3300009162 | Populus Rhizosphere | MTRRSSRRGRLYQPLPEKRSNWGARLLVLLVAVILVGGFAVLTFTH* |
| Ga0075423_115793402 | 3300009162 | Populus Rhizosphere | MSRRSSRKGRPYQPLPVRHTNWGARLVIIFVALILVVGFAILSFAR* |
| Ga0105100_102679612 | 3300009166 | Freshwater Sediment | VGPVSRRSSRKGRPYQPDPEKRVNWVARVLVVAVAFIMIAGFAILTFVR* |
| Ga0105249_134542052 | 3300009553 | Switchgrass Rhizosphere | MSRRSQRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR* |
| Ga0126312_113817482 | 3300010041 | Serpentine Soil | MSRRRRSGRPYQPYPTRRQNWGARLLIVGIGFVMVIGIAILAFTR* |
| Ga0136847_111588731 | 3300010391 | Freshwater Sediment | MSRRSSRRGRPYQPLPERRVNWGARLAVVFVTFILVAGFAILTFAR* |
| Ga0120118_11041242 | 3300012010 | Permafrost | MSRRSSRRGRPYQPLPARQVNWGARLVIVVVAVVLVAGFAILSFAR* |
| Ga0120159_10561991 | 3300012014 | Permafrost | MSRRSSRRGRPYQPLPARQVNWGARLGIVVVAVVLVAGFAILSFAR* |
| Ga0120139_11392902 | 3300012019 | Permafrost | APRSHRRGRPSQPLPPSRTNWGARLIVIFVAFILVAGFAILTFTK* |
| Ga0137374_101694962 | 3300012204 | Vadose Zone Soil | MTRRRQRGRAYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFAR* |
| Ga0137369_101732233 | 3300012355 | Vadose Zone Soil | RAYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFAR* |
| Ga0137375_103053331 | 3300012360 | Vadose Zone Soil | MSRRSNRRGRPYQPLPERRVNWAARLVIVIVAFVRVAGFAILTFAR* |
| Ga0157297_103078672 | 3300012914 | Soil | MSRRSSRKGRPYQPLPVRHTNWGARLVIIFVTFILVAGFAILSFSR* |
| Ga0153915_1000114823 | 3300012931 | Freshwater Wetlands | MSRRTSRRGRPYQPLPERRTHWGARLVIVFVAFILVAGFAVLTFVK* |
| Ga0153915_104275472 | 3300012931 | Freshwater Wetlands | VSRRSSRRGRPYQPLPERRTNWGARLVVIFVAFILVAGFAVLTFVK* |
| Ga0120150_10600972 | 3300013294 | Permafrost | MSRRSQRRGRPYQPLPARQVNWGARLVIIFVAFVLVAGFAILSFAR* |
| Ga0120158_104203062 | 3300013772 | Permafrost | MSRRSPRRGRPYQPLPERRGNWVAKLVVLFVAFILVVGIAVLAFSR* |
| Ga0167629_10258491 | 3300015209 | Glacier Forefield Soil | MSRRSQRRGRPYQPLPPSRTNWGARLIVIFVAFILVAGFAILTFTK* |
| Ga0180081_10419281 | 3300015253 | Soil | MSRRSPRRGRPYQPLPERRVNWGARITVVFVAFILVAGFAILTFAR* |
| Ga0132258_101234095 | 3300015371 | Arabidopsis Rhizosphere | MTRRRRGRPYQPYPTRRVNWGARIVIVAVGFIMVVGFAILTFTH* |
| Ga0132258_109811103 | 3300015371 | Arabidopsis Rhizosphere | MSRRSSRRGRPYQPLPKRDVNWGARLVIIFVAFVLIAGFAILSFAR* |
| Ga0132257_1003842071 | 3300015373 | Arabidopsis Rhizosphere | MSRRSSRRGRPYQPLPKLDVNWGARLVIIFVAFVLIAGFAILSFAR* |
| Ga0132255_1003296381 | 3300015374 | Arabidopsis Rhizosphere | KGRPYQPYPARTTNWAARLVIVAIGFIMVIGIAVLAFSR* |
| Ga0134083_100796923 | 3300017659 | Grasslands Soil | VSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAILTFSK |
| Ga0184610_10772183 | 3300017997 | Groundwater Sediment | MSRRSSRRGRPYQPLPERRVNWAARLVIIVVAFVLVAGFAILTFAR |
| Ga0184610_11256171 | 3300017997 | Groundwater Sediment | MSRRSNRRGRPYQPLPTRQVNWGARLVIIFVAFVLIAGFAILSFAR |
| Ga0184638_12068802 | 3300018052 | Groundwater Sediment | MPGRSSRRGRPYQPLPARRTSWGARLVVVFIALILVGGFAILTFVR |
| Ga0184638_12288152 | 3300018052 | Groundwater Sediment | MSRRSNRRGRPYQPLPTRQVNWGARLVIIFVAFVLIAGFA |
| Ga0184626_101722962 | 3300018053 | Groundwater Sediment | VSRRSSRRGRPYQPLPERRGSWMAKLVVLFVAFILVLGFAILTFTK |
| Ga0184626_104084482 | 3300018053 | Groundwater Sediment | MSRRSNRRGRPYQPLPTRRVNWGARLLIIFVAFILVAGFAILSFAR |
| Ga0184637_102047951 | 3300018063 | Groundwater Sediment | MSRRSSRRGRPYQPIPLRRVNWGARLVVVFVAFILVASFVILTFTR |
| Ga0184637_102255951 | 3300018063 | Groundwater Sediment | RSSRRGRPYQPLPARRANWGARLVVVFVAFVLVAGFAILTFAR |
| Ga0184618_100007318 | 3300018071 | Groundwater Sediment | MSRRSSRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR |
| Ga0184618_100304744 | 3300018071 | Groundwater Sediment | AEDGMSRRSQRRGRPYQPLPARRVNWGARLVIVIVAFILVAGFVILSFAR |
| Ga0184632_100036459 | 3300018075 | Groundwater Sediment | MTRRSGRRGRPYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFTR |
| Ga0184609_105777801 | 3300018076 | Groundwater Sediment | MTRRRQRGRAYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFAR |
| Ga0184639_103951882 | 3300018082 | Groundwater Sediment | MSRRSSRRGRPYQPLPVRPINWGARLVVIFVAFILVAGFAILTFAR |
| Ga0190272_131986901 | 3300018429 | Soil | MSRRSQRRGRPYQPMPVRRVNWVARLVIVFIAFTLVAGFAILTFAR |
| Ga0190270_129384052 | 3300018469 | Soil | MSRKSQRRGRPYQPLPTRHVNWGARLVIIFVAFVLVAGFAILSFAR |
| Ga0184643_13844942 | 3300019255 | Groundwater Sediment | MSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR |
| Ga0193751_10006419 | 3300019888 | Soil | MSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGIAVLAFSR |
| Ga0193745_10729692 | 3300020059 | Soil | MSRRSQRRGRPYQPLPARRVNWGARLVIVIVAFILVAGFAILSFAR |
| Ga0210382_100566432 | 3300021080 | Groundwater Sediment | MSRRSQRRGRPYQPLPARRVNWGARLVIVVVAFILVAGFAILSFAR |
| Ga0193719_103253452 | 3300021344 | Soil | VSRRSSRRGRPYQPLPERHTNWGARLLVLFVAVILIAGFAILTFTR |
| Ga0224500_100217952 | 3300022213 | Sediment | VGPVSRRSSRRGRPYQPLPQRNVNWGARLLVVFVAFIMVAGFAILTFAR |
| Ga0224505_100503234 | 3300022214 | Sediment | VSRRSSRRGRPYQPLPQRNVNWGARLLVVFVAFIMVAGFAILTFAR |
| Ga0209001_10726122 | 3300025002 | Soil | MSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFILVAGFAILTFAR |
| Ga0209619_104458591 | 3300025159 | Soil | ALPPAPRVGPMSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFVLVAGFAILTFAR |
| Ga0209109_1000409910 | 3300025160 | Soil | MSRRSSRRGRPYQPLPVRRVNWVARLVVVFVAFILVAGFAILTFAR |
| Ga0209109_100165566 | 3300025160 | Soil | MSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFVLVAGFAILTFAR |
| Ga0209109_103317442 | 3300025160 | Soil | MSRRSPRRGRPYQPLPKRHVNWGARLTVVFVAFILVVGFAILTFAR |
| Ga0209519_107276801 | 3300025318 | Soil | SSRRGRPYQPLPQRRVNWGARLLVVFVAFILVAGFAILTFAR |
| Ga0209341_100818443 | 3300025325 | Soil | MSRRSPRRGRPYQPLPVRRVNWVARLVVVFIAFVLVASFAIITFTR |
| Ga0209341_102572463 | 3300025325 | Soil | MSRRSSRRGRPYQPLPVRRVNWVARLVVVFVAFVLVAGFAILTFAR |
| Ga0209341_107587072 | 3300025325 | Soil | MSRRSPRRGRPYQPLPQRHVNWGARLTVVFVAFILVVGFAILTFAR |
| Ga0210132_10774812 | 3300025538 | Natural And Restored Wetlands | VSRRSSRRGRPYQPLPPRRTNWGARLVIVFVAFILVAGFAVLTFVK |
| Ga0210113_11131702 | 3300025796 | Natural And Restored Wetlands | MSRSRRSGRRGRPYQPYPERRTNWAARLIIVVVAFIMVAGIAVLTFTQ |
| Ga0210144_11868942 | 3300025817 | Natural And Restored Wetlands | VSRRGNRRGRPYQPYPDRRVNWGARLLIVAIAFVMVAGIAILAFAR |
| Ga0207653_104205482 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR |
| Ga0207707_111867502 | 3300025912 | Corn Rhizosphere | MSRRSQRRGRPYQPLPTRRVNWGARLVIVIVAFVLVAGFAILSFAR |
| Ga0207646_100265517 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSSRKGRPYQPLPERRVNWGARLVIIFVAFILVAGFAILSFAR |
| Ga0207646_115286782 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSSRRGRPYQPLPERRVNWGARLVIVVVAFILVAGIAVLSFAR |
| Ga0207690_117652451 | 3300025932 | Corn Rhizosphere | MSRRSQRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFAR |
| Ga0207648_103721123 | 3300026089 | Miscanthus Rhizosphere | MSRRSQRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR |
| Ga0207648_116891181 | 3300026089 | Miscanthus Rhizosphere | SCSAANGADKSMSRRSQRRGRPYQPLPTRRVNWGARLVIVIVAFVLVAGFAILSFAR |
| Ga0256867_100250693 | 3300026535 | Soil | VTRRSGRKGRPYQPYPVRRVNWAARLLIVAIAFIMVAGFAVLTFVR |
| Ga0209968_10839972 | 3300027526 | Arabidopsis Thaliana Rhizosphere | SRKGRPYQPLPVRHTNWGARLVIISVAFILVAGFAILSFSR |
| Ga0214469_10445302 | 3300027636 | Soil | MSRRSRRGRPYQPYPQRRVNWGARLLIVAIAFILVAGFAILTFAR |
| Ga0214468_10309502 | 3300027647 | Soil | MSRRTRRGRPYQPYPQRRVNWGARLLIVAIAFILVAGFAILTFAR |
| Ga0256866_10587312 | 3300027650 | Soil | MSRRRKGRPYQPYPTRNVNWGARLLIVLVGFIMVVGIAILTFTR |
| Ga0307295_100759272 | 3300028708 | Soil | MSRRSQRRGRPYQPLPARRVNWGARLVIVFVAFVLVAGFAILSFAR |
| Ga0307298_102021952 | 3300028717 | Soil | MSRRSQRRGRPYQPLPTRRVNWGARLVIVFVAFVLVAGFAILSFAR |
| Ga0307319_101330381 | 3300028722 | Soil | QRRGRPYQPLPTRRVNWGARLVIVFVAFVLVAGFAILSFAR |
| Ga0307320_101698262 | 3300028771 | Soil | MSRRSNRRGRPYQPLPTRQVNWGARLVIIFVAFVLVAGFAILSFAR |
| Ga0307282_100999893 | 3300028784 | Soil | MSRRAQRRGRPYQPLPARRVNWGARLVIVVVAFILVAGFAILSFAR |
| Ga0307504_100012466 | 3300028792 | Soil | MSRRSTRRGRPYQPLPERRVNWGARLVVIFVAFFLIAGIAILSFTR |
| Ga0307299_100618173 | 3300028793 | Soil | MSRRSSHRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR |
| Ga0307305_104355642 | 3300028807 | Soil | MSRRSSRRGRPYQPLPERHTNWGARLLVLFVAVILIAGF |
| Ga0307302_100676403 | 3300028814 | Soil | MSRRSQRRGRPYQPLPPSRTSWGARLIVIFVAFVLVAGFAILTFSR |
| Ga0307296_101949073 | 3300028819 | Soil | RSPRRGRPYQPLPARRVNWGARLVIVVVAFILVAGFAILSFAR |
| Ga0307310_103447062 | 3300028824 | Soil | MTRRRRGRPYQPYPARQVNWGARVIIVIVGFIMILGIAILTFTR |
| Ga0307312_102169261 | 3300028828 | Soil | QRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR |
| Ga0307312_103306371 | 3300028828 | Soil | SSRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR |
| Ga0307312_103658942 | 3300028828 | Soil | GAHDPVPAPSRVGPMSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR |
| Ga0307312_111716911 | 3300028828 | Soil | MSRRSQRRGRPYQPLPARRVNWGARLVIVIVAFILVAG |
| Ga0307278_103159001 | 3300028878 | Soil | MSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILSFAR |
| Ga0307308_105689971 | 3300028884 | Soil | SSFAASGAGEGMSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFAR |
| Ga0299907_100733784 | 3300030006 | Soil | MSRRRRGRPYQPYPTRNVNWGARLLIVLVGFIMVVGIAILTFTR |
| Ga0299907_105240712 | 3300030006 | Soil | VTRRSGRKGRPYQPYPVRRVNWAARLLIVAIAFIMVAGFAVLTF |
| Ga0299907_109714872 | 3300030006 | Soil | MTRRGGRRGRAYQPIPTRRVNWGARLLVVFVAFIMVAGFAILTFAR |
| Ga0268386_107971622 | 3300030619 | Soil | MSRSRRSGRKGRPYQPYPERRTNWAARLIIVVVAFIMVAGIAVLTFTQ |
| Ga0299913_100090314 | 3300031229 | Soil | VSRRSGRKGRPYQPYPVRRVNWGARLLIVAVAFIMVAGFAVLTFAR |
| Ga0299913_102885391 | 3300031229 | Soil | RPYQPYPVRRVNWAARLLIVAIAFIMVAGFAVLTFVR |
| Ga0299913_107789802 | 3300031229 | Soil | MSRSRRSGSKGRPYQPYPERRTNWAARLIIVVVAFIMVAGIAVLTFTQ |
| Ga0310813_110834522 | 3300031716 | Soil | MTRRRRGRPYQPYPTRRVNWGARIVIVAVGFIMVVGFAILTFTH |
| Ga0307468_1024336482 | 3300031740 | Hardwood Forest Soil | VSRRSSRRGRPYQPLPERRTNWGARLLVLFVAVILIAGFAILTFTR |
| Ga0214473_110379801 | 3300031949 | Soil | MSRRSSRRGRPYQPLPARRVNWGARLVIFFVAFVLVAGFAILSFAR |
| Ga0326597_113223052 | 3300031965 | Soil | MSRRSPRRGRPYQPLPERHVNWAARLVVIFVAFILVAGFAILTFAR |
| Ga0326597_120147852 | 3300031965 | Soil | MSRRSSRRGRPYQPLPERNVNWGARLTVVFVAFILVAGFAILTFAR |
| Ga0315540_102706511 | 3300032061 | Salt Marsh Sediment | MSRRSGRRGRPYQPYPERRANWGARLLVVFVAFVMIAGFAILTF |
| Ga0310890_113277342 | 3300032075 | Soil | VTRRRKGRAYQPYPARRSNWAARLVIVAIGFIMVLGIAVLAFTR |
| Ga0315281_1000559819 | 3300032163 | Sediment | VRRRSSRRGRPYQPLPKSQSNWGARLIVVFVAFILVAGFAILTFAR |
| Ga0315281_100483948 | 3300032163 | Sediment | VGALNPVSRRSSRRGRPYQPLPVRRVNWGARLVVVFVAFILVAGFAILTFAR |
| Ga0214472_1000744017 | 3300033407 | Soil | MSRRSSRRGRPYQPLPARRVNWGARLVIIFVAFVLVAGFAILSFSR |
| Ga0214471_1000136217 | 3300033417 | Soil | VTRRSGRRGRAYQPMPTRRVNWGARLLVVFVAFIMVAGFAILTFAR |
| Ga0326726_103560272 | 3300033433 | Peat Soil | MSRRSPRRGRPYQPLPERNINWGARLTVVVIAFILVIGFAILAFAR |
| Ga0326726_112344292 | 3300033433 | Peat Soil | MSRRSPRRGRPYQPLPERNINWGARLTVVIIAFILVIGFAILAFSH |
| Ga0364926_149869_294_434 | 3300033812 | Sediment | MSRRSSRRGRPYQPLPARRANWGARLVVVFVAFVLVAGFAILTFAR |
| Ga0364930_0188474_165_305 | 3300033814 | Sediment | MSRRSPRRGRPYQPLPQRHVNWGARLTVVVVAFILIVGFAILTFAR |
| Ga0364936_107331_431_553 | 3300034773 | Sediment | MSRRSSRRGRPYQPLPASRVNWVARLVIIFIAFTLVAGFAI |
| ⦗Top⦘ |