NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F038576

Metagenome / Metatranscriptome Family F038576

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F038576
Family Type Metagenome / Metatranscriptome
Number of Sequences 165
Average Sequence Length 138 residues
Representative Sequence MEKLRFTLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP
Number of Associated Samples 130
Number of Associated Scaffolds 165

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.34 %
% of genes near scaffold ends (potentially truncated) 39.39 %
% of genes from short scaffolds (< 2000 bps) 67.27 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.66

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.394 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(15.758 % of family members)
Environment Ontology (ENVO) Unclassified
(48.485 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.424 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 16.07%    β-sheet: 33.93%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.66
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 165 Family Scaffolds
PF05960DUF885 5.45
PF12704MacB_PCD 5.45
PF00313CSD 3.64
PF00905Transpeptidase 3.64
PF04011LemA 3.03
PF01743PolyA_pol 2.42
PF05977MFS_3 2.42
PF01797Y1_Tnp 1.21
PF00926DHBP_synthase 1.21
PF14579HHH_6 1.21
PF13302Acetyltransf_3 1.21
PF13620CarboxypepD_reg 1.21
PF13589HATPase_c_3 1.21
PF00501AMP-binding 1.21
PF13193AMP-binding_C 0.61
PF12838Fer4_7 0.61
PF05198IF3_N 0.61
PF07676PD40 0.61
PF01479S4 0.61
PF01715IPPT 0.61
PF00005ABC_tran 0.61
PF01558POR 0.61
PF05163DinB 0.61
PF14849YidC_periplas 0.61
PF13604AAA_30 0.61
PF01346FKBP_N 0.61
PF13305TetR_C_33 0.61
PF14450FtsA 0.61
PF00534Glycos_transf_1 0.61
PF03551PadR 0.61
PF05690ThiG 0.61
PF00092VWA 0.61
PF11008DUF2846 0.61
PF00072Response_reg 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 165 Family Scaffolds
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 5.45
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 3.03
COG0617tRNA nucleotidyltransferase/poly(A) polymeraseTranslation, ribosomal structure and biogenesis [J] 2.42
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 2.42
COG01083,4-dihydroxy-2-butanone 4-phosphate synthaseCoenzyme transport and metabolism [H] 1.21
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.21
COG0290Translation initiation factor IF-3Translation, ribosomal structure and biogenesis [J] 0.61
COG0324tRNA A37 N6-isopentenylltransferase MiaATranslation, ribosomal structure and biogenesis [J] 0.61
COG0545FKBP-type peptidyl-prolyl cis-trans isomerasePosttranslational modification, protein turnover, chaperones [O] 0.61
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.61
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.61
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.61
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.61
COG2022Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)Coenzyme transport and metabolism [H] 0.61
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.61
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.61
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.39 %
UnclassifiedrootN/A0.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10096656All Organisms → cellular organisms → Bacteria → Acidobacteria1310Open in IMG/M
3300001356|JGI12269J14319_10147717All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300004082|Ga0062384_100069207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1785Open in IMG/M
3300004091|Ga0062387_100687977All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300004475|Ga0068969_1009941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae972Open in IMG/M
3300005534|Ga0070735_10058557All Organisms → cellular organisms → Bacteria → Acidobacteria2520Open in IMG/M
3300005591|Ga0070761_10000054All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter76992Open in IMG/M
3300005591|Ga0070761_10006362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter6808Open in IMG/M
3300005591|Ga0070761_10081695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1844Open in IMG/M
3300005602|Ga0070762_10029687All Organisms → cellular organisms → Bacteria → Acidobacteria2914Open in IMG/M
3300005610|Ga0070763_10273755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae921Open in IMG/M
3300005921|Ga0070766_10187397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1287Open in IMG/M
3300006086|Ga0075019_11139818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2507Open in IMG/M
3300006893|Ga0073928_10024814All Organisms → cellular organisms → Bacteria5983Open in IMG/M
3300009518|Ga0116128_1002481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium7616Open in IMG/M
3300009518|Ga0116128_1100612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2854Open in IMG/M
3300009521|Ga0116222_1162017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2963Open in IMG/M
3300009524|Ga0116225_1018986All Organisms → cellular organisms → Bacteria3552Open in IMG/M
3300009624|Ga0116105_1000211All Organisms → cellular organisms → Bacteria → Acidobacteria17221Open in IMG/M
3300009628|Ga0116125_1002290All Organisms → cellular organisms → Bacteria → Acidobacteria7156Open in IMG/M
3300009630|Ga0116114_1128350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2658Open in IMG/M
3300009631|Ga0116115_1030781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21486Open in IMG/M
3300009631|Ga0116115_1033258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21417Open in IMG/M
3300009632|Ga0116102_1129126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2707Open in IMG/M
3300009632|Ga0116102_1145888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2654Open in IMG/M
3300009634|Ga0116124_1018247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2322Open in IMG/M
3300009637|Ga0116118_1148127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2760Open in IMG/M
3300009638|Ga0116113_1043135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1033Open in IMG/M
3300009639|Ga0116122_1010626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA23512Open in IMG/M
3300009641|Ga0116120_1031281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1890Open in IMG/M
3300009643|Ga0116110_1254820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2562Open in IMG/M
3300009665|Ga0116135_1503028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2503Open in IMG/M
3300009700|Ga0116217_10177887All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21408Open in IMG/M
3300009759|Ga0116101_1028881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1126Open in IMG/M
3300010343|Ga0074044_10000356All Organisms → cellular organisms → Bacteria45383Open in IMG/M
3300010343|Ga0074044_10383756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2920Open in IMG/M
3300010373|Ga0134128_12235769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2602Open in IMG/M
3300010379|Ga0136449_100230633All Organisms → cellular organisms → Bacteria3468Open in IMG/M
3300011075|Ga0138555_1168936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2501Open in IMG/M
3300011120|Ga0150983_12604093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2584Open in IMG/M
3300011120|Ga0150983_15556722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21158Open in IMG/M
3300014151|Ga0181539_1000998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae32511Open in IMG/M
3300014152|Ga0181533_1031394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3076Open in IMG/M
3300014152|Ga0181533_1229910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2700Open in IMG/M
3300014152|Ga0181533_1279686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83612Open in IMG/M
3300014152|Ga0181533_1379089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2500Open in IMG/M
3300014153|Ga0181527_1391537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83532Open in IMG/M
3300014155|Ga0181524_10061468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2299Open in IMG/M
3300014155|Ga0181524_10314301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2709Open in IMG/M
3300014156|Ga0181518_10355512All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2716Open in IMG/M
3300014158|Ga0181521_10215990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 831037Open in IMG/M
3300014164|Ga0181532_10007010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9272Open in IMG/M
3300014168|Ga0181534_10148067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1202Open in IMG/M
3300014169|Ga0181531_10231664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21125Open in IMG/M
3300014169|Ga0181531_10502813All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2749Open in IMG/M
3300014489|Ga0182018_10018848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4601Open in IMG/M
3300014489|Ga0182018_10181380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21187Open in IMG/M
3300014489|Ga0182018_10740144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2511Open in IMG/M
3300014495|Ga0182015_10010605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8392Open in IMG/M
3300014495|Ga0182015_10059251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2760Open in IMG/M
3300014496|Ga0182011_10510389All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2773Open in IMG/M
3300014501|Ga0182024_10008162All Organisms → cellular organisms → Bacteria → Acidobacteria22239Open in IMG/M
3300014657|Ga0181522_10876952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2553Open in IMG/M
3300016702|Ga0181511_1108450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21788Open in IMG/M
3300017822|Ga0187802_10116904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1009Open in IMG/M
3300017823|Ga0187818_10000073All Organisms → cellular organisms → Bacteria27401Open in IMG/M
3300017823|Ga0187818_10010655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3926Open in IMG/M
3300017925|Ga0187856_1035239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22329Open in IMG/M
3300017925|Ga0187856_1059746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21630Open in IMG/M
3300017925|Ga0187856_1160143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2841Open in IMG/M
3300017925|Ga0187856_1318737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83532Open in IMG/M
3300017929|Ga0187849_1019990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3799Open in IMG/M
3300017934|Ga0187803_10130354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2988Open in IMG/M
3300017935|Ga0187848_10316579All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83649Open in IMG/M
3300017940|Ga0187853_10150694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21113Open in IMG/M
3300017942|Ga0187808_10473781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2578Open in IMG/M
3300017943|Ga0187819_10003742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8217Open in IMG/M
3300017943|Ga0187819_10246655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21046Open in IMG/M
3300017943|Ga0187819_10363481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2835Open in IMG/M
3300017946|Ga0187879_10499679All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2675Open in IMG/M
3300017972|Ga0187781_10994211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2613Open in IMG/M
3300017995|Ga0187816_10050042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21744Open in IMG/M
3300017995|Ga0187816_10278111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2733Open in IMG/M
3300017996|Ga0187891_1149713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2831Open in IMG/M
3300017996|Ga0187891_1151280All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2825Open in IMG/M
3300018012|Ga0187810_10503261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2517Open in IMG/M
3300018013|Ga0187873_1243193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2666Open in IMG/M
3300018025|Ga0187885_10011143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5833Open in IMG/M
3300018025|Ga0187885_10036259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2623Open in IMG/M
3300018034|Ga0187863_10002425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae14223Open in IMG/M
3300018037|Ga0187883_10279209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300018038|Ga0187855_10022702All Organisms → cellular organisms → Bacteria → Acidobacteria4078Open in IMG/M
3300018040|Ga0187862_10904975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83504Open in IMG/M
3300018043|Ga0187887_10114192All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1623Open in IMG/M
3300018044|Ga0187890_10604115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2618Open in IMG/M
3300018046|Ga0187851_10179493All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300018057|Ga0187858_10798182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2559Open in IMG/M
3300018057|Ga0187858_10914349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2516Open in IMG/M
3300018062|Ga0187784_11657934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2506Open in IMG/M
3300019082|Ga0187852_1144343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21015Open in IMG/M
3300019082|Ga0187852_1424882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2516Open in IMG/M
3300019260|Ga0181506_1047499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21098Open in IMG/M
3300020579|Ga0210407_10171200All Organisms → cellular organisms → Bacteria → Acidobacteria1680Open in IMG/M
3300020582|Ga0210395_10000002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae502771Open in IMG/M
3300020582|Ga0210395_11252323All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2544Open in IMG/M
3300021181|Ga0210388_10382017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21238Open in IMG/M
3300021181|Ga0210388_11258076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2626Open in IMG/M
3300021420|Ga0210394_10000043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae300016Open in IMG/M
3300021420|Ga0210394_10152873All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300021420|Ga0210394_11071950All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2696Open in IMG/M
3300022532|Ga0242655_10286951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2532Open in IMG/M
3300022557|Ga0212123_10122135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22069Open in IMG/M
3300022712|Ga0242653_1068268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2607Open in IMG/M
3300022715|Ga0242678_1060079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2569Open in IMG/M
3300022717|Ga0242661_1039662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2845Open in IMG/M
3300022722|Ga0242657_1228975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2525Open in IMG/M
3300022726|Ga0242654_10076208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21008Open in IMG/M
3300022873|Ga0224550_1000755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5673Open in IMG/M
3300022873|Ga0224550_1020965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300024295|Ga0224556_1002265All Organisms → cellular organisms → Bacteria → Acidobacteria5463Open in IMG/M
3300025414|Ga0208935_1008492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1425Open in IMG/M
3300025442|Ga0208034_1008728All Organisms → cellular organisms → Bacteria → Acidobacteria3617Open in IMG/M
3300025496|Ga0208191_1065033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83773Open in IMG/M
3300025506|Ga0208937_1072789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2783Open in IMG/M
3300025507|Ga0208188_1032435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1422Open in IMG/M
3300027168|Ga0208239_1000776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2004Open in IMG/M
3300027648|Ga0209420_1023834All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1958Open in IMG/M
3300027745|Ga0209908_10005713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21866Open in IMG/M
3300027853|Ga0209274_10000027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae153786Open in IMG/M
3300027853|Ga0209274_10001802All Organisms → cellular organisms → Bacteria10765Open in IMG/M
3300027854|Ga0209517_10005331All Organisms → cellular organisms → Bacteria16425Open in IMG/M
3300027884|Ga0209275_10020205All Organisms → cellular organisms → Bacteria → Acidobacteria2970Open in IMG/M
3300027889|Ga0209380_10000616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae25082Open in IMG/M
3300027889|Ga0209380_10258157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1023Open in IMG/M
3300027905|Ga0209415_10040387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6335Open in IMG/M
3300028747|Ga0302219_10001442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9852Open in IMG/M
3300028747|Ga0302219_10094904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21125Open in IMG/M
3300028759|Ga0302224_10139989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2945Open in IMG/M
3300028776|Ga0302303_10078538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21235Open in IMG/M
3300028906|Ga0308309_10447679All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21112Open in IMG/M
3300029882|Ga0311368_10609178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2768Open in IMG/M
3300029944|Ga0311352_10149480All Organisms → cellular organisms → Bacteria → Acidobacteria2022Open in IMG/M
3300029951|Ga0311371_12230271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2570Open in IMG/M
3300029999|Ga0311339_10083482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4037Open in IMG/M
3300029999|Ga0311339_10212422All Organisms → cellular organisms → Bacteria2173Open in IMG/M
3300030007|Ga0311338_10519374All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300030053|Ga0302177_10099831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21682Open in IMG/M
3300030054|Ga0302182_10255390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2743Open in IMG/M
3300030057|Ga0302176_10000375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae28006Open in IMG/M
3300030509|Ga0302183_10001059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae12822Open in IMG/M
3300030520|Ga0311372_10504860All Organisms → cellular organisms → Bacteria → Acidobacteria1774Open in IMG/M
3300030580|Ga0311355_10339825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1492Open in IMG/M
3300030618|Ga0311354_11950412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2506Open in IMG/M
3300030646|Ga0302316_10426748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2531Open in IMG/M
3300030737|Ga0302310_10185760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21224Open in IMG/M
3300030906|Ga0302314_11171168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2723Open in IMG/M
3300031028|Ga0302180_10024702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3822Open in IMG/M
3300031236|Ga0302324_103198559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2539Open in IMG/M
3300031708|Ga0310686_110708611All Organisms → cellular organisms → Bacteria1623Open in IMG/M
3300031837|Ga0302315_10273689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2980Open in IMG/M
3300032160|Ga0311301_10334276All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22388Open in IMG/M
3300033402|Ga0326728_10030536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9143Open in IMG/M
3300033829|Ga0334854_015623All Organisms → cellular organisms → Bacteria → Acidobacteria1839Open in IMG/M
3300034091|Ga0326724_0488183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83633Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.76%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa13.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland13.33%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog9.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.09%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.67%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa3.03%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.42%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.21%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.21%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.21%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.21%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.21%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.61%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.61%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.61%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004475Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011075Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019260Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027168Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1009665623300000567Peatlands SoilMKTRCMLCFLALLLPASFVLSCGAKTQGQDPLQTITLSPASADAQDYPNGQVQFIATGYYTDPARKVTPLSAGWGTCIQGGPTQEAPTNAVSVTQGGVAQCTPGAVGTYTIWANGPPYPNVECLAITACGGGCFIAGTAQL
JGI12269J14319_1014771713300001356Peatlands SoilMKTRCMLCFLALLLPASFVLSCGAKTQGQDPLQTITLSPASADAQDYPNGQVQFIATGYYTDPARKVTPLSAGWGTCIQGGPTQEAPTNAVSVTQGGVAQCTPGAVGTYTIWANGPPYPNVECLAITACGGGCFIAGTAQLTCP*
Ga0062384_10006920723300004082Bog Forest SoilMEKLRFVLSFLALILAASLALSCGPGQRQSQLQSITLSPATADARNYPNGQVQFTASGSYGNPSRTVTPLPATWGACYQFATTGAVSVTRAGLAQCAAGATGTYTIWANDPVDINSGCPAVTACGGGCTVQGNAQLTCP*
Ga0062387_10068797713300004091Bog Forest SoilGQRQSQLQSITLSPATADARNYPNGQVQFTASGSYGNPSRTVTPLPATWGACYQFATTGAVSVTRAGLAQCAAGATGTYTIWANDPVDINSGCPAVTACGGGCTVQGNAQLTCP*
Ga0068969_100994123300004475Peatlands SoilMKTLRYLLGFLALLLPASLVLSCGTTSQGQDPLQTITLSPASADAKDYPNGQVQFIATGYYSDPARKVTPLSAGWGTCYQSPTIEAPTNAISVTPTGVAQCTPGAVGTYTVWANDPPNSNIECLAITVCGGGCFVAGTAQLTCP*
Ga0070735_1005855723300005534Surface SoilMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSVECLAITACGGGCFVAGTAQLTCP*
Ga0070761_10000054393300005591SoilMAKLRLALFSLTLVLAASSALSCGARSQSQDPLQTITLSPATANAQDYPNGQVQFVATGYYIDPSRTVSPLSATWGTCYQEASTSEVSVTAAGVAQCAPGAIGTYTIWADNPPVSGVSCLAITACGGGCFVAGTAQLTCP*
Ga0070761_1000636253300005591SoilMEKLGVVLSLIALSVAASLTLSCGAKSQSQDPLQSITISPAAADGQNYPNGQVQFVATGYYVDPSHTVTPLPATWGTCYQFAPTTAVSVTSTGLAQCASGAVGTYSVWANDPAPLGPGVYNCPASGACGGGCTIQATAQLTCP*
Ga0070761_1008169523300005591SoilMERLQLALFSLALVLAASLALSCGTGSENAGSQNQDPLVSVTLSPGTADARDYPNGQVQFVATGYYINPSRTVSPLSAAWGTCYQEASTSEISVTAGGMAQCAPGAVGTFTVWADDPPLSNVACNAITACGGGCFVAGTAQLTCP*
Ga0070762_1002968713300005602SoilMDKFRLTVFLLALLLAASFTLSCGAGSQGQDPLQSITISPATADAQDYPNGQVQFIPTGYYTDPSRAVTPLSAMWGTCYQNASTHEVSVTAGGVAQCAPGAVGTYTIWANDPPKSNVQCLAMTACGGGCFVVGSAQLTCP*
Ga0070763_1027375513300005610SoilMEKLGVVLSLIALSVAASLTLSCGAKSQSQDPLQSITISPAAADGQNYPNGQVQFVATGYYVDPSHTVTPLPATWGTCYQFAPTTAVSVTSTGLAQCASGAVGTYSVWANDPAPLGPGVYNCPASGACGGGCTIQATA
Ga0070766_1018739713300005921SoilMERLQLALFSLALVLAASLALSCGTGSENAGSQNQDPLVSVTLSPGTADARDYPNGQVQFVATGFYINPSRTVSPLSAAWGTCYQEASTSEISVTAGGMAQCAPGAVGTFTVWADDPPLSNVACNAITACGGGCFVAGTAQLTCP*
Ga0075019_1113981813300006086WatershedsSCGTKSPGQDPLQSITLSPAGADAKDYPNGQVPFVATGYYADPARKVTPLSAFWGTCYQASPTQEAPTSAVTVTQGGVAQCTAGAVGTYTVWANDPPYTSVECLAITACGGGCFVAGTAQLTCP*
Ga0073928_1002481453300006893Iron-Sulfur Acid SpringMEKLGLAFSLLALVVAAWLTLSCGARSQDQNPLQSVTLSPATADAHYVNGQVQFIATGYYVNPSRTVTPLSATWGVCYQNAGTSAISVTSTGSAQCASGVVGTYSVWASDPMPLGPGVYNCPASTACGGGCTVQATAHLTCP*
Ga0116128_100248153300009518PeatlandMEKLRFTLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP*
Ga0116128_110061223300009518PeatlandMEKLRFMLSFLALILAASFALSCGASSHGQNPLQSITLSPATADAQNYPNGEVQFTATGHYINPSRSVTPLSAGWGTCYQDASTSEVSVTSGGVAKCATGAIGTYTVWANDPPFPNVGCLAITACGGGCFIAGSAQLTCP*
Ga0116222_116201713300009521Peatlands SoilDPLQTITLSPASADAQDYPNGQVQFIATGYYTDPARKVTPLSAGWGTCIQGGPTQEAPTNAVTVTQGGVAQCTPGAVGTYTIWANGPPYPNVECLAITACGGGCFIAGTAQLTCP*
Ga0116225_101898643300009524Peatlands SoilMLCFLALLLPASFVLSCGAKTQGQDPLQTITLSPASADAQDYPNGQVQFIATGYYTDPARKVTPLSAGWGTCIQGGPTQEAPTNAVSVTQGGVAQCTPGAVGTYTIWANGPPYPNVECLAITACGGGCFIAGTAQLTCP*
Ga0116105_1000211103300009624PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP*
Ga0116125_100229063300009628PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLIATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP*
Ga0116114_112835023300009630PeatlandLGVSVALSCGANQEQSQLQSITLSPATADAQSYPNGQVQFTATGSYGNPSRTVTPLPATWGACYQLATTSAVSVTREGLAQCAPGATGTYTIWANDPVDIKSGCPAVTACGGGCTVQGNAQLTCP*
Ga0116115_103078123300009631PeatlandMEKLRFMLSFLALILATSFALSCGASSHGQDPLQSITLSPATADAQDYPNGEVQFTATGHYLNPSRTVTPLSAGWGTCYQDASTSEVSVTSGGVAKCATGAIGTYTVWANDPPFPNVGCLAITACGGGCFIAGSAQLTCP*
Ga0116115_103325833300009631PeatlandSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP*
Ga0116102_112912613300009632PeatlandALILATSFALSCGASSHGQDPLQSITLSPATADAQDYPNGEVQFTATGHYLNPSRTVTPLSAGWGTCYQDASTSEVSVTSGGVAKCAAGTVGTYTVWANDPPFPDVGCLAITACGGGCFIAGSAQLTCP*
Ga0116102_114588823300009632PeatlandCGARSQGQDPLQSITLSPATADAQDYPDGQVQFTATGFYTDPPRTVTPLSAMWGTCYQNAPTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP*
Ga0116124_101824723300009634PeatlandMEKLRFMLSFLTLVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP*
Ga0116118_114812713300009637PeatlandMFSFLTLVLGVSVALSCGANQEQSQLQSITLSPATADAQSYPNGQVQFTATGSYGNPSRTVTPLPATWGACYQLATTSAVSVTREGLAQCAPGATGTYTIWANDPVDIKSGCPAVTACGGGCTVQGNAQLTCP*
Ga0116113_104313523300009638PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESITISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP*
Ga0116122_101062623300009639PeatlandMEKLRFMLSFLALILATSFALSCGASSHGQDPLQSITLSPATADAQDYPNGEVQFTATGHYLNPSRTVTPLSAGWGTCYQDASTSEVSVTSGGVAKCAAGTVGTYTVWANDPPFPDVGCLAITACGGGCFIAGSAQLTCP*
Ga0116120_103128123300009641PeatlandMEKLRFMLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP*
Ga0116110_125482013300009643PeatlandEGIMEKLRFMLSFLALILATSFALSCGASSHGQDPLQSITLSPATADAQDYPNGEVQFTATGHYLNPSRTVTPLSAGWGTCYQDASTSEVSVTSGGVAKCAAGTVGTYTVWANDPPFPDVGCLAITACGGGCFIAGSAQLTCP*
Ga0116135_150302813300009665PeatlandSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP*
Ga0116217_1017788713300009700Peatlands SoilFVLSCGAKTQGQDPLQTITLSPASADAQDYPNGQVQFIATGYYTDPARKVTPLSAGWGTCIQGGPTQEAPTNAVSVTQGGVAQCTPGAVGTYTIWANGPPYPNVECLAITACGGGCFIAGTAQLTCP*
Ga0116101_102888123300009759PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANNPAPLGPGVYSCPASTACGGGCTIQATAQLTCP*
Ga0074044_10000356433300010343Bog Forest SoilMAKLRLISSCLTLVPAALFALSCGSSSQSQLQSITLSPATADAQNYPNGQVQFTASGSYGNPSRTVTPLPATWGACYQFATTSAVSVTREGLAQCAPGATGTYTIWANDPIDVNSGCPAVTACGGGCTVQGNAQLTCP*
Ga0074044_1038375613300010343Bog Forest SoilLLHGGFMQSLRFLLSFLALLLAASLALSCGASSQGQDPLQSIALSPATADAQNFAGGEVQFIATGNYINPTRTVTPLSAHWGTCFQNASTNEISVTSAGVAKCAPGAVGTFTVWADDPPFPSVNCLAITACGGGCFIAGAAQLTCP*
Ga0134128_1223576913300010373Terrestrial SoilGGAKSQGQDPLQSITLSPASADAKDYPTGQVPFIATGHYIDPSRTVTPLSAMWGTCYQGAPTSEVSVTAEGVAECAAGAVGTYTIWANDPPMPGAECLAITACGGGCFVVGSAQLTCP*
Ga0136449_10023063333300010379Peatlands SoilMKKLRFMLCFVALVLPASLVLSCGTKSPGQDPLQSITLSPATADAQDYPNGQVPFTATGYYSDPSRTVTPLSAGWGTCYQEASTNAVSVSPGGVAQCTPGAVGTYTIWADDPPFPNVACLAITACGGGCFVAGTAQLTCP*
Ga0138555_116893613300011075Peatlands SoilMKTLRYLLGFLALLLPASLVLSCGTTSQGQDPLQTITLSPASADAKDYPNGQVQFIATGYYSDPARKVTPLSAGWGTCIQGGPTQEAPTNAVSVTQGGVAQCTPGAVGTYTVWANDPPNSNIECLAITVCGGGCFVAGTAQLTCP*
Ga0150983_1260409313300011120Forest SoilMEKEKLGLVLCLIALSVAASLTLSCGAKSQDQDPLASITLSPATADAKDYPNGQVQFIATGYYIDPSHTVTPLPATWGTCYQFAPTTAVSVTSTGLAQCASGAVGSYSVWANDPAPLGPGVYNCPASGACGGGCTIQATAQLTCP*
Ga0150983_1555672223300011120Forest SoilMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWADDPPYPSVECLAITACGGGCFVAGTAQLTCP*
Ga0181539_100099823300014151BogMEKLRFMLSFLALILAASFALSCGASSHGQNPLQSITLSPATADAQDYPNGEVQFTATGHYINPSRTVTPLSAGWGTCYQDASTSEVSVSSGGVAKCAAGAVGTYTVWANDPPFPDVGCLAMTACGGGCFIAGSAQLTCP*
Ga0181533_103139423300014152BogMEKLRFLLFFSALVLAASLALSCGASSHSQDPLISITLSPATADAQDYPNGEVPFTATGYYINPTRTVSPLSAGWGTCYQDASTSEISIVSPGVAKCAPGAAGTYTVWANDPPDPNVECLAMTACGGGCFVAGTAQLTCP*
Ga0181533_122991013300014152BogMERLRFTLSFLALVLVAFFALSCGARSQGQDPLQSITLSPATADAQNYPNGEVQFIATGYYIDPPRTVTPLSAGWGTCYLEASTNEISVTAGGVAKCSPEAVGTYTVWANDPPNPNVECLAMTACGG
Ga0181533_127968613300014152BogMEKLRFMLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPDGQVQFTATGFYTDPPRTVTPLSAMWGTCYQNAPTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP*
Ga0181533_137908923300014152BogALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGEVQFTATGHYINPSRTVTPLSAGWGTCYQDASTSEVSVSSGGVAKCAAGAVGTYTVWANDPPFPDVGCLAMTACGGGCFIAGSAQLTCP*
Ga0181527_139153713300014153BogMEKLRFMLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPDGQVPFTATGFYTDPPHTVTPLSAMWGTCYQNAPTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCF
Ga0181524_1006146823300014155BogMENLRFLLSFSALVLAASAALSCGASSHSQDPLITITLSPATADAQDYPNGEVPFTATGYYINPTRTVSPLSAGWGTCYQDASTSEISIVSPGVAKCAPGAAGTYTVWANDPPDPNVGCLAMTACGGGCFIAGTAQLTCP*
Ga0181524_1031430113300014155BogMEKLRFMLSFLALILAASFALSCGASSHGQNPLQSITLSPATADAQDYPNGEVQFTATGHYINPSRTVTPLSAGWGTCYQDASTSEVSVSSGGVAKCAAGAVGTYTVWANDPPSPNVGCLAITACGGGCFVV
Ga0181518_1035551223300014156BogRFTLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWTNDPPSPNVGCLAITACGGGCFVVGSAQLTCP*
Ga0181521_1021599013300014158BogMEKLRFTLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPDGQVPFTATGFYTDPPHTVTPLSAMWGTCYQNAPTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP*
Ga0181532_10007010123300014164BogMKKLRVTLCFLALFLPASFVLSCGASPQGNLGSQGDPLQSITLSPATADAQDYPNGQVPFIATGHYIDPSRTVTPLSAGWGTCYQASPTQQAPTSEVSVTPTGVAQCTPGAVGTYTIWANDPPYPGVECLAITVCGGGCFVAGTAQLTCP*
Ga0181534_1014806713300014168BogMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESITISPATADAQDYPNGQVQFIATGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP*
Ga0181531_1023166413300014169BogMERVPLALFSLALVLAASLVLSCGSGSQNQDPLVSVALTPATADARDFPNGQVQFVATGYYINPSRTVSPLAAAWGTCYQEASTSEISVTAGGMAQCAPGAVGTYTVWADDPPLSNVACNAITACGGGCFVAGTAQLTCP*
Ga0181531_1050281323300014169BogMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESITISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGAVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP*
Ga0182018_1001884823300014489PalsaMQRLRLALFSVALVLAASFALSCGARSPNQDPLQSITLSPAAADALDYPNGQVQLVATGYYTDPSHTVTPLSAMWGTCYQEASTSEVSVTAAGLAQCAPGAVGTYTIWADDPPLSNVSCLAITACGGGCFVAGTAQLTCP*
Ga0182018_1018138023300014489PalsaMAKLRLTLFSLALILAASFALSCGARSQSQDPQSQDPLQSITLSPATADARNYPNGQVQFIATGYYIDPSHMVTPLSAMWGTCYQDASTSEVAVTAGGVAQCAPGAVGTYTVWADDPPLSNVACLAITACGGGCFVAGTAQLTCP*
Ga0182018_1074014413300014489PalsaMEKLGLVLSLIALSVAASLTLSCGASSQGQDLLQSITLSPAAADAQDYPNGQVQFIATGYYINPSRTVSPLSATWGTCYQFEPTSAISVTSTGLVQCASGAVGTYSVWANDPMPLAPGTYSCPASTACGGGCTIQATAHVTCP*
Ga0182015_1001060523300014495PalsaMQRLPLALLSLALVLAAALALSCGTGSQNQDPLVSVTLSPATADAADYPNGQVQFVATGYYINPSRTVSPLTAAWGTCYQEASTSEVSVTAGGVAQCAPGAVGTFTVWADDPPLPNVACTAITACGGGCFVAGTAQLTCP*
Ga0182015_1005925123300014495PalsaMLRRNVPRKCSPPAQSKPRPQSVEGSEHRLFLQPSADSRVLIRQEGVMQRLRLALFSVALVLAASFALSCGARSPNQDPLQSITLSPAAADALDYPNGQVQLVATGYYTDPSHTVTPLSAMWGTCYQEASTSEVSVTAAGLAQCAPGAVGTYTIWADDPPLSNVSCLAITACGGGCFVAGTAQLTCP*
Ga0182011_1051038913300014496FenMERLRFTLSFLALALAASLASSCGASSSNLSRGTTPPSQGQGQLQSIALSPATADAQAYPNGQVQFVATGYYTDPTQTITPLSAMWGTCYQDAPTSEISVTALGVAQCAPGAVGTYTVWA
Ga0182024_10008162153300014501PermafrostMEKLGLVLSLIALSVAASLTLSCGARSQGQDLLQSITLSPAAVDAQDYPNGQVQFIASGYYINPSRTVTPLSATWGACYQLAPTSAISVTSTGLAQCASGAVGTYSVWANDPMPLAPGVYSCPASTACGGGCTIQATAQLTCP*
Ga0181522_1087695213300014657BogMGKLRLTLSLFALVVAASFALACGAGAGSPGQQDPLVSITLSPTAADAQDFANGQVQFIATGNYIDPTRTVTPLTATWGSCCQSAGTSEVTVTAAGVAQCAPGAVGTYTVWADDPPTRGVGCLVVNACGGR
Ga0181511_110845023300016702PeatlandMKKLRVTLCFLALFLPASFVLSCGASPQGNLGSQGDPLQSITLSPATADAQDYPNGQVPFIATGHYIDPSRTVTPLSAGWGTCYQASPTQQAPTSEVSVTPTGVAQCTPGAVGTYTIWANDPPYPGVECLAITVCGGGCFVAGTAQLTCP
Ga0187802_1011690413300017822Freshwater SedimentMMKALLCLFCFLALLVPAFFLLSCGTKSPGQDPLQSITLSPASADAQDYPNGQVQFTATGYYADPSRTVTPLSALWGTCQQEGSTNEAPTNAISVTQRGVAQCARGAVGTYTVWADDPPNPNITCLAITA
Ga0187818_10000073123300017823Freshwater SedimentMEKLGLAVSLLALSVAASLALSCGARSRGQDPLQSITLSPATADAQDYPNGQVQFIATGFYINPSHTVTPLSATWGVCYQYAPTSAISVTSTGLAQCASGAVGTYSVWANDPMPLGPGIYNCPASTACGGGCTIQATAQLTCP
Ga0187818_1001065523300017823Freshwater SedimentMKALLCLFCFLALLVPAFFLLSCGTKSPGQDPLQSITLSPASADAQDYPNGQVQFTATGYYADPSRTVTPLSALWGTCQQEGSTNEAPTNAISVTQRGVAQCARGAVGTYTVWADDPPNPNITCLAITACGGGCFVAGTAQLTCP
Ga0187856_103523933300017925PeatlandMEKLRFMLSFLALILATSFALSCGASSHGQDPLQSITLSPATADAQDYPNGEVQFTATGHYLNPSRTVTPLSAGWGTCYQDASTSEVSVTSGGVAKCAAGTVGTYTVWANDPPFPDVGCLAITACGGGCFIAGSAQLTCP
Ga0187856_105974623300017925PeatlandMEKLRFMLSFLALILAASFALSCGASSHGQNPLQSITLSPATADAQNYPNGEVQFTATGHYINPSRSVTPLSAGWGTCYQDASTSEVSVTSGGVAKCATGAIGTYTVWANDPPFPNVGCLAITACGGGCFIAGSAQLTCP
Ga0187856_116014313300017925PeatlandMEKLRFTLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCF
Ga0187856_131873713300017925PeatlandMEKLRFMLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPDGQVQFTATGFYTDPPRTVTPLSAMWGTCYQNAPTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCF
Ga0187849_101999023300017929PeatlandMEKLRFTLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP
Ga0187803_1013035423300017934Freshwater SedimentMERLRFTLSFLALGLAASLAMSCGASQGQSQLQSVTLSPTTADAQDYPNGQVQFTATGLYNNPSRTVTPLQATWGACYQISTTSAVSVTREGLAQCAPGATGTYTIWANAPVDINSGCPAITACG
Ga0187848_1031657913300017935PeatlandMEKLRFMLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPDGQVQFTATGFYTDPPRTVTPLSAMWGTCYQNAPTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGC
Ga0187853_1015069423300017940PeatlandMPSLRFMFSFLTLVLGVSVALSCGANQEQSQLQSITLSPATADAQSYPNGQVQFTATGSYGNPSRTVTPLPATWGACYQLATTSAVSVTREGLAQCAPGATGTYTIWANDPVDIKSGCPAVTACGGGCTVQGNAQLTCP
Ga0187808_1047378113300017942Freshwater SedimentILGCVLQEGMMKALLGLFCFLALLVPAFFLLSCGTKSPGQDPLQSITLSPASADAQDYPNGQVQFTATGYYADPSRTVTPLSALWGTCQQEGSTNEAPTNAISVTQRGVAQCARGAVGTYTVWADDPPNPNITCLAITACGGGCFVACTAQLTCP
Ga0187819_1000374253300017943Freshwater SedimentMKALLCLFCFLALLVPAFFLLSCGTKSPGQDPLQSITLSPASADAQDYPNGQVQFTATGYYADPSRTVTPLSALWGTCQQEGSTNEAPTNAISVTQRGVAQCARGAVGTYTVWADDPPNPNISCLAITACGGGCFVAGTAQLTCP
Ga0187819_1024665523300017943Freshwater SedimentMDKLRLTLFLLALVLAASFTLSCGAGSQRSQGQDPLQSITVSPATADAQDYPNGQVQFIATGYYTDPSRAVTPLSARWGTCYQEVSTSEVSVTAAGVAQCAPGAVGTYTVWADDPPSNVYCLAITACGGGCFVAGTAQLTCP
Ga0187819_1036348113300017943Freshwater SedimentMEKLGLAVSLLALSVAASLALSCGARSRGQDPLQSITLSPATADAQDYPNGQVQFIATGFYINPSHTVTPLSATWGVCYQYAPTSAISVTSTGLAQCASGAVGTYSVWANDPMPLGPGVYNCPASTACG
Ga0187879_1049967913300017946PeatlandSLRFMFSFLTLVLGVSVALSCGANQEQSQLQSITLSPATADAQSYPNGQVQFTATGSYGNPSRTVTPLPATWGACYQLATTSAVSVTREGLAQCAPGATGTYTIWANDPVDIKSGCPAVTACGGGCTVQGNAQLTCP
Ga0187781_1099421113300017972Tropical PeatlandMERLRLTLSLFALVAAACLASSCGAHQNSMQSQDPLQDPLQSIALAPAVADAQDYPNGEVPFVATGYYTNPPRTVTPLSAFWGTCYENGSTTEISVTSAGVAKCAPGAVGTFTVWADDPPNPNVVCLAITACGGGCFIAGTAQLTCP
Ga0187816_1005004223300017995Freshwater SedimentMERLRFTLSFLALGLAASLAMSCGASQGQSQLQSVTLSPATADAQDYPNGQVQFTATGLYNNPSRTVTPLQATWGACYQISTTSAVSVTREGLAQCAPGATGTYTIWANAPVDINSGCPAITACGGGCTVEGNAQLTCP
Ga0187816_1027811113300017995Freshwater SedimentTGTGFLSGKEGVMEKLGLAVSLLALSVAASLALSCGARSRGQDPLQSITLSPATADAQDYPNGQVQFIATGFYINPSHTVTPLSATWGVCYQYEPTSAISVTSTGLAQCASGAVGTYSVWANDPMPLGPGIYNCPASSACGGGCTIQATAQLTCP
Ga0187891_114971323300017996PeatlandFMLSFLALILAASFALSCGASSHGQNPLQSITLSPATADAQNYPNGEVQFTATGHYINPSRSVTPLSAGWGTCYQDASTSEVSVTSGGVAKCATGAIGTYTVWANDPPFPNVGCLAITACGGGCFIAGSAQLTCP
Ga0187891_115128023300017996PeatlandFMLSFLALILAASFALSCGASSHGQNPLQSITLSPATADAQDYPNGEVQFTATGHYINPSRTVTPLSAGWGTCYQDASTSEVSVSSGGVAKCAAGAVGTYTVWANDPPFPDVGCLAMTACGGGCFIAGSAQLTCP
Ga0187810_1050326113300018012Freshwater SedimentSLLALSVAASLALSCGARSRGQDPLQSITLSPATADAQDYPNGQVQFIATGFYINPSHTVTPLSATWGVCYQYAPTSAISVTSTGLAQCASGAVGTYSVWANDPMPLGPGVYNCPASTACGGGCTIQATAQLTCP
Ga0187873_124319313300018013PeatlandMEKLRFMLSFLALILAASFALSCGASSHGQNPLQSITLSPATADAQNYPNGEVQFTATGHYINPSRSVTPLSAGWGTCYQDASTSEVSVTSGGVAKCATGAIGTYTVWANDPPFPNVGCLAITACGGGCFI
Ga0187885_1001114323300018025PeatlandMEKLRFMLSFLALILAASFALSCGASSHGQNPLQSITLSPATADAQDYPNGEVQFTATGHYINPSRSVTPLSAGWGTCYQDASTSEVSVTSGGVAKCAAGTVGTYTVWANDPPFPDVGCLAITACGGGCFIAGSAQLTCP
Ga0187885_1003625913300018025PeatlandMEKLRFMLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP
Ga0187863_1000242573300018034PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESITISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP
Ga0187883_1027920913300018037PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGAVGTYSVWANDPAPLGPGVYS
Ga0187855_1002270233300018038PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANNPAPLGPGVYSCPASTACGGGCTIQATAQLTCP
Ga0187862_1090497513300018040PeatlandMEKLRFMLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPDGQVQFTATGFYTDPPRTVTPLSAMWGTCYQNAPTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAIT
Ga0187887_1011419223300018043PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP
Ga0187890_1060411513300018044PeatlandCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVASGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP
Ga0187851_1017949323300018046PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGAVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATSQLTCP
Ga0187858_1079818223300018057PeatlandASFALSCGASSHGQNPLQSITLSPATADAQNYPNGEVQFTATGHYINPSRSVTPLSAGWGTCYQDASTSEVSVTSGGVAKCATGAIGTYTVWANDPPFPNVGCLAITACGGGCFIAGSAQLTCP
Ga0187858_1091434913300018057PeatlandGVMPSLRFMFSFLTLVLGVSVALSCGANQEQSQLQSITLSPATADAQSYPNGQVQFTATGSYGNPSRTVTPLPATWGACYQLATTSAVSVTREGLAQCAPGATGTYTIWANDPVDIKSGCPAVTACGGGCTVQGNAQLTCP
Ga0187784_1165793413300018062Tropical PeatlandALVAAACLASSCGAHQNSMQSQDPLQAIALTPAVADAQDYPNGEVPFVATGYYTNPPRTVTPLSAFWGTCYQNASTAEISVTSAGVAKCAPGAVGSFTVWADDPPNPNVVCLAITACGGGCFIAGTAQLTCP
Ga0187852_114434313300019082PeatlandARSQGQDPLQSITLSPATADAQDYPNGEVQFTATGHYLNPSRTVTPLSAGWGTCYQDASTSEVSVTSGGVAKCAAGTVGTYTVWANDPPFPDVGCLAITACGGGCFIAGSAQLTCP
Ga0187852_142488213300019082PeatlandMPSLRFMFSFLTLVLGVSVALSCGANQEQSQLQSITLSPATADAQSYPNGQVQFTATGSYGNPSRTVTPLPATWGACYQLATTSAVSVTREGLAQCAPGATGTYTIWANDPVDIKSGCP
Ga0181506_104749913300019260PeatlandMERVPLALFSLALVLAASLVLSCGSGSQNQDPLVSVALTPATADARDFPNGQVQFVATGYYINPSRTVSPLAAAWGTCYQEASTSEISVTAGGMAQCAPGAVGTYTVWADDPPLSNVACNAITACGGGCFVAGTAQLTCP
Ga0210407_1017120023300020579SoilMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSVECLAITACGGGCFVAGTAQLTCP
Ga0210395_100000021123300020582SoilMEKEKLGLVLCLIALSVAASLTLSCGAKSQDQDPLASITLSPATADAKDYPNGQVQFIATGYYIDPSHTVTPLTATWGTCYQFAPTTAVSVTSTGLAQCASGAIGNYSVWANDPAPLGPGVYNCPASGACGGGCTIQATAQLTCP
Ga0210395_1125232323300020582SoilVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSVECLAITACGGGCFVAGTAQLTCP
Ga0210388_1038201713300021181SoilMDKFRLTVFLLALLLAASFTLSCGAGSQGQDPLQSITISPATADAQDYPNGQVQFIPTGYYTDPSRAVTPLSAMWGTCYQNASTHEVSVTAGGVAQCAPGAVGTYTIWANDPPKSNVQCLAMTVCGGGCFVVGSAQLTCP
Ga0210388_1125807613300021181SoilCLLGFLALPLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSVECLAITACGGGCFVAGTAQLTCP
Ga0210383_1127600413300021407SoilMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSVECLAIT
Ga0210394_10000043473300021420SoilMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSVTLSPPSADAQDYPNGQVPFVATGYYADPVRKVSPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYTSVECLAITACGGGCFVAGAAQLTCP
Ga0210394_1015287313300021420SoilMEKLGLVLSLIVLSVAASLILSCGAGSQGQDPLQSITLSPAAADAQNYSNGQVQFIATGYYSNPSRTVTPLSATWGTCYQFAPTSAISVTSTGLAQCASGAVGTYSVWANDPMPLAPGVYSCPASTACGGGCTIQATAQLTCP
Ga0210394_1107195013300021420SoilLLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSVECLAITACGGGCFVAGTAQLTCP
Ga0242655_1028695113300022532SoilMKALRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSVECLAITACGGGCFVAGTAQLTCP
Ga0212123_1012213533300022557Iron-Sulfur Acid SpringMEKLGLAFSLLALVVAAWLTLSCGARSQDQNPLQSVTLSPATADAHYVNGQVQFIATGYYVNPSRTVTPLSATWGVCYQNAGTSAISVTSTGSAQCASGVVGTYSVWASDPMPLGPGVYNCPASTACGGGCTVQATAHLTCP
Ga0242653_106826813300022712SoilMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQESPTNAATVTQGGVAQCTAGAVGTYTVWANDPPYPSLECLAITACGGGCFVAGTAQLTCP
Ga0242678_106007913300022715SoilLGLVLCLIALSVAASLTLSCGAKSQDQDPLASITLSPATADAKDYPNGQVQFIATGYYIDPSHTVTPLTATWGTCYQFAPTTAVSVTSTGLAQCASGAVGSYSVWANDPAPLGPGVYNCPASGACGGGCTIQATAQLTCP
Ga0242661_103966223300022717SoilMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADAQDYPNGQVPFVATGYYADPVRKVSPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSLECLAITACGGGCFVAGTAQLTCP
Ga0242657_122897513300022722SoilMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWAKDPPYPSVECLAITACGGGCFVAGTAQLTCP
Ga0242654_1007620823300022726SoilGIMKTLRCLLGFLALLLPASLVLSCGTKSPSPGQDPLQSITLSPASADARDYPNGQVSFVATGYYAAPARKVTPLSAGWGACIQGGPTQEAPTNAVTVTQGGVAQCTAGAVGTYTVWANDPPYPSVECLAITACGGGCFVAGTAQLTCP
Ga0224550_100075563300022873SoilMAKLRLTLFSLALILAASFALSCGARSQSQDPQSQDPLQSITLSPATADARNYPNGQVQFIATGYYIDPSHMVTPLSAMWGTCYQDASTSEVAVTAGGVAQCAPGAVGTYTVWADDPPLSNVACLAITACGGGCFVAGTAQLTCP
Ga0224550_102096513300022873SoilMQRLPLALLSLALVLAAALALSCGTGSQNQDPLVSVTLSPATADAADYPNGQVQFVATGYYINPSRTVSPLTAAWGTCYQEASTSEISVTAVGVAQCAPGAVGTFTVWADDPPLPNVACTAIT
Ga0224556_100226533300024295SoilMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESITISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLTATWGTCSQFAATTAVSVSSTGLAQCASGAVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP
Ga0208935_100849213300025414PeatlandMAMEKLDLALSLIALSVVATLSLSCGAKSQSQDPLESVTISPATADAQDYPNGQVQFIASGYYIDPSHTVTPLIATWGTCSQFAATTAVSVSSTGLAQCASGTVGTYSVWANDPAPLGPGVYSCPASTACGGGCTIQATAQLTCP
Ga0208034_100872843300025442PeatlandMEKLRFTLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPNGQVQFTATGFYADPPHTVTPLSATWGTCYQGAGTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAITACGGGCFVVGSAQLTCP
Ga0208191_106503313300025496PeatlandMEKLRFMLSFLALVLAASFALSCGARSQGQDPLQSITLSPATADAQDYPDGQVQFTATGFYTDPPRTVTPLSAMWGTCYQNAPTSEVSVTSGGVAQCAPGAVGTYTVWANDPPSPNVGCLAI
Ga0208937_107278913300025506PeatlandMEKLRFMLSFLALILATSFALSCGASSHGQDPLQSITLSPATADAQDYPNGEVQFTATGHYLNPSRTVTPLSAGWGTCYQDASTSEVSVTSGGVAKCAAGTVGTYTVWANDPPFPDVGCLAITACGGGCFIA
Ga0208188_103243513300025507PeatlandMPSLRFMFSFLTLVLGVSVALSCGANQEQSQLQSITLSPATADAQSYPNGQVQFTATGSYGNPSRTVTPLPATWGACYQLATTSAVSVTREGLAQCAPGATGTYTIWANDPVDIKSGCPAVTACGGGC
Ga0208239_100077623300027168Forest SoilMEKEKLGLVLCLIALSVAASLTLSCGAKSQDQDPLASITLSPATADAKDYPNGQVQFIATGYYIDPSHTVTPLPATWGTCYQFAPTTAVSVTSTGLAQCASGAVGSYSVWANDPAPLGPGVYNCPASGACGGGCTIQATAQLTCP
Ga0209420_102383413300027648Forest SoilMQRLPLALLSLALVLAAALALSCGTGSQNQDPLVSVTLNPATADAADYPNGQVQFVATGYYINPSRTVSPLTAAWGTCYQEASTSEISVTAGGVAQCAPGAVGTFTVWADDPPLPNVACTAITACGGGCFVAGTAQLTCP
Ga0209908_1000571333300027745Thawing PermafrostMAKLRLTLFSLALVLTASFALSCGARSHSQDPLQSITLSPATADAQNYPNGQVQFIATGYYIDPSHTVTPLSAMWGTCYQNASTSAVSVSAGGVAQCAPGAVGTYTVWADDPPLSNVACLAITACGGGCFVAGTAQLTCP
Ga0209274_10000027383300027853SoilMAKLRLALFSLTLVLAASSALSCGARSQSQDPLQTITLSPATANAQDYPNGQVQFVATGYYIDPSRTVSPLSATWGTCYQEASTSEVSVTAAGVAQCAPGAIGTYTIWADNPPVSGVSCLAITACGGGCFVAGTAQLTCP
Ga0209274_1000180223300027853SoilMEKLGVVLSLIALSVAASLTLSCGAKSQSQDPLQSITISPAAADGQNYPNGQVQFVATGYYVDPSHTVTPLPATWGTCYQFAPTTAVSVTSTGLAQCASGAVGTYSVWANDPAPLGPGVYNCPASGACGGGCTIQATAQLTCP
Ga0209517_10005331113300027854Peatlands SoilMKTRCMLCFLALLLPASFVLSCGAKTQGQDPLQTITLSPASADAQDYPNGQVQFIATGYYTDPARKVTPLSAGWGTCIQGGPTQEAPTNAVSVTQGGVAQCTPGAVGTYTIWANGPPYPNVECLAITACGGGCFIAGTAQLTCP
Ga0209275_1002020533300027884SoilMDKFRLTVFLLALLLAASFTLSCGAGSQGQDPLQSITISPATADAQDYPNGQVQFIPTGYYTDPSRAVTPLSAMWGTCYQNASTHEVSVTAGGVAQCAPGAVGTYTIWANDPPKSNVQCLAMTACGGGCFVVGSAQLTCP
Ga0209380_10000616113300027889SoilMERLQLALFSLALVLAASLALSCGTGSENAGSQNQDPLVSVTLSPGTADARDYPNGQVQFVATGFYINPSRTVSPLSAAWGTCYQEASTSEISVTAGGMAQCAPGAVGTFTVWADDPPLSNVACNAITACGGGCFVAGTAQLTCP
Ga0209380_1025815723300027889SoilMEKLGVVLSLIALSVAASLTLSCGAKSQSQDPLQSITISPAAADGQNYPNGQVQFVATGYYVDPSHTVTPLPATWGTCYQFAPTTAVSVTSTGLAQCASGAVGTYSVWANDPAPLGP
Ga0209415_1004038723300027905Peatlands SoilMKTLRYLLGFLALLLPASLVLSCGTTSQGQDPLQTITLSPASADAKDYPNGQVQFIATGYYSDPARKVTPLSAGWGTCYQSPTIEAPTNAISVTPTGVAQCTPGAVGTYTVWANDPPNSNIECLAITVCGGGCFVAGTAQLTCP
Ga0302219_1000144233300028747PalsaMKTPHRFSLCSFLLFLVASFALSCGNGAGANRQLQSIALTPATADAQAYPDGQVQFTATGDYNTAPNTVTPLAAHWGTCYQGAATSEISVTAAGLAQCTSGASGTYTVWADDPASPNGGCLSINACGGGCFIVGTAQLTCH
Ga0302219_1009490423300028747PalsaLALVLAAALALSCGTGSQNQDPLVSVTLSPATADAADYPNGQVQFVATGYYINPSRTVSPLTAAWGTCYQEASTSEISVTAVGVAQCAPGAVGTFTVWADDPPLPNVACTAITACGGGCFVAGTAQLTCP
Ga0302224_1013998913300028759PalsaMQRLPLALLSLALVLAAALALSCGTGSQNQDPLVSVTLSPATADAADYPNGQVQFVATGYYINPSRTVSPLTAAWGTCYQEASTSEISVTAVGVAQCAPGAVGTFTVWADDPPLPNVACTAITACGGGCFVAGTAQLTCP
Ga0302303_1007853823300028776PalsaMAKLRLALFSLALVLTASFALSCGARSQSQDPLQSITLSPATADAQNYPNGQVQFIATGYYIDPSHTVTPLSAMWGTCYQNASTSAVSVTAGGVAQCAPGAAGTYTIWADDPPLSNVACTAITACGGGCFVAGTAQLTCP
Ga0308309_1044767913300028906SoilMERLQLALFSLALVLAASLALSCGTGSENAGSQNQDPLVSVTLSPGTADARDYPNGQVQFVATGYYINPSRTVSPLSAAWGTCYQEASTSEISVTAGGMAQCAPGAVGTFTVWADDPPLSNVACNAITACGGGCFVAGTAQLTCP
Ga0311368_1060917813300029882PalsaLRLTLFSLALVLTASFALSCGARSQSQDPQSQDPLQSITLSPATADAQNYPNGQVQFIATGYYIDPSHTVTPLSAMWGTCYQNASTSAVSVTAGGVAQCAPGAAGTYTIWADDPPLSNVACTAITACGGGCFVAGTAQLTCP
Ga0311352_1014948023300029944PalsaMAKLRLTLFSLALILAASFALSCGARSQSQDPQSQDPLQSITLSPATADARNYPNGQVQFIATGYYIDPSHMVTPLSAMWGTCYQDASTSEVAVTAGGVAQCAPGAAGTYTIWADDPPLSNVACTAITACGGGCFVAGTAQLTCP
Ga0311371_1223027113300029951PalsaGHSCPLLLTLTWSPGRFLQPGVRSRVLIRKEGVMAKLRLTLFSLALILAASFALSCGARSQSQDPQSQDPLQSITLSPATADARNYPNGQVQFIATGYYIDPSHMVTPLSAMWGTCYQDASTSEVAVTAGGVAQCAPGAVGTYTVWADDPPLSNVACLAITACGGGCFVAGTAQLTCP
Ga0311339_1008348233300029999PalsaMQKPMFTFLTLPLAAAFVLSCGGSSNARQLQSITLSPATADAQDYPNGQVQFAATGNYSSDPRIVNPLAANWGSCYQGAVTSAISVTSAGVAQCASGAVGTYTVWADDPSPTSNCLAVTACGGGCFVAGTAQLTCP
Ga0311339_1021242223300029999PalsaMETLQLTLFSLALVLAASFALSCGTSSQSHDPLQSITLTPATADAQDYPNGQVQFTATGNYIDPSRTVTPLSATWGACFENASTSKVSVTAGGVAQCAPGAVGTYTVWANDPPQSSVECLAITACGGGCFVAGTAQLTCP
Ga0311338_1051937413300030007PalsaCGTSSQSHDPLQSITLTPATADAQDYPNGQVQFTATGNYIDPSRTVTPLSATWGACFENASTSKVSVTAGGVAQCAPGAVGTYTVWANDPPQSSVECLAITACGGGCFVAGTAQLTCP
Ga0302177_1009983133300030053PalsaLALVLTASFALSCGARSQSQDPLQSITLSPATADAQNYPNGQVQFIATGYYIDPSHTVTPLSAMWGTCYQNASTSAVSVTAGGVAQCAPGAAGTYTIWADDPPLSNVACTAITACGGGCFVAGTAQLTCP
Ga0302182_1025539013300030054PalsaVLSCGGSSNARQLQSITLSPATADAQDYPNGQVQFAATGNYISDPRIVNPLAANWGSCYQGAVTSAISVTSAGVAQCASGAVGTYTVWADDPSPTSNCLAVTACGGGCFVAGTAQLTCP
Ga0302176_1000037553300030057PalsaMKTPHRFSLCSFLLFLVASFALSCGNGAGANRQLQSIALTPATADAQAYPDGQVQFTATGDYNTAPNTVTPLAAHWGTCYQGSATSEISVTAAGLAQCTSGASGAYTVWADDPASPNGGCLSINACGGGCFIVGTAQLTCP
Ga0302183_1000105983300030509PalsaMKTPHRFSLCSFLLFLVASFALSCGNGAGANRQLQSIALTPATADAQAYPDGQVQFTATGDYNTAPNTVTPLAAHWGTCYQGSATSEISVTAAGLAQCTSGASGTYTVWADDPASPNGGCLSINACGGGCFIVGTAQLTCH
Ga0311372_1050486033300030520PalsaMQRLPLALLSLALVLAAALALSCGTGSQNQDPLVSVTLNPATADAADYPNGQVQFVATGYYINPSRTVSPLTAAWGTCYQEASTSEVSVTAGGVAQCAPGAVGTFTVWADDPPLPNVACTAITACGGGCFVAGTAQLTCP
Ga0311355_1033982533300030580PalsaMQRLPLALLSLALVLAAALALSCGTGSQNQDPLVSVTLNPATADAADYPNGQVQFVATGYYINPSRTVSPLTAAWGTCYQEASTSEISVTAVGVAQCAPGAVGTFTVWADDPPLPNVACTAITACGGG
Ga0311354_1195041213300030618PalsaKEGVMAKLRLTLFSLALILAASFALSCGARSQSQDPQSQDPLQSITLSPATADARNYPNGQVQFIATGYYIDPSHMVTPLSAMWGTCYQDASTSEVAVTAGGVAQCAPGAVGTYTVWADDPPLSNVACLAITACGGGCFVAGTAQLTCP
Ga0302316_1042674813300030646PalsaLDRKNSMKTPHRFSLCSFLLFLVASFALSCGNGAGANRQLQSIALTPATADAQAYPDGQVQFTATGDYNTAPNTVTPLAAHWGTCYQGAATSEISVTAAGLAQCTSGASGTYTVWADDPASPNGGCLSINACGGGCFIVGTAQLTCH
Ga0302310_1018576023300030737PalsaMKTPHRFSLCSFLLFLVASFALSCGNGAGANRQLQSIALTPATADAQAYPDGQVQFTATGDYNTAPNTVTPLAAHWGTCYQGAATSEISVTAAGLAQCTSGASGTYTVWADDPASPNGGCLSINACGGGCFIVGTAQLTCP
Ga0302314_1117116813300030906PalsaMKTPHRFSLCSFLLFLVASFALSCGNGAGANRQLQSIALTPATADAQAYPDGQVQFTATGDYNTAPNTVTPLAAHWGTCYQGAATSEISVTAAGLAQCTSGASGTYTVWADDPASPNGGCLSINACGGGCFIVGTAQLTC
Ga0302180_1002470213300031028PalsaKLRLALFSLALVLTASFALSCGARSQSQDPLQSITLSPATADAQNYPNGQVQFIATGYYIDPSHTVTPLSAMWGTCYQNASTSAVSVTAGGVAQCAPGAAGTYTIWADDPPLSNVACTAITACGGGCFVAGTAQLTCP
Ga0302324_10319855913300031236PalsaMEKLGLVLSLIALSVAASLTLSCGASSQGQDLLQSITLSPAAADAQDYPNGQVQFIATGYYINPSRTVSPLSATWGTCYQFEPTSAISVTSTGLVQCASGAVGTYSVWANDPMPLAPGTYSCPASTACGGGCTIQATAHVTCP
Ga0310686_11070861133300031708SoilMEKLGLVLSLIVLSVAASLILSCGAGSQGQDPLQSITLSPAAADAQNYPNGQVQFTATGYYSNPSRTVTPLSATWGTCYQFAPTSAISVTSTGLAQCASGAVGTYSVWANDPMPLAPGVYSCPASTACGGGCTIQATAQLTCP
Ga0302315_1027368913300031837PalsaSCGNGAGANRQLQSIALTPATADAQAYPDGQVQFTATGDYNTAPNTVTPLAAHWGTCYQGAATSEISVTAAGLAQCTSGASGTYTVWADDPASPNGGCLSINACGGGCFIVGTAQLTCH
Ga0311301_1033427613300032160Peatlands SoilMKKLRFMLCFVALVLPASLVLSCGTKSPGQDPLQSITLSPATADAQDYPNGQVPFTATGYYSDPSRTVTPLSAGWGTCYQEASTNAVSVSPGGVAQCTPGAVGTYTIWADDPPFPNVACLAITACGGGCFVAGTAQLTCP
Ga0326728_1003053633300033402Peat SoilMERLRFTLSFLALVLLASLASSCGASSQDQDPLLSITLTPATADAQDYPNGEVQFTATGHYTNPPRTVTPLSAGWGTCYQDASTSEVIITAPGVAKCASGAVGTYTVWANDPPDPNVECLVMNACGGGCFVAGTAQLTCP
Ga0334854_015623_1083_15053300033829SoilMAKLRLALFSLVLVLTASFALYCGARSHSQDPLQSITLSPATADAQNYPNGQVQFIATGYYIDPSHTVTPLSAMWGTCYQNASTSEVSVSAGGVAQCAPGAVGTYTVWADDPPLSNVACTAITACGGGCFVAGTAQLTCP
Ga0326724_0488183_296_6313300034091Peat SoilMERLRFTLSFLALVLLASLASSCGASSQDQDPLLSITLTPATADAQDYPNGEVQFTATGHYTNPPRTVTPLSAGWGTCYQDASTSEVIITAPGVAKCASGAVGTYTVWANDP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.