| Basic Information | |
|---|---|
| Family ID | F038521 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MTAQDLQGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.88 % |
| % of genes near scaffold ends (potentially truncated) | 50.30 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (58.788 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (84.848 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.75% β-sheet: 0.00% Coil/Unstructured: 51.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 58.79% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 13.94% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 13.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.06% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009977 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028246 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028465 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070668_1010301181 | 3300005347 | Switchgrass Rhizosphere | MTAQDLRGIRVNGLSEKTNFGAKIALSQLFDGAARKTYSGTQVIRGPCFLDV* |
| Ga0070668_1012066341 | 3300005347 | Switchgrass Rhizosphere | MTAQDLQGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0070665_1024945651 | 3300005548 | Switchgrass Rhizosphere | MIAQDLQGIRANGLSEKTNFGAKISLSQQIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0068859_1005740022 | 3300005617 | Switchgrass Rhizosphere | MTAQDLQGIRANDLSEKTNFGVKIALSQLIDGAARKTYSGTQVIRGPCFLDALASS* |
| Ga0068859_1005740023 | 3300005617 | Switchgrass Rhizosphere | MTAQDLQGIRANSLIEKMNFGAKIALSQLIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0068864_1016959942 | 3300005618 | Switchgrass Rhizosphere | MIAQDLQGIRANGLSEKTNFGAKIALSQLIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0068863_1015489382 | 3300005841 | Switchgrass Rhizosphere | VAAGSSWSKHMIAQDLQGIRVNGLREKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDV* |
| Ga0068858_1009973561 | 3300005842 | Switchgrass Rhizosphere | MIAQDLQGIKANGLSEKTNFGAKIALSQLIDGAARKTYSSIQVKRGPCFLDA* |
| Ga0068858_1015553172 | 3300005842 | Switchgrass Rhizosphere | MITQDLQGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0068860_1018203081 | 3300005843 | Switchgrass Rhizosphere | MTAQDLQGIRANGLSEKMNFGAKIALLQQIDGAARKTYSSTQVIRGPCFLDA* |
| Ga0068862_1023862072 | 3300005844 | Switchgrass Rhizosphere | MTAQDLQGIKVNGLNEKTNFGAKIALSQLIDGAARTTYSGT* |
| Ga0105247_112573511 | 3300009101 | Switchgrass Rhizosphere | MTAQDLQGIKVNGLSEKTNFGAKIALSQLIDGAARKTYLGTHVI |
| Ga0105248_120743161 | 3300009177 | Switchgrass Rhizosphere | MTAQDLQGIRANGLSEKMNFGAKIALMQLIGGAARKTYSGTQVIRRPYFLDA* |
| Ga0105137_1095511 | 3300009972 | Switchgrass Associated | MRAQDLQVIRANGLSEKKNFGAKVALSQQIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0105129_1019581 | 3300009975 | Switchgrass Associated | IRVNGLSEKTNFGAKIALSQLIDGAARKTYSGTQVIRGPCFLDV* |
| Ga0105129_1096511 | 3300009975 | Switchgrass Associated | TAQDPQGIRGNGSSEKTNFGAKIALSQLIDSAAHIIYSGTQVIRGPYFLDA* |
| Ga0105128_1147851 | 3300009976 | Switchgrass Associated | MRAQDLQGVRANGLSKKMNFGSKIALMQLIDGAVRKTYSGTQVIRGPYFLDALACS* |
| Ga0105141_1201751 | 3300009977 | Switchgrass Associated | AGSSWSQDMTAQDLQGIRANGWSEKKKFGAKIALSQLIDGAALKTYSGTQVIRGPCILAA |
| Ga0105141_1201752 | 3300009977 | Switchgrass Associated | MTAQDLQGIRANGLSEKTIFGAKIALSQQIDGAAHKTYSGTQVI* |
| Ga0105135_1131092 | 3300009980 | Switchgrass Associated | MTAKDLHGISVNGLSEKMNFGVKIALSQQIDGAAHKTYSGTLVIREPCFLVA* |
| Ga0105135_1246191 | 3300009980 | Switchgrass Associated | MTAQDLEGIRANGLSEKMNFGAKIALSLLIDGAARQTYSDTQVIRGPCFLDA* |
| Ga0105135_1309271 | 3300009980 | Switchgrass Associated | MTTQDLQGIRANGLSEKMNFGAKIAIMQLIDGAVRKTYSGTQVIRGLCFLDA* |
| Ga0105133_1041961 | 3300009981 | Switchgrass Associated | MTAQDLQGTRPNGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLD |
| Ga0105133_1257961 | 3300009981 | Switchgrass Associated | RKTAQDLQGIRANGLSEKTNFLAKIALSQQIDGAARKTYSGTQVIRGPCFLAA* |
| Ga0105133_1257962 | 3300009981 | Switchgrass Associated | MVAAGSSWSKHMIAQDLKGIRANCLSEKMNFGVKIALSQLIDDVVRKTYSGNQVIRGPCFLDA* |
| Ga0105133_1278661 | 3300009981 | Switchgrass Associated | LMVLAHTTQDLQGIRANGLREKTNFGVKIALSQQIDGAARKTYSGTQVI* |
| Ga0105035_1312391 | 3300009988 | Switchgrass Rhizosphere | MTAQELQGKRANGLSEKTNFGAKIALSQLIDGAARKTYSGTQVIQGPCFLDA* |
| Ga0105131_1302292 | 3300009989 | Switchgrass Associated | MIAHYLQGIRANGLSEKMNFGAKIALSQQIDGAARKPYSGTNVIRGPYFLAV* |
| Ga0105131_1317391 | 3300009989 | Switchgrass Associated | MIAQDLHGIRANGLSEKMNFGAKIALSQQIDGAARK |
| Ga0105132_1325611 | 3300009990 | Switchgrass Associated | MTAQDLQGIRANGLSENTNFWAKIALSQLIDGAARKTYSGTQVIR |
| Ga0105120_10182842 | 3300009992 | Switchgrass Associated | VVAGSSWSKHMIAQDLQGIRANGLSEKMNFGVKIALSQLIDGVARKTYSGTQVIRGPCFLDA* |
| Ga0105120_10263991 | 3300009992 | Switchgrass Associated | MTAQDLQSVRANGLSEKTNFWAKIALSQLIDGAARKTYSDTQA |
| Ga0105120_10379471 | 3300009992 | Switchgrass Associated | MTAQDLQGIRENSLSEKMNFGAKIDLSRLIDGAARKTHSGTQVIRGPCF |
| Ga0105120_10513391 | 3300009992 | Switchgrass Associated | MIAQDLEGIRANGLSEKTNFGAKIALSQLIVGAARQTYSDTQVIR |
| Ga0105126_10254791 | 3300009994 | Switchgrass Associated | MTAKDLHGISVNGLSEKMNFGVKIALSQQIDGSARKTYPGTQVI* |
| Ga0105139_10815521 | 3300009995 | Switchgrass Associated | MIAQDLDSIRVNGLSKKTNFGAKIALSQQIDGAARKTYSGTHVIRGPYFLDA* |
| Ga0134125_108522921 | 3300010371 | Terrestrial Soil | MTAQDLQGIRTNGLSKKTNLGAKIDLSQQIDGAARKTYSVTQVIRGPSFLDA* |
| Ga0134126_122915871 | 3300010396 | Terrestrial Soil | MIAQDLQGIKANGLSEKTNFGAKIALSQLIDGAARKTDSGTQVIPGPCFLDA* |
| Ga0134127_119593361 | 3300010399 | Terrestrial Soil | MIAQDLQGIRANGLNEKMNFGAKIALMQLIDGAVRKTYSGTQVIRVPYFLDT* |
| Ga0134127_133767911 | 3300010399 | Terrestrial Soil | MTAQDLHGISVNGLSEKMNFGAKIALSQLIDVAALKTYSGTQVI* |
| Ga0134123_119426532 | 3300010403 | Terrestrial Soil | SLWSLHNAVQNLQGKRANGLSEKTNFGSKIALSQLIDGAARKTYSGTQVIRGPCFLDALASS* |
| Ga0157379_124952051 | 3300014968 | Switchgrass Rhizosphere | MTALDLQGIKVNGLSEKTNFGVKIALSQLIVGAARKTYSATQFIRGPRFLDA* |
| Ga0182099_10733391 | 3300015278 | Switchgrass Phyllosphere | MTAQDLQGIRANDLSEKTNFGVKIALSQLIDDAARKTYSGTQVIRGPCFLDA* |
| Ga0182100_10829632 | 3300015280 | Switchgrass Phyllosphere | QDLQGIRANSLSEKMNFGAKIALLQLIDGAARKTYSGTWVIRGPYFLDA* |
| Ga0182101_10107611 | 3300015284 | Switchgrass Phyllosphere | MIAQDLQGIRANDLSEKTNFGVKIALSQLIDDAARKTYSGTQVIRGPCFLDALASS* |
| Ga0182101_10234411 | 3300015284 | Switchgrass Phyllosphere | GMIAQDLQGIRVNGLREKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLVA* |
| Ga0182105_10498351 | 3300015290 | Switchgrass Phyllosphere | MIVQDLQGITANGLSEKMNFGSKIALSQLIDGAARKTYSGTQVIRGPCFLDALA |
| Ga0182105_10737991 | 3300015290 | Switchgrass Phyllosphere | LGSAAGSSWSQHMTAQDLQAIRANGLSEKMNFGVKITLSQLIDGAARTTYSGTQVIRGPFFLDA* |
| Ga0182103_10288531 | 3300015293 | Switchgrass Phyllosphere | MIAQDLQGIRVNGLREKTNFGAKIALSQQIDGAARKTYLGTQVI* |
| Ga0182103_10434261 | 3300015293 | Switchgrass Phyllosphere | AARSSSSQHMTAQDLQGIRVNGLSEKTNFGVKIALSQQIDGAARKTYSGTLVIRGPCFLDA* |
| Ga0182104_10291041 | 3300015297 | Switchgrass Phyllosphere | MIAQDLQGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDV* |
| Ga0182104_10502571 | 3300015297 | Switchgrass Phyllosphere | MTAQDLQGIIANGLSKKMNFGAKIALSQLIDGVARKTYSGTQVIQGPCFSDA |
| Ga0182104_10950091 | 3300015297 | Switchgrass Phyllosphere | MTAQDLQGIRANVLSEKMNFGVKIALSQQIDGAARKTYLGTLVIRGPCFLDA* |
| Ga0182104_11004592 | 3300015297 | Switchgrass Phyllosphere | MIAQDLQGTKVNGLSEKMNFGAKIALSLLIDGAAR |
| Ga0182184_10304702 | 3300015301 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSEKTNFGAKIALSQLIDGAARKTYSGTQVIQGPYFMDA* |
| Ga0182184_10936731 | 3300015301 | Switchgrass Phyllosphere | AAESSWSQHMTALDLQGIKVNGSSEKTNFGVKIALSQQIDGAAHKTYSGIQDIRGPYFLDA* |
| Ga0182098_10926092 | 3300015309 | Switchgrass Phyllosphere | MIAQDLQGIRANGLSEKTNFGAKIALSQLIDGAARKTYSGTQVIQ |
| Ga0182182_11089331 | 3300015311 | Switchgrass Phyllosphere | MIAQDLDSIRVNGLSKKTNFGAKIALSQQIDGAARKTYSGTHVIRGPY |
| Ga0182182_11089332 | 3300015311 | Switchgrass Phyllosphere | WSLHKTTQDLQGIRVNGLSEKTNFGVKIALSQLIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0182168_11027631 | 3300015312 | Switchgrass Phyllosphere | LQGIRANGLSEKTNFGAKIALSQLIDDAACKTYSGTQVIRGPCFLNA* |
| Ga0182164_10159651 | 3300015313 | Switchgrass Phyllosphere | ESSWSQHMIAQDLHGIRANSLSGKTNFGAKIALLQLIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0182164_10448541 | 3300015313 | Switchgrass Phyllosphere | IRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0182181_10651922 | 3300015318 | Switchgrass Phyllosphere | MTAQDLQGIRANGLREKMNFGAKIALMQLIDGAGRKTYSGTQVIRGPYFLDA* |
| Ga0182130_10491191 | 3300015319 | Switchgrass Phyllosphere | MIAQDLLGVRVNSLSEKTSFGAKIALSQVIDGAALETYSGTQVIRGPCFLYV* |
| Ga0182130_10877172 | 3300015319 | Switchgrass Phyllosphere | MIAQDLQGIRENGLSEKTNFGAKIALSQLIDGAARKTYSATQVIRGPHFLDA* |
| Ga0182165_10697101 | 3300015320 | Switchgrass Phyllosphere | MTALDLQGIKVNGSSEKTNFGVKIALSQQIDGSARKTYPGTQVI* |
| Ga0182165_10818681 | 3300015320 | Switchgrass Phyllosphere | WSHDMIAQDLQGIRANGLSEKTNFWAKIALSQLIDGAARKTYSGTQFI* |
| Ga0182148_10838791 | 3300015325 | Switchgrass Phyllosphere | DLQGIRANGLSEKMNFGAKIALSQLIDGAARKTYSCTQVIRGPCFLYA* |
| Ga0182148_10908921 | 3300015325 | Switchgrass Phyllosphere | MIAQDLHGISVNGLSEKMNFGAKIALSQQIDGAARKTYSGTQVIRGPCFMDA* |
| Ga0182148_10908922 | 3300015325 | Switchgrass Phyllosphere | DLGSAAGSSWSRHMTAPDLQGIRANGLSEKMNFGAKIALMHLIDGAGRKTYSGTQVIRGPYFLDA* |
| Ga0182166_10993221 | 3300015326 | Switchgrass Phyllosphere | WFQHLTAQDLQGIRANKWSEKKNFVAKIALSQLIDGAAHKTYSATHVIRGPCFLDA* |
| Ga0182166_11359101 | 3300015326 | Switchgrass Phyllosphere | MIAQDLQGIRANGLSEKMNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0182114_11533441 | 3300015327 | Switchgrass Phyllosphere | HMIAQDLDSIRVNGLSKKTNFGAKIALSQQIDGAARKTYSGTHVIRGPYFLDA* |
| Ga0182135_10778131 | 3300015329 | Switchgrass Phyllosphere | MIAKDLLGIRVNGLSEKTNFGVKIALSQLIDGAAHKTYSGTQVIRGPCFLDA* |
| Ga0182135_11448831 | 3300015329 | Switchgrass Phyllosphere | MTALDLQGIRANGLSEKTNFGAKIALSKLIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0182152_10219152 | 3300015330 | Switchgrass Phyllosphere | MTAQDLQGIRAKGFGEKMNFGVKIALSQQIDGAARKTYSGTLVIRGPCFLDA* |
| Ga0182152_10539191 | 3300015330 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSEKMNFCAKIALSQQNDGAARKTYLS |
| Ga0182152_10539192 | 3300015330 | Switchgrass Phyllosphere | MIAQDLQGIKANGLSEKTNFGAKIALSQLIDGAARKTYSGTQVKQGPCFLDA* |
| Ga0182152_11094211 | 3300015330 | Switchgrass Phyllosphere | IAQDLLGIRANGLSDKTNFWAKIALSQLIDSAARKTHSGTQVIRGPCFLDV* |
| Ga0182152_11094212 | 3300015330 | Switchgrass Phyllosphere | MIAQDLQGIRANGLSEKTNFGAKIALSQQIDGAAHKTYSGTQDIRGPYFLDA* |
| Ga0182117_11654841 | 3300015332 | Switchgrass Phyllosphere | MIAQDLLGIRAIGLSEKMNFGAKIALSQLIDGAARKTYSGTHVIRGPCFLDV* |
| Ga0182132_11674231 | 3300015334 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSKKMNFGAKIALSQQIDGAARKTYS |
| Ga0182116_10419322 | 3300015335 | Switchgrass Phyllosphere | MAQHMTAQDLQGIIANGLSEKTNFGAKIALSRQLDGAARQTYSGTQVIRGLCFLDALADS |
| Ga0182116_11393721 | 3300015335 | Switchgrass Phyllosphere | MTAQDLHGISVNGLSEKMNFGVKISLSQQIDGAAHKTYSGTQDIRGPYFLDA* |
| Ga0182151_10992471 | 3300015337 | Switchgrass Phyllosphere | MAQHMTAQDLQGIIANGLSEKTNFGAKIALSQLIDGAARMTNSGTQVIQGPCFLNA* |
| Ga0182151_11649731 | 3300015337 | Switchgrass Phyllosphere | MIAQDLQGIRANGVSKKTHFGAKIALSQQIDGAAHKTYSGTQ |
| Ga0182151_11649732 | 3300015337 | Switchgrass Phyllosphere | SQHITTQDLQSIRANGLSEKMNFRAKIALSQLIDGAARKTYSGTQVI* |
| Ga0182137_10715101 | 3300015338 | Switchgrass Phyllosphere | MTAQHLQGIRANGLSEKMNFGAKIALSLLIDGAARKTYSG |
| Ga0182137_11133191 | 3300015338 | Switchgrass Phyllosphere | MTAQDLQGIGANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDA* |
| Ga0182137_11290871 | 3300015338 | Switchgrass Phyllosphere | DLQGIRANDWSEKKIFGAKIAISQLIDGVARKTYSGTQVIRGPCFLDA* |
| Ga0182137_11331251 | 3300015338 | Switchgrass Phyllosphere | MTAKDLHGISVNGLSEKMNFGVKIALSQQIDGAAHKTYSGTQVIRGPCVLDA* |
| Ga0182149_11015302 | 3300015339 | Switchgrass Phyllosphere | VFSWSQHITAQDLQGIRANGLTEKMNFGAKIALSRQIDGAAHKTCSGTQDIRGPYFLDA* |
| Ga0182133_10836382 | 3300015340 | Switchgrass Phyllosphere | MTAQDLEGIRANSLSEKTNFGAKIALSRQIDGAARQTYSDTQVIRGP |
| Ga0182133_11051891 | 3300015340 | Switchgrass Phyllosphere | MVAQDLYGIRANGLSEKTNFGAKIALSQLIDGAARKICSGTQV |
| Ga0182133_11051892 | 3300015340 | Switchgrass Phyllosphere | MIAKDLDSIRVNGLSKKTNFGAKIALSQQIDGTARKTYSATQVIRGPYFLDA* |
| Ga0182133_11286221 | 3300015340 | Switchgrass Phyllosphere | GIIANGLSEKTNFGAKIALSQLIDGAADKTYSGTQVIRGPCFLDASAGS* |
| Ga0182133_11290681 | 3300015340 | Switchgrass Phyllosphere | MIAQDLQGIKANGLSEKTNFWAKIALSQLIDGAARKTYSGTQVKRGPCFLDA* |
| Ga0182115_11249071 | 3300015348 | Switchgrass Phyllosphere | MTAQDLQGKIANGLSEKMNFGAKIALSQQIDGAARKTYLGTQVIRGPCFLDA* |
| Ga0182115_12006552 | 3300015348 | Switchgrass Phyllosphere | MIAQDLQGVRENGLSEKTNFGAKIALSQLIDGAARKTYSGTQVI* |
| Ga0182115_12860041 | 3300015348 | Switchgrass Phyllosphere | MVQHKTGQDLQGIRANGLSEKTNFGAKIALSHQIDGAARKTYSVTLVIRGPRFLDA* |
| Ga0182185_10818101 | 3300015349 | Switchgrass Phyllosphere | MIAQDLDSIRVNGLSKKTNFGAKIALSQQIDGTARKTYSATQVIRGPYFLDAY |
| Ga0182185_10818102 | 3300015349 | Switchgrass Phyllosphere | WSHHMTAQDLQGIRANGLSEKTNFGAKIALSQLIDGAARKTYSGTQVIQGPCFLDA* |
| Ga0182163_11451692 | 3300015350 | Switchgrass Phyllosphere | VSSWSQHMIAQDMQGIRVNNLSEKTNFGAKIGLSQLIDGAARKTYSGTKFIRGPCFLYA* |
| Ga0182163_11805421 | 3300015350 | Switchgrass Phyllosphere | MIAQDLQGIRANSLSEKTNFGAKIALLQLIDGVARKTYSGTHVI* |
| Ga0182163_12367841 | 3300015350 | Switchgrass Phyllosphere | MTAKDLHGISVNVLSEKMNFGVKIALSQQIDGAAHKTYSGTQDIR |
| Ga0182169_11279161 | 3300015352 | Switchgrass Phyllosphere | IRANGLSEKMNFGAKIALMHLIDGAGRKTYSGTQVIRGPYFLDA* |
| Ga0182169_12461501 | 3300015352 | Switchgrass Phyllosphere | KGIRANGLSEKTNFGAKIALSQLIDGAARETYSGTQVIRGPCFLYV* |
| Ga0182169_12461502 | 3300015352 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSKKMNFGAKIALSQQIDGVARKTYSGTQVI* |
| Ga0182179_11022851 | 3300015353 | Switchgrass Phyllosphere | MKAQDLQGIRANGLSKKMNFGAKIALSQQIDGAARKTYSVTQVIRGPCFLYG* |
| Ga0182179_11540371 | 3300015353 | Switchgrass Phyllosphere | MTAQDLQVIRANGLSEKTNFGAKIALSHQIDGAARKTYLGTLVIRGPCFLDA* |
| Ga0182179_12286231 | 3300015353 | Switchgrass Phyllosphere | MTAQDLQGIRAKGFSEKMNFGVKIALSQQIDGAARKTYSGTL |
| Ga0182179_12286232 | 3300015353 | Switchgrass Phyllosphere | MIAQDLHGISMNGLSEKMNFGVKIALSQQIDGAAHKTYSGTQDIRGPYFLDA* |
| Ga0182167_13000412 | 3300015354 | Switchgrass Phyllosphere | MIAQDLQGIKANGLSEKTNFGAKIALSQLIDGAARKTYSGTQV |
| Ga0182167_13518641 | 3300015354 | Switchgrass Phyllosphere | MIAQDLQGIRANGLSVKTNFGAKIALSQQIDGAARKTYSGTQVIR |
| Ga0182167_13518642 | 3300015354 | Switchgrass Phyllosphere | SQHMIGQDLQGIRANGLREKTNFGAKIALSQLIDGAARKIYSGTQVIR* |
| Ga0182197_10899391 | 3300017408 | Switchgrass Phyllosphere | AGSSWSQHMTTQDLQGIRANGLSEKTNFGAKIAFSHLIDGAARKTYSDTQVI |
| Ga0182199_11925391 | 3300017412 | Switchgrass Phyllosphere | MTALDLQGIRANGLSEKMNFGAKIALMQLIDGAVRKIYSGTQVIRGPYFLDA |
| Ga0182199_12012111 | 3300017412 | Switchgrass Phyllosphere | AQDLHGISVNGLSEKMNFGVKIALSQQIDGAARKTYSSTQVIRGPCFQDA |
| Ga0182199_12012112 | 3300017412 | Switchgrass Phyllosphere | MTAQDLHGIRANSWSEKKNLVAKIALSQLIDGAARKTYSATQVIRGP |
| Ga0182201_10745491 | 3300017422 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSEIMNFGAKIALSQQIDGAAHKTYSGTQDIRGPYFLDA |
| Ga0182201_11064191 | 3300017422 | Switchgrass Phyllosphere | MKAPDLQGIRANGLSKKTNFGAKIALSQVIDGVAGKTYLGTQVIRGPCFLDA |
| Ga0182201_11146201 | 3300017422 | Switchgrass Phyllosphere | QDLQGIRMNGLREETNFGAKIALLQLIDGAARKTYSGTQVIRGPCFLDA |
| Ga0182196_10278171 | 3300017432 | Switchgrass Phyllosphere | MIAHDLQGIRVNGLSEKTNFGAKIGLSQLIDGAARKTYSGTKFIRGPCFLYA |
| Ga0182196_10991672 | 3300017432 | Switchgrass Phyllosphere | MTAKDLHGISVNVLSEKMNFGVKIALSQQIDGAAHKTYSGIQDI |
| Ga0182196_11299911 | 3300017432 | Switchgrass Phyllosphere | QHLTGQDLQGIRANSWSEKKNLVAKIALSQLIDGAARKTYSGTQVIRGPYFQNA |
| Ga0182196_11352792 | 3300017432 | Switchgrass Phyllosphere | AQDLQGIRANGLSEKTNFWAKIALPQLIDDAARKTYSGTQVI |
| Ga0182214_11407341 | 3300017440 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSEKTNFGAKIALSQQIDGAARTTYSGTQVIRGPFFLDA |
| Ga0182214_11585051 | 3300017440 | Switchgrass Phyllosphere | VSSLYQHMIAQDLQGIRVNGLSENTNFAATIAPSQLIDSAARMTYSGTQ |
| Ga0182198_11882891 | 3300017445 | Switchgrass Phyllosphere | MTAQDLQDIRVNGLSKKTNFAAKIALSQEIDGAARKTYSVTQV |
| Ga0182198_11882893 | 3300017445 | Switchgrass Phyllosphere | VLMAQHMTAQDLQGIIANGLSEKTNFGAKIALSQLIDGAADKTYSGTQVIRGPCF |
| Ga0182215_10847082 | 3300017447 | Switchgrass Phyllosphere | MIAQDLQGIRVNGLSEKTNFGANIALSQLIDGAARKTYSGTQVIRGPCFLDA |
| Ga0182215_11105842 | 3300017447 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVI |
| Ga0182215_11643172 | 3300017447 | Switchgrass Phyllosphere | MVGSWSSWSQHMIAQDLHGIRANGVREKMNFGPKIALSQLIDGASRKTYSGTQVIRGPCFLDA |
| Ga0182210_11096791 | 3300017692 | Switchgrass Phyllosphere | MIAQDLRGIRANGLSEKTNFGAKIALSQLIDGAARKTYSGTQVKRGPCFLDA |
| Ga0182146_1053681 | 3300020033 | Switchgrass Phyllosphere | MIAQDLQGIRANGLSEKTNFGAKVALSQQIDGAARKTYSGTQVIRGPCFLDA |
| Ga0182118_1035891 | 3300020223 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSEKMNFGAKIALSQQIDGAARKTYSSTQVIRGPCFLD |
| Ga0207712_108104041 | 3300025961 | Switchgrass Rhizosphere | WSYHMTAQYLQGIRANGLSEKTNFGAKIALSKLIDGAARKTYSGTQVIRGPCFLDA |
| Ga0268344_10083101 | 3300028051 | Phyllosphere | MIAQDLRGIRAKGLSEKINFGEKIALSQLIDGAARKTYSGTQVIPGPCFL |
| Ga0268346_10103971 | 3300028053 | Phyllosphere | MTAQVLQGIRANGLSEKTNFSAKIPLSQQIDGAARKTYLGTQVIR |
| Ga0268346_10103972 | 3300028053 | Phyllosphere | MTAQDLQGIRANDLSEKTNFGVKIALSQLIDDAARKTYSGTQVIRGPCFLDA |
| Ga0268306_10111651 | 3300028054 | Phyllosphere | SLHNAVQDLQGKRANGLSEKTNFGSKIALSQLIDGAARKTYSGTQVIRGPCFLDA |
| Ga0268334_10114131 | 3300028140 | Phyllosphere | MTAQDLQGIRANGLSEKMNFGAKIALSQLIDGAARKTYSGTQVIRGP |
| Ga0268347_10088731 | 3300028142 | Phyllosphere | SKYMIAQDLQGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDV |
| Ga0268347_10161161 | 3300028142 | Phyllosphere | MTAQDLQGIRANGLSEKTNFWAKIPPSQLIDGTARKTYSGTQ |
| Ga0268348_10102381 | 3300028143 | Phyllosphere | MTALDLQGIRANSLSEKMNFGAKIALSQLIHGAARKTYSGTHVIRGPYFLDA |
| Ga0268336_10219621 | 3300028152 | Phyllosphere | MVAARSSWSQHMTGQDLQGIRVNRVREKMNFWAKIALSQLIDGAARKTYSGTQVIRGPYFLNA |
| Ga0268320_10121531 | 3300028153 | Phyllosphere | MIAQDLQGIRANKWSEKKNFVAKIALSQLIVGAARKTYSATQFIRGPRFLDA |
| Ga0268351_10196611 | 3300028246 | Phyllosphere | HMIAQDLHGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRLPCFINA |
| Ga0268312_10147041 | 3300028248 | Phyllosphere | MTAQDLKGIRANGLSEKTNFGAKIALSQQINGAARKTYSGTQVIRGPCF |
| Ga0268312_10162711 | 3300028248 | Phyllosphere | MTAQDLQGIRAKGFSEKMNFGVKIALSQQIDGAARKTYSGTLVIRE |
| Ga0268312_10162712 | 3300028248 | Phyllosphere | MIAQDLHGISVNGLSEKMNFGAKIALSQQIDGAAHKTYSGTQGIRGPCFLNA |
| Ga0268310_10080822 | 3300028262 | Phyllosphere | GSSAGSSWTQHTIAQVLQGIRANGWSEKKNFGAKIALSQLIDGAALKTYSGTQVIRGPCILDA |
| Ga0268310_10282351 | 3300028262 | Phyllosphere | HHIIAQHLQGIRANGLSKNINFWAKIALSQLIDGAARKTYSGTQVIRGPCFLDA |
| Ga0268310_10518001 | 3300028262 | Phyllosphere | GIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDV |
| Ga0268264_107520591 | 3300028381 | Switchgrass Rhizosphere | SHHMTAQDLQGIRANGLSEKTNFGAKIALSQLIDGAARKTYSGTQVIRGPCFLDV |
| Ga0268264_118493811 | 3300028381 | Switchgrass Rhizosphere | MTILDLQGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTQVIRGPCFLDV |
| Ga0268301_1048411 | 3300028465 | Phyllosphere | TAQDLQGIRANGLSEKMNFGAKIALLQLIDDAARKIYSGTQVIRGPCFLDA |
| Ga0268321_1111812 | 3300028466 | Phyllosphere | LGSAAGSSFSHHMTAQDLQGIRANSLSEKMNFWAKIALSQLIDGTARKTYSGTQVIRGPYFLDA |
| Ga0268317_10100911 | 3300028468 | Phyllosphere | MTAQDLQGIRANGLSEKTNFGAKIALSQQIDGAARKTYSGTLVIRGP |
| Ga0268337_10155111 | 3300028469 | Phyllosphere | MIAQDLRGIRAKGLSEKINFGEKIALSQLIDGAARKTDSGTQVIPGPCFLDA |
| Ga0268323_10199142 | 3300028471 | Phyllosphere | MIAQDLQGIRVNGLREKTNFGAKIALSQQIDGAARKTYLVTQVI |
| Ga0268309_10177521 | 3300028477 | Phyllosphere | QGIRANGLSEKTNFWAKIALSQLIDGAARKTYSGTQVIRGPCFLDV |
| Ga0214488_11146331 | 3300032467 | Switchgrass Phyllosphere | MIAQDLQGIRANGLSEKMNFGAKIAPSQLIDDAACKTY |
| Ga0214490_10981561 | 3300032502 | Switchgrass Phyllosphere | MTTQDLQGIRANGLSEKTNFGAKIALSRQIDGAARKTYSGTQVIRGPSF |
| Ga0214490_10981562 | 3300032502 | Switchgrass Phyllosphere | MTAQDLQGIRANGLSKKMNFGAKIALSQQIDGAARKSYSVTQVIRGPSFLDA |
| ⦗Top⦘ |