Basic Information | |
---|---|
Family ID | F038429 |
Family Type | Metagenome |
Number of Sequences | 166 |
Average Sequence Length | 41 residues |
Representative Sequence | VVEFRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVS |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 166 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.33 % |
% of genes near scaffold ends (potentially truncated) | 77.71 % |
% of genes from short scaffolds (< 2000 bps) | 83.13 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.542 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.494 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.542 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.217 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.94% β-sheet: 11.59% Coil/Unstructured: 72.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 166 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 3.01 |
PF08708 | PriCT_1 | 2.41 |
PF07681 | DoxX | 1.20 |
PF09261 | Alpha-mann_mid | 1.20 |
PF00483 | NTP_transferase | 1.20 |
PF01135 | PCMT | 0.60 |
PF03144 | GTP_EFTU_D2 | 0.60 |
PF01970 | TctA | 0.60 |
PF01381 | HTH_3 | 0.60 |
PF02776 | TPP_enzyme_N | 0.60 |
PF06577 | EipA | 0.60 |
PF13304 | AAA_21 | 0.60 |
PF13560 | HTH_31 | 0.60 |
PF13709 | DUF4159 | 0.60 |
PF01255 | Prenyltransf | 0.60 |
PF02518 | HATPase_c | 0.60 |
PF04326 | AlbA_2 | 0.60 |
PF08241 | Methyltransf_11 | 0.60 |
PF01391 | Collagen | 0.60 |
PF03695 | UPF0149 | 0.60 |
PF07045 | DUF1330 | 0.60 |
PF13701 | DDE_Tnp_1_4 | 0.60 |
PF00486 | Trans_reg_C | 0.60 |
PF13545 | HTH_Crp_2 | 0.60 |
PF01741 | MscL | 0.60 |
PF04430 | DUF498 | 0.60 |
PF03734 | YkuD | 0.60 |
PF00581 | Rhodanese | 0.60 |
PF05239 | PRC | 0.60 |
PF03795 | YCII | 0.60 |
PF00106 | adh_short | 0.60 |
PF00072 | Response_reg | 0.60 |
PF03401 | TctC | 0.60 |
COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.01 |
COG0383 | Alpha-mannosidase | Carbohydrate transport and metabolism [G] | 1.20 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.20 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.20 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.60 |
COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.60 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.60 |
COG3333 | TctA family transporter | General function prediction only [R] | 0.60 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.60 |
COG3079 | Uncharacterized conserved protein YgfB, UPF0149 family | Function unknown [S] | 0.60 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.60 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.60 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.60 |
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG1784 | TctA family transporter | General function prediction only [R] | 0.60 |
COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.60 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.54 % |
Unclassified | root | N/A | 14.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig1234259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 776 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101449217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101462528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 955 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10059989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10074497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
3300000955|JGI1027J12803_103941171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 975 | Open in IMG/M |
3300000956|JGI10216J12902_101584467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300000956|JGI10216J12902_112413217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
3300004281|Ga0066397_10020948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 971 | Open in IMG/M |
3300004479|Ga0062595_100476011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
3300005174|Ga0066680_10314393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1000 | Open in IMG/M |
3300005332|Ga0066388_101196029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1299 | Open in IMG/M |
3300005332|Ga0066388_101632650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1136 | Open in IMG/M |
3300005332|Ga0066388_107627439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
3300005436|Ga0070713_100622431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1027 | Open in IMG/M |
3300005445|Ga0070708_101603273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
3300005467|Ga0070706_100282081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1550 | Open in IMG/M |
3300005555|Ga0066692_10253092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1112 | Open in IMG/M |
3300005713|Ga0066905_101194314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300005713|Ga0066905_101892885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
3300005713|Ga0066905_102216878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
3300005713|Ga0066905_102264644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
3300005764|Ga0066903_101341553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1339 | Open in IMG/M |
3300005764|Ga0066903_103464644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
3300005764|Ga0066903_104172478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
3300005764|Ga0066903_104920986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
3300005764|Ga0066903_105522342 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300005764|Ga0066903_107008639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
3300005764|Ga0066903_107388169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
3300005764|Ga0066903_107749618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
3300005764|Ga0066903_109167656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
3300006028|Ga0070717_10474837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1129 | Open in IMG/M |
3300006028|Ga0070717_11163480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
3300006032|Ga0066696_10917499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
3300006163|Ga0070715_10900271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300006175|Ga0070712_101674534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
3300006847|Ga0075431_102010857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
3300007076|Ga0075435_102046617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
3300009100|Ga0075418_11179886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 830 | Open in IMG/M |
3300009792|Ga0126374_10609637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300010046|Ga0126384_10256882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1415 | Open in IMG/M |
3300010046|Ga0126384_10608235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
3300010047|Ga0126382_10457311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1014 | Open in IMG/M |
3300010047|Ga0126382_10816903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
3300010047|Ga0126382_10925081 | Not Available | 757 | Open in IMG/M |
3300010047|Ga0126382_11145459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
3300010321|Ga0134067_10124760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
3300010360|Ga0126372_10023083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S8 | 3722 | Open in IMG/M |
3300010360|Ga0126372_10028226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3464 | Open in IMG/M |
3300010361|Ga0126378_11591617 | Not Available | 742 | Open in IMG/M |
3300010361|Ga0126378_13322803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
3300010362|Ga0126377_10024266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5035 | Open in IMG/M |
3300010376|Ga0126381_103001655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
3300010398|Ga0126383_11388267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
3300010398|Ga0126383_12828523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
3300010398|Ga0126383_12875449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
3300010398|Ga0126383_13376638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 521 | Open in IMG/M |
3300012199|Ga0137383_10089177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2233 | Open in IMG/M |
3300012199|Ga0137383_10819500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
3300012201|Ga0137365_10024249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4694 | Open in IMG/M |
3300012201|Ga0137365_11079509 | Not Available | 579 | Open in IMG/M |
3300012202|Ga0137363_10758753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
3300012211|Ga0137377_11095099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 727 | Open in IMG/M |
3300012211|Ga0137377_11440271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
3300012211|Ga0137377_11469907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
3300012354|Ga0137366_11070724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
3300012355|Ga0137369_10903532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300012356|Ga0137371_10309378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
3300012356|Ga0137371_10642486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 813 | Open in IMG/M |
3300012361|Ga0137360_10458240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
3300012929|Ga0137404_10810654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
3300012948|Ga0126375_10507867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
3300012948|Ga0126375_11788773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
3300012948|Ga0126375_12045219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
3300012961|Ga0164302_11793794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
3300012971|Ga0126369_10820180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1013 | Open in IMG/M |
3300012971|Ga0126369_11273925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
3300012971|Ga0126369_13232264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300012984|Ga0164309_10177813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1443 | Open in IMG/M |
3300012988|Ga0164306_10074927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2134 | Open in IMG/M |
3300016294|Ga0182041_10935290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
3300016294|Ga0182041_11493433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
3300016319|Ga0182033_11290523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
3300016341|Ga0182035_10091071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2207 | Open in IMG/M |
3300016341|Ga0182035_10335574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1251 | Open in IMG/M |
3300016341|Ga0182035_10492699 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300016357|Ga0182032_10966731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
3300016357|Ga0182032_11272170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
3300016371|Ga0182034_10207311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1520 | Open in IMG/M |
3300016371|Ga0182034_10594767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
3300016387|Ga0182040_10195522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1482 | Open in IMG/M |
3300016445|Ga0182038_10459820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1079 | Open in IMG/M |
3300016445|Ga0182038_11714023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
3300018073|Ga0184624_10486174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
3300018469|Ga0190270_11145048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
3300020580|Ga0210403_11340688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
3300021560|Ga0126371_10900723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
3300025910|Ga0207684_10270366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1466 | Open in IMG/M |
3300025915|Ga0207693_10646041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
3300025916|Ga0207663_11630418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
3300026277|Ga0209350_1109698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
3300026325|Ga0209152_10419726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
3300026538|Ga0209056_10318307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1055 | Open in IMG/M |
3300026551|Ga0209648_10493874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
3300027161|Ga0208368_105662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti | 662 | Open in IMG/M |
3300027874|Ga0209465_10046081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2080 | Open in IMG/M |
3300027909|Ga0209382_12203321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
3300031572|Ga0318515_10161730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1195 | Open in IMG/M |
3300031572|Ga0318515_10221026 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300031573|Ga0310915_10128947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1733 | Open in IMG/M |
3300031573|Ga0310915_11089073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
3300031679|Ga0318561_10297143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
3300031681|Ga0318572_10166419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1278 | Open in IMG/M |
3300031713|Ga0318496_10651085 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300031720|Ga0307469_11350321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
3300031723|Ga0318493_10357446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
3300031724|Ga0318500_10042556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1890 | Open in IMG/M |
3300031736|Ga0318501_10639823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 585 | Open in IMG/M |
3300031763|Ga0318537_10395611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300031771|Ga0318546_11318629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
3300031777|Ga0318543_10563731 | Not Available | 510 | Open in IMG/M |
3300031780|Ga0318508_1231657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
3300031781|Ga0318547_10873540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
3300031793|Ga0318548_10424434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
3300031795|Ga0318557_10452169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
3300031819|Ga0318568_10764841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
3300031821|Ga0318567_10231596 | Not Available | 1035 | Open in IMG/M |
3300031880|Ga0318544_10008541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S8 | 3161 | Open in IMG/M |
3300031890|Ga0306925_10736398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
3300031894|Ga0318522_10063891 | Not Available | 1321 | Open in IMG/M |
3300031896|Ga0318551_10347314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
3300031897|Ga0318520_10273292 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300031910|Ga0306923_11425310 | Not Available | 728 | Open in IMG/M |
3300031946|Ga0310910_10050037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2940 | Open in IMG/M |
3300031946|Ga0310910_10261955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1354 | Open in IMG/M |
3300031947|Ga0310909_10262145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1445 | Open in IMG/M |
3300031947|Ga0310909_10769241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
3300032001|Ga0306922_10111099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2907 | Open in IMG/M |
3300032001|Ga0306922_11397688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
3300032025|Ga0318507_10335139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
3300032054|Ga0318570_10309886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
3300032059|Ga0318533_10769090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
3300032066|Ga0318514_10784473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
3300032076|Ga0306924_12403183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium manausense | 531 | Open in IMG/M |
3300032090|Ga0318518_10457211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
3300032180|Ga0307471_102839691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300032261|Ga0306920_100029805 | All Organisms → cellular organisms → Bacteria | 7769 | Open in IMG/M |
3300033289|Ga0310914_11130765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
3300033290|Ga0318519_10272454 | Not Available | 985 | Open in IMG/M |
3300033290|Ga0318519_10387654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 830 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.45% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.23% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.41% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.41% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.20% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.20% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_02601450 | 2124908045 | Soil | MMARTSYIVEFRTAEGEALAISIPGSEAAVIRHFQERMPYGLFVPDVP |
INPhiseqgaiiFebDRAFT_1014492172 | 3300000364 | Soil | VIEFMTTEGNVLAISIPRTEAHVIRHFQERMPYGLFVPDLALE* |
INPhiseqgaiiFebDRAFT_1014625282 | 3300000364 | Soil | VVEFRTAAGEALAISIPRTETAMVKHFQERMPYGLFVPDLV* |
AF_2010_repII_A1DRAFT_100599892 | 3300000597 | Forest Soil | RTAAGEALAISIPRSEASVVRYFQERTPYGLFVPEVT* |
AF_2010_repII_A001DRAFT_100744973 | 3300000793 | Forest Soil | AAGEALAISIPASETGVIRHFQERMPYGLFVPDTP* |
JGI1027J12803_1039411713 | 3300000955 | Soil | TYIVEFKTAADEALAISIPEAAVIQHFQERMPYGLFVPDVSDSR* |
JGI10216J12902_1015844671 | 3300000956 | Soil | DGTYVVEFRTAGETLAISIPRTEAAVTRHFQERMPYGLFVPDVDAGAI* |
JGI10216J12902_1124132173 | 3300000956 | Soil | MTCPAPFYLVEFRTAAGESLAISIPRTEAAVIRHFQERMPYGLFVPDVP* |
Ga0066397_100209482 | 3300004281 | Tropical Forest Soil | MEFKAAAGEALAISIPRAEAPVIRYLHARMLHGLVVPDVP* |
Ga0062595_1004760113 | 3300004479 | Soil | GTYVIEFRTAAGESLAISIPGTEAAVIRHFQERMPYGLFVPDVDSGVE* |
Ga0066680_103143931 | 3300005174 | Soil | KNDGTYIVEFRTAEGKTLAISIPRTETAVIRHFQERMPYGLFVPDVP* |
Ga0066388_1011960292 | 3300005332 | Tropical Forest Soil | VVEFKTAEGETLAISIPRTETGVIQHFQERISYGLFMPEH* |
Ga0066388_1016326503 | 3300005332 | Tropical Forest Soil | YIVEFRTAAGEALAISIPGGEARVIRHFQERMPYGLFVPDVP* |
Ga0066388_1076274391 | 3300005332 | Tropical Forest Soil | DGTYVVEFRTAAGEALAISIPATETRVIRHFQDRMRYGLFVSDVP* |
Ga0070713_1006224313 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MATYVIEFKTAAGEVLAISIPRTETAVIRHFQERMPYGLFVPDIP* |
Ga0070708_1016032731 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RTSVGESLAISIRRTEAAVIRHFQERMPYGLYVPDVHESG* |
Ga0070706_1002820811 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LSNLAMADGEALAISIPIIETAVIRHFQGRMPYGLFVPDVNAI* |
Ga0066692_102530921 | 3300005555 | Soil | YIVEFRTAEGKTLAISIPRTETAVIRHFQERMPYGLFVPDAP* |
Ga0066704_105723283 | 3300005557 | Soil | QEPDHDFRPEEDGTYVVEFKTAAGEALAISIPRTECAVTGLFVPDVEAT* |
Ga0066905_1011943141 | 3300005713 | Tropical Forest Soil | KAAAGEALAISIPRTEAPMIRYFRARMPYGLVVPDVP* |
Ga0066905_1018928851 | 3300005713 | Tropical Forest Soil | MVEFRTAAGEALAISIPRNEAAVIRHFQERMPYGLFVPEVE* |
Ga0066905_1022168781 | 3300005713 | Tropical Forest Soil | KDDGTYIVAAAGEALAISIPRNEASVIRHFQERMPYGLFVPDVP* |
Ga0066905_1022646442 | 3300005713 | Tropical Forest Soil | YIVEFRTAAGEALAISITRSEASVVRYFQERMPYGLFVPDIP* |
Ga0066903_1013415533 | 3300005764 | Tropical Forest Soil | FRTAAGEALAISIPRTEASVVRHFQERMPYGLFVPDVP* |
Ga0066903_1034646441 | 3300005764 | Tropical Forest Soil | GEALAISIPRGETAVIRHFQERMPYGLFVPEVLSE* |
Ga0066903_1041724781 | 3300005764 | Tropical Forest Soil | VVEFRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVS* |
Ga0066903_1049209862 | 3300005764 | Tropical Forest Soil | MEFKAAAGEALAISIPRTEAPVIRYFQARMPYGLVVPDVL* |
Ga0066903_1055223422 | 3300005764 | Tropical Forest Soil | DGTYVVEFRTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDVEAGAI* |
Ga0066903_1070086391 | 3300005764 | Tropical Forest Soil | TARKTTGHVVEFRTGAGEALAISIPRSEASVIRHFQERMPYGLFVPDVP* |
Ga0066903_1073881692 | 3300005764 | Tropical Forest Soil | TAAGEALAISIPRTEAAVIRYFQERMPYGLFVPDAEPQ* |
Ga0066903_1077496182 | 3300005764 | Tropical Forest Soil | LQAPTAAGEALAISIPRAEAPVIRYFQARMPYGLVVPDVP* |
Ga0066903_1091676562 | 3300005764 | Tropical Forest Soil | GTYVVEFRTAAGEALAISIPRNEAGVIRHFQERMPYGLFVPDVP* |
Ga0070717_104748373 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DGTYVIEFWRTAGEALAISVPRNEAAVLKHFQERMPYGLFVPDVP* |
Ga0070717_111634802 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AGQALAISIPSTETEVIRHFQERMPHGLFVPEVP* |
Ga0066696_109174991 | 3300006032 | Soil | EGESLAITIPRTEAAVIKHFQARMPYGPILPDGPLEVGD* |
Ga0070715_109002712 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VEFKTADGEELAISVPRNETAVLKHFQERIPYGLFVPDAPGNL* |
Ga0070712_1016745343 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AGEALAISISRTETAVIRHFQERMPYGLFVLDVP* |
Ga0075431_1020108572 | 3300006847 | Populus Rhizosphere | IVEFRTAAGEALAISIPNSETAVLKHFQERMPYGLFVPDVDQP* |
Ga0075435_1020466171 | 3300007076 | Populus Rhizosphere | VEFRTADGEALAISIPRSEAHVIRHFQERMPYGLFVPEVPTS* |
Ga0075418_111798861 | 3300009100 | Populus Rhizosphere | GTHVVEFMTSKGDALSISIPRNETAVIKHFQERMRYGLFVPDVTAF* |
Ga0126374_106096372 | 3300009792 | Tropical Forest Soil | MEFKAAAGEALAISIPRAEAPVIRYLQTRMPHGLVVPDVP* |
Ga0126384_102568821 | 3300010046 | Tropical Forest Soil | RTAQGAVLAISIPRTEAAVIRHFQERMPYGLFVPDTEPQ* |
Ga0126384_106082351 | 3300010046 | Tropical Forest Soil | MAIVEFKTAAGEALAISIPRAEASVIRHFQEVMPYGLFVPDVP* |
Ga0126382_104573111 | 3300010047 | Tropical Forest Soil | DDGTYVVEFKTAADEVLAISAPGGEARVIRHFQERVPYGLFVPEVA* |
Ga0126382_108169032 | 3300010047 | Tropical Forest Soil | DGTYVVEFRTESAVLAISIPRTEAAVVRHFQERMPYGLFVPDVP* |
Ga0126382_109250811 | 3300010047 | Tropical Forest Soil | VNTRIVEFKTANGALAISIPRTECAVIRHFQERMPHGLVVQDVS* |
Ga0126382_111454591 | 3300010047 | Tropical Forest Soil | TYVVEFRTAAGEALAISIPRTEDGVIRHFQERMPYGLFVPDVP* |
Ga0126382_114709482 | 3300010047 | Tropical Forest Soil | MANETPAISIPRTEAAVVRHFKERMPYGLFVPDVN |
Ga0134067_101247603 | 3300010321 | Grasslands Soil | EGEALAISIPRTEAAVIRHFQSKMPYGLVVPDVKPDTDR* |
Ga0126372_100230831 | 3300010360 | Tropical Forest Soil | RTAEGESLAISIPRTETAVIRHFQERMPHGLLFVPDVL* |
Ga0126372_100282265 | 3300010360 | Tropical Forest Soil | AGKALAISIPRTETAVIRHFQERMPYGLFVPEVPSE* |
Ga0126378_115916171 | 3300010361 | Tropical Forest Soil | AGEALAISIPRTEAGVIRHFQERMPYGLFVPDVP* |
Ga0126378_124440342 | 3300010361 | Tropical Forest Soil | PDDTYVIEFKTADGQTLAISMPRGEWVVLKHFQERMPYGLFVPDIQ* |
Ga0126378_133228031 | 3300010361 | Tropical Forest Soil | AAGEALAISIPGSDAGVIRHFQERMPYGLFVPDVS* |
Ga0126377_100242661 | 3300010362 | Tropical Forest Soil | TAAGKALAISIPRTETAVIRHFQERMPYGLFVPEVPSE* |
Ga0126381_1030016552 | 3300010376 | Tropical Forest Soil | AGEALAISIPRTEASVVRYFQERMPYGLFVPDVA* |
Ga0126383_113882671 | 3300010398 | Tropical Forest Soil | DGTYVVEFRTAAGEALAISIPRTETAVIRYFQERMPYGLFVADVTDATA* |
Ga0126383_128285231 | 3300010398 | Tropical Forest Soil | ISIPRTEAAVIRHFQERMPYGLFVPDEPNLGETQ* |
Ga0126383_128754492 | 3300010398 | Tropical Forest Soil | VEFKTAAGATLAISIPRTEADVVRHFQERMPYGLFVPDMNAI* |
Ga0126383_133766382 | 3300010398 | Tropical Forest Soil | EFRTAAGEALAISIPRSEASVIRHFQERMPYGLFVPDVP* |
Ga0137383_100891773 | 3300012199 | Vadose Zone Soil | VVEFRTAEGDALAISIPRTEAHVIWHFQEWMPYGVLVLDVNAVE* |
Ga0137383_108195001 | 3300012199 | Vadose Zone Soil | GEALAISIPRGETAVIRHFQERMPYGLFVPDVSVG* |
Ga0137365_100242491 | 3300012201 | Vadose Zone Soil | VVDRTAAGEALAILIPRVECAVIRHFQERMPYGLFVPDVP* |
Ga0137365_110795092 | 3300012201 | Vadose Zone Soil | RAWALAISIPRSEAAVIRHFQERVPYGLVVPEAP* |
Ga0137363_107587531 | 3300012202 | Vadose Zone Soil | AGEALAISIPRSEGGGDPAHFQERMPYGLFVPDVPS* |
Ga0137399_103408222 | 3300012203 | Vadose Zone Soil | AEGDALAISIPRTEAAVIRHFQAKMPYELVVPDVKAD* |
Ga0137379_105538341 | 3300012209 | Vadose Zone Soil | MKPAAGEALAISIPRNEAGVIRHFQERMPYGLFVPDVP* |
Ga0137377_110950993 | 3300012211 | Vadose Zone Soil | FRTADGDVLTISIPGTEAAVIRHFQERMPYGLFVPDADVFGS* |
Ga0137377_114402712 | 3300012211 | Vadose Zone Soil | MTSEGDVLAISIPRTEVHVIRHFQERMPYSLFVPDVPMSL* |
Ga0137377_114699073 | 3300012211 | Vadose Zone Soil | MKPAAGEALAISIPRNEAGVIRHFQERMPYGLFVP |
Ga0137366_110707241 | 3300012354 | Vadose Zone Soil | FRTAAGEPLAISIPGTEAAVIRHFQERMPYGLFVPDVDSGVE* |
Ga0137369_109035321 | 3300012355 | Vadose Zone Soil | PKNDGTYVVECITATGEVLAISIPRSEVHVIRYFQERMPYGLFVPDDVT* |
Ga0137369_110727721 | 3300012355 | Vadose Zone Soil | DGESLAISVPGSEGAVIRYFQERMPYGLFVPDAA* |
Ga0137371_103093783 | 3300012356 | Vadose Zone Soil | LVEFRTAAGESLAISIPRTEAAVIRHFKERMPYGLFVPDVNAG* |
Ga0137371_106424862 | 3300012356 | Vadose Zone Soil | GGEALAISIPRTEAAVIRHFQERMPYGLFVPDVNAI* |
Ga0137360_104582401 | 3300012361 | Vadose Zone Soil | FRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVDTSK* |
Ga0137390_101829181 | 3300012363 | Vadose Zone Soil | WQLRFEFRTSVGESLAISIRRTEAAVIHHFQERMPYGLYVPNVHESG* |
Ga0137404_108106542 | 3300012929 | Vadose Zone Soil | VIEFRTAAGESLAISIPGTEAAVIRHFQERMPYGLFVPDVDSGVE* |
Ga0126375_105078671 | 3300012948 | Tropical Forest Soil | AAGATLAISIPRTEADVVRHFQERMPYGLFVPDIP* |
Ga0126375_117887732 | 3300012948 | Tropical Forest Soil | YVVEFRTAAGEALAISIPGGEARVIRYFQERMPYGLFVPDVL* |
Ga0126375_120452192 | 3300012948 | Tropical Forest Soil | PKSDGTYVEFRTAAGEALAISVPRNEAAVIRHFQERMPYGLFVPDVP* |
Ga0164302_117937941 | 3300012961 | Soil | RTAAGEALAISIPGTEAAVIRHFQARMPYGLVVPDAD* |
Ga0126369_102721141 | 3300012971 | Tropical Forest Soil | MANETPAISIPRTEAAVVRHFKERMPYGLFVPDVNAI* |
Ga0126369_108201801 | 3300012971 | Tropical Forest Soil | IVEFKTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVP* |
Ga0126369_112739251 | 3300012971 | Tropical Forest Soil | AGEALAISIPRTETAVIRHFQERMPYGLFVPEVP* |
Ga0126369_132322641 | 3300012971 | Tropical Forest Soil | TYVVEFRTSDGETLAISIPRTECAVVRHFQERMPYGLFVPDVDPQ* |
Ga0164309_101778131 | 3300012984 | Soil | AGDALAISIPRSEVSVIRHFQERMPYGLFVPEVET* |
Ga0164306_100749273 | 3300012988 | Soil | AEGDVLAISTPRSEAAMLRHFQERMPYGLCVPDVAM* |
Ga0182041_109352901 | 3300016294 | Soil | YIVEFRTAAGEALAISIPRTEAAVVRHFQERMPYGLFVPDVP |
Ga0182041_114934332 | 3300016294 | Soil | FRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIS |
Ga0182033_112905231 | 3300016319 | Soil | FRTAAGEALAISIPRTEAAVARHFQERMPYGLFVPDVP |
Ga0182035_100910711 | 3300016341 | Soil | RTAEGAVLAISIPRSEAALIQHFQERMPYGLFVPDVNSGA |
Ga0182035_101154905 | 3300016341 | Soil | GEALAISIPRTEAAVIRHFQERMPYGLFVPDAEPR |
Ga0182035_103355741 | 3300016341 | Soil | PKDDGTYIVEFRTAAGEALAISIPRSEASVIRHFQERMPYGLFVPDVP |
Ga0182035_104926992 | 3300016341 | Soil | DDGTYVVEFRTAASAVLAISIPRTETAVIRYFQERMPYGLFVPDAP |
Ga0182032_109667312 | 3300016357 | Soil | TYIVEFRTAAGEALAISIPRTEAAVVRHFQERMPYGLFVPDVP |
Ga0182032_112721701 | 3300016357 | Soil | DDGTYIVEFRTAAGEALAISIPRTEAAVARHFQERMPYGLFVPDVP |
Ga0182034_102073111 | 3300016371 | Soil | KTDGTYVVEFRTAEGEALAISIPRTETAVIRHFQERMPYGLFVPDMNAI |
Ga0182034_105947672 | 3300016371 | Soil | YVIEFKAAAGEALAILIPRTETAVVRHFQERMPYGLFVPDIP |
Ga0182040_101955224 | 3300016387 | Soil | TAEGEALAISIPRTETAVIRHFQERMPYGLFVPDMNAI |
Ga0182038_104598201 | 3300016445 | Soil | KTDGTYVVEFRTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDEP |
Ga0182038_117140232 | 3300016445 | Soil | RTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIS |
Ga0184624_104861741 | 3300018073 | Groundwater Sediment | LGLLLLAAGEALAISIPRTEAAVIRYFQERMPYGLFVPEVL |
Ga0190270_111450482 | 3300018469 | Soil | DGTFVIEFMTSAGEALAISIPASEARVARHFQERIPYGLFVPDVSMD |
Ga0210403_113406882 | 3300020580 | Soil | MASDGTYIVEFRTAAGEALAISIPRTEATVIRHFQARMPYGLVVRDIDNR |
Ga0126371_109007232 | 3300021560 | Tropical Forest Soil | YIVEFRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIP |
Ga0207684_101486581 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GEALAISIPIIETAVIRHFQGRMPYGLFVPDVNAI |
Ga0207684_102703663 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MATYVIEFKTAAGEVLAISIPRTETAVIRHFQERMPYGLFVPDIP |
Ga0207693_106460411 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGKNRIVVQFRTAEGDMLAISIPRSETAVIRHFQERMPYGLFVPDVQP |
Ga0207663_116304182 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RTAAGEALAISIPRTECAVIRHFQERMPYGLFVPDLNKP |
Ga0207646_111124531 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TDDTYVIEFRTAAGEALAISVPRNETAVLKHFQERMPYELFVPDVP |
Ga0209350_11096982 | 3300026277 | Grasslands Soil | IEFRTAAGESLAISIPGTEAAVIRHFQERMPYGLFVPDVDSGVE |
Ga0209152_104197262 | 3300026325 | Soil | ETYVVEFRTAAGEALAISIPIIETAVIRHFQGRMPYGLFVPVNAI |
Ga0209056_103183071 | 3300026538 | Soil | ETYVVEFRTAAGEALAISIPIIETAVIRHFQGRMPYGLFVPDVNAI |
Ga0209648_104938742 | 3300026551 | Grasslands Soil | YVVEFRTAAGEVLAISIPRGETAVLKHFQERMPYGLFVPDVNPDADP |
Ga0208368_1056622 | 3300027161 | Forest Soil | RTAAGEALAISIPGGEARVIRHFQERMPYGLFVPDVP |
Ga0209465_100460812 | 3300027874 | Tropical Forest Soil | MEFKAAAGEALAISIPRAEAPVIRYLHARMLHGLVVPDVP |
Ga0209465_105161152 | 3300027874 | Tropical Forest Soil | MGVALAISIPRTEAAVIRHFQERMPYGLFVPDARLV |
Ga0209382_122033212 | 3300027909 | Populus Rhizosphere | PTADGEELAISAPRNETAVLKHFQERIPYGLFVPDAPGNL |
Ga0318515_101617301 | 3300031572 | Soil | SRTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDVT |
Ga0318515_102210262 | 3300031572 | Soil | FRTAASAVLAISIPRTETAVIRYFQERMPYGLFVPDAP |
Ga0310915_101289471 | 3300031573 | Soil | TAAGEALAISIPRSEASVIRHFQERMPYGLSVPDVP |
Ga0310915_110890732 | 3300031573 | Soil | KDDGAYIVEFRTAAGEALAISIPRSEAVVRYFQERMPYGLFVPDIS |
Ga0318561_102971432 | 3300031679 | Soil | TYVVEFRTAAGEALAISLPASETRVIRHFQERMPSGLFVPDTP |
Ga0318561_104472092 | 3300031679 | Soil | PKTDGTYVVEFRTAEGEALAISIPRTETAVIRHFQERMPYGLFVPDMNAI |
Ga0318561_108091971 | 3300031679 | Soil | MGAALAISIPRTEAAAIRHFRERMPYGLFVPDARLV |
Ga0318572_101664194 | 3300031681 | Soil | TYVVEFRTAAGEALAISIPRTEAAVIRHFHERMPYGLFVPDVNGV |
Ga0318496_106510852 | 3300031713 | Soil | YVVEFRTAAGEALAISIPRTETAVIRHFQERMQYGLFVPDAP |
Ga0307469_113503211 | 3300031720 | Hardwood Forest Soil | EFRTAAGEALAISIPRTECAVIRHFQERMPYGLFVPDLNKP |
Ga0318493_103574461 | 3300031723 | Soil | TYVVEFRTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDEP |
Ga0318500_100425565 | 3300031724 | Soil | EFRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIS |
Ga0318501_106398232 | 3300031736 | Soil | RTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDAEPR |
Ga0318537_103956111 | 3300031763 | Soil | FKTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVNAI |
Ga0318546_113186291 | 3300031771 | Soil | RASDGESLAISIPRTECAVIRHFQDRMPYGLVVPDLP |
Ga0318543_105637311 | 3300031777 | Soil | VIEFRTAGGDSLAISIPRTEAAVIRHFQTWMPYGLVVPDVDAAK |
Ga0318508_12316572 | 3300031780 | Soil | MTYVVEFRTAAGEALAISLPASETRVIRHFQERMPSGLFVPD |
Ga0318547_108735402 | 3300031781 | Soil | GTYIVEFRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDAEPR |
Ga0318548_104244342 | 3300031793 | Soil | IVEVRTAAGEALAISIPRSEASVIRHFQERMPYGLFVPDIS |
Ga0318557_104521691 | 3300031795 | Soil | AAGEALAISIPRTETAVIRHFQERMPYGLFVPDEP |
Ga0318568_107648411 | 3300031819 | Soil | TDGTYVVEFRTAAGAELAISIPRSEAAVIQHFQERMPYGLFVPDEP |
Ga0318567_102315963 | 3300031821 | Soil | IVEFRTAAGEALAITIPRTECAVIRHFQERMPYGLFVPDVP |
Ga0306919_100950223 | 3300031879 | Soil | MGVALAISIPRTEAAAIRHFRERMPYGLFVPDARLV |
Ga0318544_100085411 | 3300031880 | Soil | AEGESLAISIPRTETAVIRHFQERMPHGLFVPDVL |
Ga0306925_107363981 | 3300031890 | Soil | KDDGTYIVEFRTAAGEALAISIPRTEAAVVRHFQERMPYGLFVPDVP |
Ga0318522_100638912 | 3300031894 | Soil | FRTALGESLAISIPGNEAGVIRHFQERMPYGLFVPDVP |
Ga0318551_103473141 | 3300031896 | Soil | TYVVEFRTAAGESLAISLPASETRVIRHFQERMPSGLFVPDTP |
Ga0318520_102732921 | 3300031897 | Soil | GTYVVEFRTAEGEVLAISIPTTETAVIRHFQERMPYGLSVPDEP |
Ga0306923_114253102 | 3300031910 | Soil | LAFGAATYVIEFKTVAGEALAISIPRTEAAVIRHFQARMPYSLIVPDAD |
Ga0310910_100500375 | 3300031946 | Soil | MEFKAAAGEALAISIPRAEAPVIRYLQARMPHGLVVPDVP |
Ga0310910_102619551 | 3300031946 | Soil | TYIVEFRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIP |
Ga0310909_102621453 | 3300031947 | Soil | TNGTYVVEFRTAQGAVLAISIPRTEAAVIRHFQERMPYGLFVPDEP |
Ga0310909_107692413 | 3300031947 | Soil | TPPVPVGEALAISIPRTEAAVIKYFQERMPHGLVVPDG |
Ga0310909_112503632 | 3300031947 | Soil | MGVALAISIPRTEAAVIRHFQERMPYGLFVPDARL |
Ga0306922_101110991 | 3300032001 | Soil | TYIVEFRTADGEALAISIPGGEARVIRHFQERMPYGLFVPDVP |
Ga0306922_113976881 | 3300032001 | Soil | TYIVEFRTAEGEVLAISIPRTETAVIRHFQKRMPYGLFVPDEPRRTA |
Ga0318507_103351391 | 3300032025 | Soil | GTYVVEFRTAAGEALAISIPRTEAAVIRHFHERMPYGLFVPDVNGV |
Ga0318570_103098862 | 3300032054 | Soil | TAAGEALAISIPRTETAVIRHFQERMPYGLFVPDEP |
Ga0318533_107690902 | 3300032059 | Soil | TAAGEALAISIPRTEAAVARHFQERMPYGLFVPDVP |
Ga0318514_107844731 | 3300032066 | Soil | VEFKTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDVDAGAFGKK |
Ga0306924_124031831 | 3300032076 | Soil | TSEGDVLAISIPRTETAVIRHFQERMPYGLFVPDNAI |
Ga0318518_104572111 | 3300032090 | Soil | YVVEFRTAAGEALAISIPRTEAAVIRHFHERMPYGLFVPDVNGV |
Ga0307471_1028396911 | 3300032180 | Hardwood Forest Soil | VDFRTAEGEALAISIPRTEAAVIRHFQSKMPYGLVVPDVKPDTDR |
Ga0306920_10002980513 | 3300032261 | Soil | MTYVVEFRTAAGEALAISLPASETRVIRHFQERMPSGLFVPDTP |
Ga0310914_111307652 | 3300033289 | Soil | DDGAYIVEFRTAAGEALAISIPRSEAVVRYFQERMPYGLFVPDIS |
Ga0318519_102724541 | 3300033290 | Soil | VEFRTAQGAVLAISIPRTEAAVIRHFQERMPYGLFVPDEP |
Ga0318519_103876542 | 3300033290 | Soil | FRTAAGKALAITIPRTECAVIRHFQERMPYGLFVPDVP |
⦗Top⦘ |