| Basic Information | |
|---|---|
| Family ID | F038403 |
| Family Type | Metagenome |
| Number of Sequences | 166 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MPETRGVQATEEVKAEWSLAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLT |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.40 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.77 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (7.229 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.193 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.265 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.50% β-sheet: 0.00% Coil/Unstructured: 57.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF09335 | SNARE_assoc | 45.78 |
| PF02082 | Rrf2 | 1.81 |
| PF07883 | Cupin_2 | 0.60 |
| PF02012 | BNR | 0.60 |
| PF14437 | MafB19-deam | 0.60 |
| PF01757 | Acyl_transf_3 | 0.60 |
| PF00140 | Sigma70_r1_2 | 0.60 |
| PF00924 | MS_channel | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 45.78 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 45.78 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 45.78 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 1.81 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 1.81 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 1.81 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 1.81 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.81 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.81 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 1.81 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 1.81 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.60 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459018|G1P06HT01B3O33 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300000531|CNBas_1004912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300000559|F14TC_100456684 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300000956|JGI10216J12902_117831816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300001867|JGI12627J18819_10367129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300002568|C688J35102_120903679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2168 | Open in IMG/M |
| 3300003267|soilL1_10133368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1090 | Open in IMG/M |
| 3300003324|soilH2_10140294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2194 | Open in IMG/M |
| 3300004081|Ga0063454_100589395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 809 | Open in IMG/M |
| 3300004114|Ga0062593_101623436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300004114|Ga0062593_102070262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300004157|Ga0062590_101249031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300004463|Ga0063356_102030983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 871 | Open in IMG/M |
| 3300004480|Ga0062592_100152660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1549 | Open in IMG/M |
| 3300004643|Ga0062591_100839391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 853 | Open in IMG/M |
| 3300004643|Ga0062591_101977929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300005290|Ga0065712_10624798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005293|Ga0065715_11137736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300005294|Ga0065705_10011392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3678 | Open in IMG/M |
| 3300005330|Ga0070690_100417295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 989 | Open in IMG/M |
| 3300005331|Ga0070670_100169553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1893 | Open in IMG/M |
| 3300005338|Ga0068868_101228337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300005339|Ga0070660_101085578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300005344|Ga0070661_101948768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005365|Ga0070688_100603404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 840 | Open in IMG/M |
| 3300005367|Ga0070667_100334683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1368 | Open in IMG/M |
| 3300005444|Ga0070694_101116023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300005445|Ga0070708_100583754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300005458|Ga0070681_11411783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300005466|Ga0070685_10708848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300005467|Ga0070706_101453428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300005471|Ga0070698_101298418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300005530|Ga0070679_101785698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300005545|Ga0070695_100203147 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300005546|Ga0070696_100709172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300005546|Ga0070696_101518146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300005548|Ga0070665_102217123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300005549|Ga0070704_100299237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1340 | Open in IMG/M |
| 3300005549|Ga0070704_100485477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1070 | Open in IMG/M |
| 3300005549|Ga0070704_101037559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300005564|Ga0070664_100448071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1185 | Open in IMG/M |
| 3300005615|Ga0070702_101583371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300005616|Ga0068852_101111249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 811 | Open in IMG/M |
| 3300005618|Ga0068864_101959162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300005840|Ga0068870_10831221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300005844|Ga0068862_102391964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300006169|Ga0082029_1044813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1825 | Open in IMG/M |
| 3300006169|Ga0082029_1099401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1279 | Open in IMG/M |
| 3300006169|Ga0082029_1325337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300006173|Ga0070716_100351243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1044 | Open in IMG/M |
| 3300006237|Ga0097621_100827401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 859 | Open in IMG/M |
| 3300006237|Ga0097621_102123112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300006358|Ga0068871_100407387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1212 | Open in IMG/M |
| 3300006755|Ga0079222_10263843 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300006806|Ga0079220_12065008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300006845|Ga0075421_102310036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300006846|Ga0075430_101545708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300006852|Ga0075433_11026202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 718 | Open in IMG/M |
| 3300006853|Ga0075420_101651181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300006876|Ga0079217_11415683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300006880|Ga0075429_100909576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 770 | Open in IMG/M |
| 3300006969|Ga0075419_10494267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 849 | Open in IMG/M |
| 3300007004|Ga0079218_10910374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 865 | Open in IMG/M |
| 3300009011|Ga0105251_10365310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300009094|Ga0111539_11219452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 874 | Open in IMG/M |
| 3300009098|Ga0105245_11159995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 820 | Open in IMG/M |
| 3300009100|Ga0075418_11236699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 809 | Open in IMG/M |
| 3300009101|Ga0105247_10879615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300009147|Ga0114129_13058440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300009147|Ga0114129_13315430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300009148|Ga0105243_10487048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1165 | Open in IMG/M |
| 3300009148|Ga0105243_11575842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300009148|Ga0105243_12514664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300009148|Ga0105243_13125146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300009162|Ga0075423_10576032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1186 | Open in IMG/M |
| 3300009162|Ga0075423_12627851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300009177|Ga0105248_11623128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 733 | Open in IMG/M |
| 3300009545|Ga0105237_10626438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1083 | Open in IMG/M |
| 3300009553|Ga0105249_10118679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2511 | Open in IMG/M |
| 3300009553|Ga0105249_11158959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 844 | Open in IMG/M |
| 3300009553|Ga0105249_12079068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300009553|Ga0105249_13314561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300009840|Ga0126313_10328955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1200 | Open in IMG/M |
| 3300010036|Ga0126305_10594837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 743 | Open in IMG/M |
| 3300010036|Ga0126305_10971587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300010039|Ga0126309_10298532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 930 | Open in IMG/M |
| 3300010040|Ga0126308_11189677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300010042|Ga0126314_10517068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 867 | Open in IMG/M |
| 3300010045|Ga0126311_10041250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2914 | Open in IMG/M |
| 3300010166|Ga0126306_10091270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2185 | Open in IMG/M |
| 3300010359|Ga0126376_10433921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300010359|Ga0126376_12003505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300010360|Ga0126372_10445182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300010373|Ga0134128_10526856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
| 3300010375|Ga0105239_12417217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300010399|Ga0134127_10348698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1445 | Open in IMG/M |
| 3300010399|Ga0134127_12506641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300010399|Ga0134127_13168973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300010400|Ga0134122_11329832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 728 | Open in IMG/M |
| 3300010401|Ga0134121_10054663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3280 | Open in IMG/M |
| 3300010401|Ga0134121_10268266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1500 | Open in IMG/M |
| 3300010401|Ga0134121_10454583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1170 | Open in IMG/M |
| 3300011270|Ga0137391_11017756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300011271|Ga0137393_11027085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300012519|Ga0157352_1046083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300012923|Ga0137359_10069552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3077 | Open in IMG/M |
| 3300012923|Ga0137359_10758907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300012925|Ga0137419_10184756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1533 | Open in IMG/M |
| 3300012944|Ga0137410_10279776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1316 | Open in IMG/M |
| 3300012951|Ga0164300_10040185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1787 | Open in IMG/M |
| 3300012957|Ga0164303_11340936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300012961|Ga0164302_11425121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300013297|Ga0157378_11118898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 825 | Open in IMG/M |
| 3300013306|Ga0163162_12134312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300013306|Ga0163162_12397451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300013306|Ga0163162_13038739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300013306|Ga0163162_13449273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300013307|Ga0157372_11057681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 939 | Open in IMG/M |
| 3300013307|Ga0157372_12113565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300013307|Ga0157372_13276955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300014325|Ga0163163_10474174 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300014325|Ga0163163_11220500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 814 | Open in IMG/M |
| 3300014325|Ga0163163_11328865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 781 | Open in IMG/M |
| 3300014325|Ga0163163_11562442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300014325|Ga0163163_12847026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300014326|Ga0157380_13447679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300014745|Ga0157377_11105349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300015265|Ga0182005_1118041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 753 | Open in IMG/M |
| 3300018074|Ga0184640_10017616 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
| 3300018075|Ga0184632_10242320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300018084|Ga0184629_10050008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1902 | Open in IMG/M |
| 3300018422|Ga0190265_11658758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 750 | Open in IMG/M |
| 3300018433|Ga0066667_10724230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300018466|Ga0190268_11190885 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300018466|Ga0190268_12238799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300018476|Ga0190274_13140796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300018920|Ga0190273_10340571 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300019377|Ga0190264_11122736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300019458|Ga0187892_10031535 | All Organisms → cellular organisms → Bacteria | 4291 | Open in IMG/M |
| 3300025735|Ga0207713_1205007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300025908|Ga0207643_10214426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300025914|Ga0207671_11276127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300025920|Ga0207649_11412909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300025924|Ga0207694_10164127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1795 | Open in IMG/M |
| 3300025925|Ga0207650_10689583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 862 | Open in IMG/M |
| 3300025933|Ga0207706_11226445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300025934|Ga0207686_11058331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300025938|Ga0207704_11770599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300025961|Ga0207712_10007818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6757 | Open in IMG/M |
| 3300026023|Ga0207677_11087538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300026023|Ga0207677_11665417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300026035|Ga0207703_10494845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1147 | Open in IMG/M |
| 3300026035|Ga0207703_11001329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 802 | Open in IMG/M |
| 3300026041|Ga0207639_11228109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300026116|Ga0207674_10341044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1449 | Open in IMG/M |
| 3300026142|Ga0207698_12717144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300028379|Ga0268266_11906572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300028380|Ga0268265_12704328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300028814|Ga0307302_10340770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300030606|Ga0299906_10750560 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300031548|Ga0307408_100812566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 849 | Open in IMG/M |
| 3300031548|Ga0307408_102501925 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031858|Ga0310892_10987462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300031911|Ga0307412_11180331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300031911|Ga0307412_11532962 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300032004|Ga0307414_11443508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.82% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 3.01% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.01% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.01% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.81% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.81% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.20% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.60% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.60% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.60% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2MG_01130460 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | MPERRGVQATEEIKAEWAFAYKIYLKAPGDRYDKKKDRTSRIDFVAQEMKLTR |
| CNBas_10049121 | 3300000531 | Quercus Rhizosphere | MPETRGVQATEEVKAEWSTAYKVYMRAPGDRFDKKKDRTARIDYVAQ |
| F14TC_1004566844 | 3300000559 | Soil | MPEQRGKQATPEIKAEWTHAYKLYLKAPGDRYDKKKDRTTRIDFVAQEMKLTRKQ |
| JGI10216J12902_1178318162 | 3300000956 | Soil | MPERRGVQATEEIKAEWAFAYKVYLRAPGDRFDKKKDRTA |
| JGI12627J18819_103671291 | 3300001867 | Forest Soil | RRGVQATEEIKAEWAFAYKVYLRAPGDRFDKKKDRTARIDYVAQEMKLTQTGKTTN* |
| C688J35102_1209036791 | 3300002568 | Soil | MPETRGIQATDEIKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQE |
| soilL1_101333681 | 3300003267 | Sugarcane Root And Bulk Soil | MPERRGVQATDEIKAEWSYAYKVYLRAPGDRFDKKKDRTARIDYVAQEM |
| soilH2_101402943 | 3300003324 | Sugarcane Root And Bulk Soil | MPERRGVQATEEIKAEWSYAYKVYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRRI |
| Ga0063454_1005893951 | 3300004081 | Soil | MPETRGIQATEEIKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAK |
| Ga0062593_1016234362 | 3300004114 | Soil | MPETRGIQATDEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRI |
| Ga0062593_1020702621 | 3300004114 | Soil | MPERRGVQATEEIKAEWSLAYKVYLRAPGDRFDKKKDRTARIDYVAQEMKL |
| Ga0062590_1012490312 | 3300004157 | Soil | MPETRGIQATDEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMK |
| Ga0063356_1020309831 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPERRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKR |
| Ga0062592_1001526603 | 3300004480 | Soil | MPETRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTQRIDYVAREMKLTRK |
| Ga0062591_1008393912 | 3300004643 | Soil | MPERRGVQATDEIKAEWAFAYKIYLRAPGDRFDKKKDRTARI |
| Ga0062591_1019779291 | 3300004643 | Soil | MPEKRGVQATEEIKAEWSTAYKIYQKAPGDRYDKKKDRTSRIDFVAQ |
| Ga0065712_106247981 | 3300005290 | Miscanthus Rhizosphere | MPERRGVQATEEVKAEWSTAYKFYLRAPGDRYDKKKDRTARIDYVAQEMKLTRKQA |
| Ga0065715_111377362 | 3300005293 | Miscanthus Rhizosphere | MPERRGVQATEEIKAEWSHAYKIYLKAPGDRYDKKKDRTSRIDFVAQEMKLTRKQA |
| Ga0065705_100113921 | 3300005294 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQ |
| Ga0070690_1004172952 | 3300005330 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAK |
| Ga0070670_1001695533 | 3300005331 | Switchgrass Rhizosphere | MPERRGVQATEEVKAEWSTAYKFSLRAPGDRYDKKKDRTARIDYVAQEMKLTRKQ |
| Ga0068868_1012283372 | 3300005338 | Miscanthus Rhizosphere | MPEMRGVQATEEVKAEWATAYKIYLKAPGDRYDKKKDRTSRIDFVAQEMNLTR |
| Ga0070660_1010855782 | 3300005339 | Corn Rhizosphere | MPERRGVQATDDIKAEWSKAYKVYLKAPGDRFDKKKDRTA |
| Ga0070661_1019487681 | 3300005344 | Corn Rhizosphere | MPETRGIQATEEIKAEWSLAYKYYLRAPGDRFDKKKDRTQRVDYVAQEMKLTRKQAKRR |
| Ga0070688_1006034041 | 3300005365 | Switchgrass Rhizosphere | MPEKRGVQATEEIKAEWATAYKLYLKAPGDRYDKKKDRTSRIDFVAQEMNLTRKQAK |
| Ga0070667_1003346831 | 3300005367 | Switchgrass Rhizosphere | MPERRGIQATDEIKAEWATAYKFYLKAPGDRYDKKKDRTSRID |
| Ga0070694_1011160231 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPERRGVQATDDIKAEWSKAYKVYLKAPGDRFDKKKDRTARIDFVAQEMRL |
| Ga0070708_1005837543 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEQRGKQATADVKSEWTRAYQIYLKAPGDRYDKKKDRTARIDSVANELRLTRKQAK |
| Ga0070681_114117832 | 3300005458 | Corn Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKDRTQ |
| Ga0070685_107088482 | 3300005466 | Switchgrass Rhizosphere | MPETRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTQRIDYVAREMKLTRKQAKRRIRN |
| Ga0070706_1014534282 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEQRGKQATEDVKSEWVRAYEIYRKAPGDRSDPKNDRTARIDYVAKEMQLTRKQAKRRV |
| Ga0070698_1012984181 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPERRGVQATEEVKAEWSTAYKYYQRAPGDRYDKKKDRTQRIDYVAQEMK |
| Ga0070679_1017856981 | 3300005530 | Corn Rhizosphere | MPERRGVQATEEIKAEWSFAYKIYLRAPGDRFDKKKDRTAR |
| Ga0070695_1002031471 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MPERRGVQATEEIKAEWSKAYKVYLKAPGDRFDKKKDRTARIDFVAQEMK |
| Ga0070696_1007091721 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEQRGKQATPEVKAEWTHAYKLYLKAPGDRYDKKKDRTTRIDFVAQEMKLTRKQAKR |
| Ga0070696_1015181462 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPERRGVQATEEVKAEWSTAYKHYQRAPGDRFDKKKDRTA |
| Ga0070665_1022171232 | 3300005548 | Switchgrass Rhizosphere | MPERRGVQATEEIKAEWSKAYKVYLKAPGDRFDKKKDRTARIDFVAQEMKLTR |
| Ga0070704_1002992371 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPERRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMKLTR |
| Ga0070704_1004854772 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMK |
| Ga0070704_1010375592 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETRGIQATDEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRI |
| Ga0070664_1004480714 | 3300005564 | Corn Rhizosphere | MPETRGVQATEEVKAEWVTAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAK |
| Ga0070702_1015833711 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEKRGIQATADVKSEWTRAYQIYLRAPGDRYDKKKDRTARIDSVANELRLTRKQAKRRV |
| Ga0068852_1011112491 | 3300005616 | Corn Rhizosphere | MPETRGIQATDEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAK |
| Ga0068864_1019591622 | 3300005618 | Switchgrass Rhizosphere | MPEKRGVQATEEIKAEWSYAYKVYLRAPGDRFDKKKDRTARID |
| Ga0068870_108312211 | 3300005840 | Miscanthus Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRRI |
| Ga0068862_1023919641 | 3300005844 | Switchgrass Rhizosphere | MPERRGVQATDEVKAEWSTAYKFYLRAPGDRFDKKKDRTARIDYV |
| Ga0082029_10448131 | 3300006169 | Termite Nest | MPETRGIQATEDVKAEWSLAYKYYLRAPGDRFAKKKDRTQ |
| Ga0082029_10994011 | 3300006169 | Termite Nest | MPETRGVQATEEVKAEWSTAYKYYLRAPGHRFDKKKDRTQRIDYVAQE |
| Ga0082029_13253372 | 3300006169 | Termite Nest | MPETRGIQATEEVKAEWSLAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKR |
| Ga0070716_1003512431 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPERRGVQATEEIKAEWSFAYKIYLRAPGDRFDKKKDRTARIDYVAQEMKLTRK |
| Ga0097621_1008274012 | 3300006237 | Miscanthus Rhizosphere | MPETRGVQASEEVKAEWSTAYKYYLRAPGDRFDKKKDRT |
| Ga0097621_1021231121 | 3300006237 | Miscanthus Rhizosphere | MPERRVVQATEEIKAEWAFAYKVYLRAPGDRFDKKKDRTA |
| Ga0068871_1004073873 | 3300006358 | Miscanthus Rhizosphere | MPERRGVQATDDIKAEWSKAYKVYLKAPGDRFDKKKDRTARIDFVAQEMRLTRKQAKRRIRN |
| Ga0079222_102638433 | 3300006755 | Agricultural Soil | MPETRGVQATDEVKAERSTAYKFYLRAPGDRFDKKKDRTQRIDYVAQEMKLTR |
| Ga0079220_120650082 | 3300006806 | Agricultural Soil | MPERRGVQATDEIKAEWSFAYKIYLRAPGDRFDKKKDRTARIDYVAQEMKLTR |
| Ga0075421_1023100361 | 3300006845 | Populus Rhizosphere | MPETRGVQATEEVKAEWSLAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLTR |
| Ga0075430_1015457082 | 3300006846 | Populus Rhizosphere | MPETRGVQATDEVKAEWSTAYKFYLRAPGDRFDKKKDRTARI |
| Ga0075433_110262021 | 3300006852 | Populus Rhizosphere | MPETRGVQATEEVKAEWSTAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKL |
| Ga0075420_1016511811 | 3300006853 | Populus Rhizosphere | MPETRGVQATEEVKAEWSLAYKYYLRAPGDRFDKKKDRTARIDY |
| Ga0079217_114156832 | 3300006876 | Agricultural Soil | MPEKRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKK |
| Ga0075429_1009095762 | 3300006880 | Populus Rhizosphere | MPETRGVQATEEVKAEWSLAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLT |
| Ga0075419_104942671 | 3300006969 | Populus Rhizosphere | MPERRGVQATEEVKAEWSTAYKFYLRAPGDRYDKKKDRTARIDYVAQEMKLT |
| Ga0079218_109103742 | 3300007004 | Agricultural Soil | MPEKRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMKLTR |
| Ga0105251_103653102 | 3300009011 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEM |
| Ga0111539_112194522 | 3300009094 | Populus Rhizosphere | MPERRGVQATEEVKAEWAFAYKIYLKAPGDRYDKKKDRTSRIDFVAQEMK |
| Ga0105245_111599951 | 3300009098 | Miscanthus Rhizosphere | MPETRGIQATEDVKAEWSLAYKHYLRAPGDRFDKKKD |
| Ga0075418_112366992 | 3300009100 | Populus Rhizosphere | MPETRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTQRIDYVAREMKLT |
| Ga0105247_108796151 | 3300009101 | Switchgrass Rhizosphere | MPERRGVQATDDIKAEWSKAYKVYLKAPGDRFDKKKDRTARIDFVAQEMRLTRKQ |
| Ga0114129_130584401 | 3300009147 | Populus Rhizosphere | MPERRGVQATEEIKAEWAFAYKMYLKAPGDRYDKKKDRTSRIDF |
| Ga0114129_133154301 | 3300009147 | Populus Rhizosphere | MPEKRGVQATEEVKAEWSHAYKIYLKAPGDRYDKKKDRTYRIDFVAQEMKLTRKQAKRR |
| Ga0105243_104870481 | 3300009148 | Miscanthus Rhizosphere | MPETRGVQATEEVKAEWATAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRR |
| Ga0105243_115758422 | 3300009148 | Miscanthus Rhizosphere | MPETRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARI |
| Ga0105243_125146641 | 3300009148 | Miscanthus Rhizosphere | MPERRGVQATEEVKAEWATAYKFYLRAPGDRFDKKKDRTAR |
| Ga0105243_131251461 | 3300009148 | Miscanthus Rhizosphere | MPETRGIQATDEIKAEWSLAYKHYLRAPGDRFDKKKDRTQRI |
| Ga0075423_105760324 | 3300009162 | Populus Rhizosphere | MPETRGVQATEEVKAEWSLAYKYYLRAPGDRFDKKKDR |
| Ga0075423_126278511 | 3300009162 | Populus Rhizosphere | MPEQRGKQATDEVKSEWTRAYEIYLKPPGDRYDKKTDRPARRDNRAEQMKLTRKQ |
| Ga0105248_116231282 | 3300009177 | Switchgrass Rhizosphere | MPERRGVQATEEIKAEWSFAYKIYLRAPGDRFDKKKDRTARIDFVAQEMKLTRKQAKRRI |
| Ga0105237_106264383 | 3300009545 | Corn Rhizosphere | MPERRGVQATEEIKAEWSKAYKVYLKAPGDRFDKKKDRTARIDFVAQEMKLTRKQAK |
| Ga0105249_101186793 | 3300009553 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKD |
| Ga0105249_111589591 | 3300009553 | Switchgrass Rhizosphere | MPEKRGVQATEEIKAEWATAYKLYLKAPGDRYDKKKDRTSRIDFVAQEM |
| Ga0105249_120790682 | 3300009553 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRR |
| Ga0105249_133145612 | 3300009553 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRI |
| Ga0126313_103289551 | 3300009840 | Serpentine Soil | MPETRGIQATEDIKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDY |
| Ga0126305_105948371 | 3300010036 | Serpentine Soil | MPEKRGVQATEDVKAEWSTAYKFYLRAPGDRFDKKKD |
| Ga0126305_109715871 | 3300010036 | Serpentine Soil | MPEKRGVQATEEVKAEWSTAYKFYIRAPGDRFDKKKDRTARIDYVAQE |
| Ga0126309_102985321 | 3300010039 | Serpentine Soil | MPEKRGIQATEDVKAEWATAYKFYLRAPGDRFDKKKDRT |
| Ga0126308_111896772 | 3300010040 | Serpentine Soil | MPEKRGIQATEDVKAEWATAYKFYLRAPGDRFDKKKDRTARIDYVA |
| Ga0126314_105170682 | 3300010042 | Serpentine Soil | MPEKRGVQATEEVKAEWATAYKFYLRAPGDRFDKKKDRTARID |
| Ga0126311_100412504 | 3300010045 | Serpentine Soil | MPEKRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMKLTRK |
| Ga0126306_100912704 | 3300010166 | Serpentine Soil | MPEKRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMK |
| Ga0126376_104339211 | 3300010359 | Tropical Forest Soil | MPETRGVQATDEVKAEWSTAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLT |
| Ga0126376_120035052 | 3300010359 | Tropical Forest Soil | MPERRGVQATEEIKAEWSYAYKVYLRAPGDRFDKKKD |
| Ga0126372_104451823 | 3300010360 | Tropical Forest Soil | MPERRGVQATEEIKAEWSYAYKVYLRAPGDRFDKKKDRTARIDYVAQEMKL |
| Ga0134128_105268562 | 3300010373 | Terrestrial Soil | MPEQRGKQATADVKSEWTRAYDISLRAPGDRYDKKKDRTARIDSVAQELQLTRKQAKR |
| Ga0105239_124172172 | 3300010375 | Corn Rhizosphere | MPETRGIQATDEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQE |
| Ga0134127_103486982 | 3300010399 | Terrestrial Soil | MPEKRGVQATEEIKAEWSTAYKIYQKAPGDRYDKKKDRTSRIDFVAQEMGLTR |
| Ga0134127_125066411 | 3300010399 | Terrestrial Soil | MPETRGVQATEEVKAEWALAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQA |
| Ga0134127_131689731 | 3300010399 | Terrestrial Soil | MPETRGVQATEEVKAEWSTAYKFYLRAPGDRFDKK |
| Ga0134122_113298321 | 3300010400 | Terrestrial Soil | MPETRGVQATEEVKAEWSTAYRYYLRAPGDRFDKKKDRTQRIDY |
| Ga0134121_100546633 | 3300010401 | Terrestrial Soil | MPEKRGVQATEEIKAEWSTAYKIYQKAPGDRYDKKKDRTSRIDFVAQEMGLTRKQAKRR |
| Ga0134121_102682663 | 3300010401 | Terrestrial Soil | MPERRGVQATEEIKAEWSFAYKIYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQAKRR |
| Ga0134121_104545833 | 3300010401 | Terrestrial Soil | MPETRGVQATEEVKAEWALAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLTRKQ |
| Ga0137391_110177562 | 3300011270 | Vadose Zone Soil | MPEQRGIQATEEVKAEWTTAYKLYLKAPGDRFDKKKDRTARIDFVAQEMNLT |
| Ga0137393_110270851 | 3300011271 | Vadose Zone Soil | MPEQRGKQATADVKSEWTQAYQIYQRAPGDRYDKKKDRTSRIDHVAVEMKLTRKQAKRRI |
| Ga0157352_10460831 | 3300012519 | Unplanted Soil | MPEKRGVQATEEIKAEWATAYKLYLKAPGDRYDKKKDRTSRIDFVAQEMNLTRKQAKRR |
| Ga0137359_100695523 | 3300012923 | Vadose Zone Soil | MPEQRGVQATEEVKAEWTIAYKLYLKAPGDRFDKKKDRTARIDFV |
| Ga0137359_107589071 | 3300012923 | Vadose Zone Soil | MPEQRGKQATADVKSEWTQAYQIYQRAPGDRYDKKKDRTSRIDHVAVEMKLTRKQAKR |
| Ga0137419_101847561 | 3300012925 | Vadose Zone Soil | MPELRGKQATAEVKAEWTNAHQIYLRAPGDRYDKKKDRTARIDFVAKELQLTRKQAKR |
| Ga0137410_102797761 | 3300012944 | Vadose Zone Soil | MPEQRGKQATPDIKSEWTRAYQIYLRAPGDRYDKKKDRTARIDSVAHELNLTRKQAKRRV |
| Ga0164300_100401851 | 3300012951 | Soil | MPEQRGKQATADVKSEWTQAYQIYQRAPGDRYDKKKDRTSRIDHVAVEMKLTRKQAKRR |
| Ga0164303_113409362 | 3300012957 | Soil | MPERRGVQATEEIKAEWSFAYKIYLRAPGDRFDKKKDRTARIDYVAQE |
| Ga0164302_114251213 | 3300012961 | Soil | MPETRGVQATEEVKAEWSTAYKYYLRAPGDRVDKK |
| Ga0157378_111188981 | 3300013297 | Miscanthus Rhizosphere | MPETRGIQATEDVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQ |
| Ga0163162_121343122 | 3300013306 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKR |
| Ga0163162_123974512 | 3300013306 | Switchgrass Rhizosphere | MPETRGIQATDEIKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQ |
| Ga0163162_130387391 | 3300013306 | Switchgrass Rhizosphere | MPETRGVQASEEVKAEWSTAYKYYLRAPGDRFDKKKDRTQRIDYVAQ |
| Ga0163162_134492731 | 3300013306 | Switchgrass Rhizosphere | MPEQRGKQATADVKSEWTRAYQIYLKAPGDRYDKKKDRTARIDSVATELRLTRKQAKRRV |
| Ga0157372_110576811 | 3300013307 | Corn Rhizosphere | MPERRGVQATDDIKAEWSKAYKVYLKAPGDRFDKKKD |
| Ga0157372_121135652 | 3300013307 | Corn Rhizosphere | MPETRGVQATEEVEAEWSLAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKSTRK |
| Ga0157372_132769552 | 3300013307 | Corn Rhizosphere | MPERRGVQATEEIKAEWSKAYKVYLKAPGDRFDKKKDRTARIDFVA |
| Ga0163163_104741743 | 3300014325 | Switchgrass Rhizosphere | MPERRGVQATDDIKAEWSKAYKVYLKAPGDRFDKKKDRTARID |
| Ga0163163_112205001 | 3300014325 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKL |
| Ga0163163_113288651 | 3300014325 | Switchgrass Rhizosphere | MPETRGIQATEDVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEM |
| Ga0163163_115624421 | 3300014325 | Switchgrass Rhizosphere | MPEMRGVQATEEVKAEWAAAYKIYIKAPGDRYDKKKDRTSRIDFVAQEMGLTRKQAKR |
| Ga0163163_128470261 | 3300014325 | Switchgrass Rhizosphere | MPETRGVQASEEVKAEWSTAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAKRR |
| Ga0157380_134476792 | 3300014326 | Switchgrass Rhizosphere | MPETRGVQASEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARIDYVAQEMKL |
| Ga0157377_111053491 | 3300014745 | Miscanthus Rhizosphere | MPETRGVQATEEVKAEWALAYKYYLRAPGDRFDKKKDRTARIDYVAQEMKLT |
| Ga0182005_11180411 | 3300015265 | Rhizosphere | MPERRGVQATDEIKAEWSYAYKVYLRAPGDRFDKKKDRTARIDYVAQEMK |
| Ga0184640_100176166 | 3300018074 | Groundwater Sediment | MPEQRGKQATADVKSEWTRAYQIYLRAPGDRYDKKKDRTARIDSVAQELRLTR |
| Ga0184632_102423202 | 3300018075 | Groundwater Sediment | MPEQRGKQATADVKSEWTRAYQIYLKAPGDRYDEKKDRTARIDSVATELRLTRKQ |
| Ga0184629_100500081 | 3300018084 | Groundwater Sediment | MPEQRGKQATADVKSEWTRAYQIYLKAPGDRYDKKKDRTARIDSVAHELKLTRKQAK |
| Ga0190265_116587582 | 3300018422 | Soil | MPETRGVQATEEVKAEWVTAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQA |
| Ga0066667_107242301 | 3300018433 | Grasslands Soil | MPERRGVQATEEVKEEWSTAYKHYQRAPGDRYDKKKDRTQ |
| Ga0190268_111908851 | 3300018466 | Soil | MPEQRGKQATAEVKSEWTRAYQIYLRAPGDRYDKKKDRTARIDTVAQELKLTRKQ |
| Ga0190268_122387991 | 3300018466 | Soil | MPETRGIQATEEVKAEWALAYKHYLKAAGDRFDKKKDSTQRIDYVAR |
| Ga0190274_131407962 | 3300018476 | Soil | MPETRGVQATEEIKAEWATAYKHYLRAPGDRFDKKKDRTQ |
| Ga0190273_103405711 | 3300018920 | Soil | MPELRGKQATAEIKDEWARAYEFFLQAQGDPYDKKKDRTARIDYVAVKL |
| Ga0190264_111227362 | 3300019377 | Soil | MPELRGIQATDEVKAEWTRAYEIYLSAPGDRYDKKNDRTARIDTVAKELQLTRKQ |
| Ga0187892_100315355 | 3300019458 | Bio-Ooze | MPEQRGKQATPEVKAEWTRAYNIYLKAPGDRFDKKKDRTSRIDFVA |
| Ga0207713_12050072 | 3300025735 | Switchgrass Rhizosphere | MPETRGVQATEEVKAEWATAYKYYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQAK |
| Ga0207643_102144261 | 3300025908 | Miscanthus Rhizosphere | MPETRGIQATDEVKAEWSNAYKFYMRAPGDRFDKKKDRTARI |
| Ga0207671_112761272 | 3300025914 | Corn Rhizosphere | MPETRGIQATDEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQ |
| Ga0207649_114129091 | 3300025920 | Corn Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLT |
| Ga0207694_101641271 | 3300025924 | Corn Rhizosphere | MPETRGIQATDEVKAEWSLAYKHYLRAPGDRFDKKKDRT |
| Ga0207650_106895832 | 3300025925 | Switchgrass Rhizosphere | MPERRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTARI |
| Ga0207706_112264452 | 3300025933 | Corn Rhizosphere | MPETRGVQASEEVKAEWSTAYKYYLRAPGDSFDKKKDRTQRIDYVAQEMKLTR |
| Ga0207686_110583312 | 3300025934 | Miscanthus Rhizosphere | MPERRGVQATEEIKAEWSQAYKIYLKAPGDRYDKKKDRTSRIDFVAQEMKLTRKQAKRRIRN |
| Ga0207704_117705991 | 3300025938 | Miscanthus Rhizosphere | MPETRGVQATEEVKAEWSTAYKFYLRAPGDRFDKKKDRTA |
| Ga0207712_100078188 | 3300025961 | Switchgrass Rhizosphere | MPETRGIQATEEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRK |
| Ga0207677_110875382 | 3300026023 | Miscanthus Rhizosphere | MPETRGIQATDEIKAEWSLAYKHYLRAPGDRFDKKKDRTQ |
| Ga0207677_116654171 | 3300026023 | Miscanthus Rhizosphere | MPETRGVQATEEVKAEWATAYKYYLRAPGDRFDKKKDRTQR |
| Ga0207703_104948451 | 3300026035 | Switchgrass Rhizosphere | MPERRGIQATDEIKAEWATAYKFYLKAHGARYDKKKDRTSR |
| Ga0207703_110013291 | 3300026035 | Switchgrass Rhizosphere | MPETRGVQATEEVKAEWVTAYKYYLRAPGDRFDKKKDRTQRIDYVAQ |
| Ga0207639_112281091 | 3300026041 | Corn Rhizosphere | MPERRGVQATEEIKAEWAFAYKIYLKAPGDRYDKKKDRTSRIDFVAQEMK |
| Ga0207674_103410444 | 3300026116 | Corn Rhizosphere | MPETRGVQATEEVKAEWVTAYKYYLRAPGDRFDKKKDRTQRID |
| Ga0207698_127171441 | 3300026142 | Corn Rhizosphere | VPEQRGKQATPEVKAEWTHAYKLYLKAPGDRYDKKKDRTTRIDFVAQEMKLTRKQAKRRI |
| Ga0268266_119065722 | 3300028379 | Switchgrass Rhizosphere | MPERRGVQATEEIKAEWSKAYKVYLKAPGDRFDKKKDRTARIDFVAQEMKLTRKQ |
| Ga0268265_127043282 | 3300028380 | Switchgrass Rhizosphere | MPETRGIQATDEVKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLTRKQ |
| Ga0307302_103407701 | 3300028814 | Soil | MPEQRGKQATADVKSEWTRAYQIYLRAPGDRYDKKKDRTARIDSVANELRLTRKQAK |
| Ga0299906_107505601 | 3300030606 | Soil | MPEQRGKQATPEVKAEWSKAYEIYLRAPGDRFDKKNDRTKRIDHVAEEMNLTRKQAKRR |
| Ga0307408_1008125662 | 3300031548 | Rhizosphere | MPETRGIQATDEIKAEWSLAYKHYLRAPGDRFDKKKDRTQRIDYVAQEMKLT |
| Ga0307408_1025019251 | 3300031548 | Rhizosphere | MPELRGVQATPETKEEWSRAYDLYLQAPGVPYDKKKDRTQRIEYVARQMNLTRKQA |
| Ga0310892_109874622 | 3300031858 | Soil | MPERRGVQATDEIKAEWSHAYKIYLRAPGDRFDKK |
| Ga0307412_111803312 | 3300031911 | Rhizosphere | MPETRGVQATEEVKAEWSLAYKYYLRAPGDRFDKK |
| Ga0307412_115329622 | 3300031911 | Rhizosphere | MPELRGVQATPETKEEWSRAYDLYLQAPGVPYDKKKDRTQRIEYVARQMNLTRKQ |
| Ga0307414_114435082 | 3300032004 | Rhizosphere | MPERRGVQATEEIKAEWSTAYKVYLRAPGDRFDKKKDRTAR |
| ⦗Top⦘ |