Metagenome Family F038379

Basic Information
Family ID	F038379
Family Type	Metagenome
Number of Sequences	166
Average Sequence Length	43 residues
Representative Sequence	PMALPRCTTGPGTVPGRSGTLLMQGPEFLGDVDLAQAA
Number of Associated Samples	151
Number of Associated Scaffolds	166

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.69 %
% of genes near scaffold ends (potentially truncated)	86.14 %
% of genes from short scaffolds (< 2000 bps)	80.72 %
Associated GOLD sequencing projects	140
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Most Common Taxonomy
Group	Unclassified (50.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (6.024 % of family members)
Environment Ontology (ENVO)	Unclassified (36.747 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.590 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 6.06% β-sheet: 12.12% Coil/Unstructured: 81.82%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 166 Family Scaffolds
PF00578	AhpC-TSA	77.71
PF13638	PIN_4	13.25
PF14307	Glyco_tran_WbsX	1.20
PF03796	DnaB_C	0.60
PF13231	PMT_2	0.60
PF00293	NUDIX	0.60
PF08534	Redoxin	0.60
PF13649	Methyltransf_25	0.60
PF13229	Beta_helix	0.60
PF01425	Amidase	0.60
PF02142	MGS	0.60

COG ID	Name	Functional Category	% Frequency in 166 Family Scaffolds
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.60
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	0.60
COG1066	DNA repair protein RadA/Sms, contains AAA+ ATPase domain	Replication, recombination and repair [L]	0.60

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	42.77 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	7.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	37.95 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	7.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	28.31 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	7.23 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	2.41 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.81 %
Thiotrichales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales	0.60 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuricellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae	1.81 %
Zoogloeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae	0.60 %
unclassified Thiotrichales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales	0.60 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula	1.81 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Pseudomonas syringae group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Pseudomonas syringae group genomosp. 1	species subgroup	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	7.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Grewioideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Apeibeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Corchorus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Corchorus olitorius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Corchorus olitorius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	6.63 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.42 %
Sulfuriferula multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	1.81 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.60 %
Pseudomonas syringae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	0.60 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.60 %
Thiotrichales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	0.60 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459016\|G1P06HT01AZGN2	Not Available	525	Open in IMG/M
3300000579\|AP72_2010_repI_A01DRAFT_1032631	Not Available	753	Open in IMG/M
3300001213\|JGIcombinedJ13530_108721149	Not Available	685	Open in IMG/M
3300003858\|Ga0031656_10292889	Not Available	550	Open in IMG/M
3300004024\|Ga0055436_10238071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	578	Open in IMG/M
3300004047\|Ga0055499_10018726	All Organisms → cellular organisms → Bacteria → Proteobacteria	902	Open in IMG/M
3300004155\|Ga0066600_10337772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	697	Open in IMG/M
3300005293\|Ga0065715_10679943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	663	Open in IMG/M
3300005295\|Ga0065707_10200238	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1314	Open in IMG/M
3300005341\|Ga0070691_10245838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	958	Open in IMG/M
3300005354\|Ga0070675_100008530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7958	Open in IMG/M
3300005355\|Ga0070671_101746113	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300005356\|Ga0070674_100915023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	765	Open in IMG/M
3300005356\|Ga0070674_101959125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	533	Open in IMG/M
3300005364\|Ga0070673_100436744	All Organisms → cellular organisms → Bacteria	1176	Open in IMG/M
3300005367\|Ga0070667_100806599	All Organisms → cellular organisms → Bacteria	871	Open in IMG/M
3300005434\|Ga0070709_10720457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	777	Open in IMG/M
3300005435\|Ga0070714_101678098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	621	Open in IMG/M
3300005438\|Ga0070701_10341989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	932	Open in IMG/M
3300005471\|Ga0070698_101191048	All Organisms → cellular organisms → Bacteria → Proteobacteria	711	Open in IMG/M
3300005518\|Ga0070699_101414720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	638	Open in IMG/M
3300005539\|Ga0068853_100762251	Not Available	925	Open in IMG/M
3300005563\|Ga0068855_101949591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	594	Open in IMG/M
3300005564\|Ga0070664_102095633	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300005575\|Ga0066702_10948129	Not Available	514	Open in IMG/M
3300005576\|Ga0066708_10126901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1545	Open in IMG/M
3300005577\|Ga0068857_101645764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	627	Open in IMG/M
3300005660\|Ga0073904_10787090	Not Available	507	Open in IMG/M
3300005719\|Ga0068861_100444942	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1160	Open in IMG/M
3300005764\|Ga0066903_106113768	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300005834\|Ga0068851_10425364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	785	Open in IMG/M
3300005937\|Ga0081455_10506060	All Organisms → cellular organisms → Bacteria → Proteobacteria	810	Open in IMG/M
3300005952\|Ga0080026_10205609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	584	Open in IMG/M
3300006173\|Ga0070716_100113294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1684	Open in IMG/M
3300006174\|Ga0075014_100385655	All Organisms → cellular organisms → Bacteria → Proteobacteria	760	Open in IMG/M
3300006642\|Ga0075521_10680008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	508	Open in IMG/M
3300006806\|Ga0079220_11481081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	581	Open in IMG/M
3300006846\|Ga0075430_101115628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	650	Open in IMG/M
3300006904\|Ga0075424_100362206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1545	Open in IMG/M
3300006904\|Ga0075424_101969902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	617	Open in IMG/M
3300009009\|Ga0105105_10499058	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	696	Open in IMG/M
3300009012\|Ga0066710_101946525	Not Available	876	Open in IMG/M
3300009082\|Ga0105099_10364966	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300009083\|Ga0105047_10323721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1593	Open in IMG/M
3300009098\|Ga0105245_12197212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae	606	Open in IMG/M
3300009111\|Ga0115026_10952891	Not Available	683	Open in IMG/M
3300009137\|Ga0066709_101027165	All Organisms → cellular organisms → Bacteria → Proteobacteria	1208	Open in IMG/M
3300009156\|Ga0111538_10914406	Not Available	1111	Open in IMG/M
3300009156\|Ga0111538_13211261	Not Available	569	Open in IMG/M
3300009167\|Ga0113563_12618151	Not Available	610	Open in IMG/M
3300010339\|Ga0074046_10746652	Not Available	573	Open in IMG/M
3300010361\|Ga0126378_12713026	Not Available	566	Open in IMG/M
3300010362\|Ga0126377_13476068	Not Available	509	Open in IMG/M
3300010376\|Ga0126381_101998392	Not Available	836	Open in IMG/M
3300010398\|Ga0126383_13541037	Not Available	510	Open in IMG/M
3300012189\|Ga0137388_10670048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	964	Open in IMG/M
3300012209\|Ga0137379_10720407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	903	Open in IMG/M
3300012285\|Ga0137370_10732582	Not Available	614	Open in IMG/M
3300012349\|Ga0137387_10463148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	920	Open in IMG/M
3300012349\|Ga0137387_10795625	Not Available	684	Open in IMG/M
3300012357\|Ga0137384_11143122	Not Available	622	Open in IMG/M
3300012482\|Ga0157318_1004040	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	878	Open in IMG/M
3300012971\|Ga0126369_12902092	Not Available	561	Open in IMG/M
3300013104\|Ga0157370_10036326	All Organisms → cellular organisms → Bacteria → Proteobacteria	4783	Open in IMG/M
3300013306\|Ga0163162_11606110	Not Available	742	Open in IMG/M
3300013308\|Ga0157375_10507361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1370	Open in IMG/M
3300014312\|Ga0075345_1035194	All Organisms → cellular organisms → Bacteria → Proteobacteria	992	Open in IMG/M
3300014324\|Ga0075352_1160971	Not Available	638	Open in IMG/M
3300014325\|Ga0163163_12229483	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	607	Open in IMG/M
3300014498\|Ga0182019_10216856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1245	Open in IMG/M
3300015167\|Ga0167661_1016863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1327	Open in IMG/M
3300015371\|Ga0132258_10045260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	10028	Open in IMG/M
3300015372\|Ga0132256_102809865	Not Available	585	Open in IMG/M
3300015372\|Ga0132256_103198939	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	551	Open in IMG/M
3300015374\|Ga0132255_102223476	Not Available	836	Open in IMG/M
3300017961\|Ga0187778_10574923	Not Available	754	Open in IMG/M
3300018482\|Ga0066669_10488272	All Organisms → cellular organisms → Bacteria → Proteobacteria	1064	Open in IMG/M
3300021082\|Ga0210380_10488069	Not Available	565	Open in IMG/M
3300021478\|Ga0210402_10061297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3307	Open in IMG/M
(restricted) 3300021517\|Ga0224723_1215957	Not Available	556	Open in IMG/M
3300022534\|Ga0224452_1275535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	514	Open in IMG/M
3300025479\|Ga0208588_1084500	Not Available	598	Open in IMG/M
3300025560\|Ga0210108_1106639	Not Available	562	Open in IMG/M
3300025898\|Ga0207692_10314589	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	956	Open in IMG/M
3300025900\|Ga0207710_10579082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	586	Open in IMG/M
3300025910\|Ga0207684_11062004	Not Available	675	Open in IMG/M
3300025919\|Ga0207657_10551733	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	901	Open in IMG/M
3300025919\|Ga0207657_11316682	All Organisms → cellular organisms → Bacteria → Proteobacteria	545	Open in IMG/M
3300025926\|Ga0207659_10265987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1397	Open in IMG/M
3300025931\|Ga0207644_10484899	All Organisms → cellular organisms → Bacteria → Proteobacteria	1018	Open in IMG/M
3300025933\|Ga0207706_11266345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	610	Open in IMG/M
3300025936\|Ga0207670_10746344	Not Available	813	Open in IMG/M
3300025937\|Ga0207669_10731748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	815	Open in IMG/M
3300025937\|Ga0207669_11167718	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	651	Open in IMG/M
3300025940\|Ga0207691_11594615	Not Available	531	Open in IMG/M
3300025945\|Ga0207679_10027575	All Organisms → cellular organisms → Bacteria → Proteobacteria	3929	Open in IMG/M
3300026023\|Ga0207677_10845400	All Organisms → cellular organisms → Bacteria → Proteobacteria	822	Open in IMG/M
3300026041\|Ga0207639_10863512	Not Available	845	Open in IMG/M
3300026041\|Ga0207639_11432929	Not Available	648	Open in IMG/M
3300026142\|Ga0207698_10889709	Not Available	897	Open in IMG/M
3300026538\|Ga0209056_10112735	Not Available	2182	Open in IMG/M
3300027678\|Ga0209011_1005740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4266	Open in IMG/M
3300027765\|Ga0209073_10437127	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300027841\|Ga0209262_10145996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1132	Open in IMG/M
3300027871\|Ga0209397_10185403	Not Available	948	Open in IMG/M
3300027880\|Ga0209481_10698446	Not Available	527	Open in IMG/M
3300027900\|Ga0209253_10693130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	736	Open in IMG/M
3300027902\|Ga0209048_10764620	Not Available	632	Open in IMG/M
3300028380\|Ga0268265_10338863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1368	Open in IMG/M
3300028380\|Ga0268265_11653701	Not Available	646	Open in IMG/M
3300028381\|Ga0268264_11688153	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	644	Open in IMG/M
3300028587\|Ga0247828_11005991	Not Available	545	Open in IMG/M
3300028868\|Ga0302163_10011009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1877	Open in IMG/M
3300029989\|Ga0311365_11367835	Not Available	609	Open in IMG/M
3300030339\|Ga0311360_11277012	Not Available	576	Open in IMG/M
3300030838\|Ga0311335_10801896	Not Available	666	Open in IMG/M
3300030943\|Ga0311366_10040332	All Organisms → cellular organisms → Bacteria → Proteobacteria	4060	Open in IMG/M
3300031232\|Ga0302323_100603840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1189	Open in IMG/M
3300031521\|Ga0311364_11067139	Not Available	805	Open in IMG/M
3300031720\|Ga0307469_11059017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	760	Open in IMG/M
3300031722\|Ga0311351_11004017	Not Available	639	Open in IMG/M
3300031726\|Ga0302321_100881066	Not Available	1014	Open in IMG/M
3300031820\|Ga0307473_11361273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans	533	Open in IMG/M
3300031834\|Ga0315290_10103508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2403	Open in IMG/M
3300031834\|Ga0315290_10668605	Not Available	897	Open in IMG/M
3300031858\|Ga0310892_11036877	Not Available	579	Open in IMG/M
3300031902\|Ga0302322_100010030	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	8585	Open in IMG/M
3300031997\|Ga0315278_10988322	Not Available	839	Open in IMG/M
3300032068\|Ga0318553_10488553	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300032091\|Ga0318577_10194517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	969	Open in IMG/M
3300032164\|Ga0315283_11960142	Not Available	584	Open in IMG/M
3300032174\|Ga0307470_10181631	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	1324	Open in IMG/M
3300032205\|Ga0307472_101301486	Not Available	700	Open in IMG/M
3300032828\|Ga0335080_10957001	Not Available	874	Open in IMG/M
3300033408\|Ga0316605_12224124	Not Available	533	Open in IMG/M
3300033412\|Ga0310810_10627267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1023	Open in IMG/M
3300033413\|Ga0316603_12161753	Not Available	525	Open in IMG/M
3300033418\|Ga0316625_101813857	Not Available	592	Open in IMG/M
3300033418\|Ga0316625_102343618	Not Available	536	Open in IMG/M
3300033433\|Ga0326726_11207282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium	736	Open in IMG/M
3300033481\|Ga0316600_10520314	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	827	Open in IMG/M
3300034090\|Ga0326723_0219226	Not Available	845	Open in IMG/M
3300034149\|Ga0364929_0246945	Not Available	600	Open in IMG/M
3300034417\|Ga0364941_079714	Not Available	769	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	62.05%
Host-Associated	Host-Associated	36.75%
Engineered	Engineered	1.20%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	48.19%
Plants	Host-Associated → Plants	36.75%
Aquatic	Environmental → Aquatic	13.86%
Solid Waste	Engineered → Solid Waste	0.60%
Wastewater	Engineered → Wastewater	0.60%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	39.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere	20.48%
Rhizoplane	Host-Associated → Plants → Rhizoplane	15.66%
Freshwater	Environmental → Aquatic → Freshwater	10.24%
Peat	Environmental → Terrestrial → Peat	7.23%
Marine	Environmental → Aquatic → Marine	2.41%
Sediment	Environmental → Aquatic → Sediment	1.20%
Floodplain	Environmental → Terrestrial → Floodplain	1.20%
Roots	Host-Associated → Plants → Roots	0.60%
Grass	Engineered → Solid Waste → Grass	0.60%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	23.49%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	13.86%
Soil	Host-Associated → Plants → Rhizosphere → Soil	12.65%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.43%
Loam	Environmental → Terrestrial → Soil → Loam	7.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	7.23%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.01%
Lake	Environmental → Aquatic → Freshwater → Lake	3.01%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.41%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.81%
Pond	Environmental → Aquatic → Freshwater → Pond	1.20%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.20%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.20%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.60%
Ice	Environmental → Aquatic → Freshwater → Ice	0.60%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.60%
Composting	Engineered → Solid Waste → Grass → Composting	0.60%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	13.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	12.65%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	9.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.83%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.23%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	7.23%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.63%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.82%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.22%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.01%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.01%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.41%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.81%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.81%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	1.20%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.20%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.20%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.20%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.20%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.20%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.20%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.60%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.60%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.60%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.60%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.60%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	6.02%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.42%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	5.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.82%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.22%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.22%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.61%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.01%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.41%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.41%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.41%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.41%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.41%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.41%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.81%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.81%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.81%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.20%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.20%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	1.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.20%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.20%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.20%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.20%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.20%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.20%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.20%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.20%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.20%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.60%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.60%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.60%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.60%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.60%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.60%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.60%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.60%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.60%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.60%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.60%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.60%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.60%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.60%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.60%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.60%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.60%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.60%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.60%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.60%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.60%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.60%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459016	Litter degradation ZMR2	Engineered	Open in IMG/M
3300000579	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300003371	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM	Host-Associated	Open in IMG/M
3300003858	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI	Environmental	Open in IMG/M
3300004024	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2	Environmental	Open in IMG/M
3300004047	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1	Environmental	Open in IMG/M
3300004155	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005660	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate	Engineered	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005896	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005952	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006642	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009083	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012482	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510	Host-Associated	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014312	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1	Environmental	Open in IMG/M
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014498	Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG	Environmental	Open in IMG/M
3300015167	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021517 (restricted)	Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR2_MetaG	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300025479	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025560	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026010	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 (SPAdes)	Environmental	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027678	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027841	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028868	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3	Environmental	Open in IMG/M
3300029989	III_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030339	III_Bog_N1 coassembly	Environmental	Open in IMG/M
3300030838	I_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031521	III_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031722	II_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033481	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F038379

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2ZMR_01117140	2170459016	Switchgrass, Maize And Mischanthus Litter	FEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA
AP72_2010_repI_A01DRAFT_10326312	3300000579	Forest Soil	PMRAIYESLQTFALPRCEVGLEQIRGRSGRLLTQGKEFLGDVDLAQAA*
JGI11643J12802_104794392	3300000890	Soil	PMALPRCETMLASVPGRTGTLLMQGDEFLGDVDESQAGR*
JGIcombinedJ13530_1087211492	3300001213	Wetland	ALPRCETGPGEIPGRSGALLVQGAEFLADVDLATAQ*
JGI26145J50221_10268021	3300003371	Arabidopsis Thaliana Rhizosphere	EPMALPRCETMLASVPGRTGTLLMQGDEFLGDVDESQAGR*
Ga0031656_102928892	3300003858	Freshwater Lake Sediment	VEPLALPRCEVAFGTLPGRDGTVLLQGREFLADVDLARAA*
Ga0055436_102380712	3300004024	Natural And Restored Wetlands	VQPLALPRCETGPGAVPGRSGTLLVQGAEFLADVDLAAAV*
Ga0055499_100187261	3300004047	Natural And Restored Wetlands	LVSTRALYDTLQPLALPRCEVGPGTIAGRAGTLLVQRAEFLADVDLAQAA*
Ga0066600_103377722	3300004155	Freshwater	TRMLFESLQPMALPRCTVGPGEVPGRTGTLLLQGPEFLGDVGLAAAA*
Ga0062592_1005009281	3300004480	Soil	EPLALPRCETLLSAIPGRTGTLLVQGEEFLGEVDEARREL*
Ga0065715_106799431	3300005293	Miscanthus Rhizosphere	EPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA*
Ga0065707_102002381	3300005295	Switchgrass Rhizosphere	ALLDTLQPLALPRCVVGPGEIDGRSGTLLLQREEFLADVDLAAAA*
Ga0070691_102458381	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	FEPMALPRCEVGMDPVPGRSGTLLCQRREFLGDVDLVRAA*
Ga0070675_1000085308	3300005354	Miscanthus Rhizosphere	FEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA*
Ga0070671_1017461132	3300005355	Switchgrass Rhizosphere	IGPVRALYESVEPMALPRCTTGPGTVEGRTGTLLVQGDEFLGDVDLAQAA*
Ga0070674_1009150231	3300005356	Miscanthus Rhizosphere	ELHAAVEPMALPRCETILASVPGRTGTLLVQGDEFLGDVDESQAGR*
Ga0070674_1019591252	3300005356	Miscanthus Rhizosphere	TLASMRSLLETLQPLALPRCEIGPGTVEARSGPLLVQGREFLAEVDLAQAA*
Ga0070673_1004367441	3300005364	Switchgrass Rhizosphere	ALYESVEPMALPRCTTGPGTVEGRTGTLLVQGDEFLGDVDLAQAA*
Ga0070667_1008065991	3300005367	Switchgrass Rhizosphere	QGWTIGPVRALYESVEPMALPRCTTGPGTIEGRTGTLLVQGDEFLGDVDLARAA*
Ga0070709_107204571	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	SSLRRLYETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA*
Ga0070714_1016780981	3300005435	Agricultural Soil	SLRRLYETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA*
Ga0070701_103419891	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	PTRSLFESVEPMALPRCTASPGTVPGRSGTLLIQGPEFLGEVDLAKAA*
Ga0070698_1011910481	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	TRDLYETLQPMALPRCVVMQGSVAGRSGTLLVQGTEFLGDVDLAAAA*
Ga0070699_1014147202	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	LVAMRAWYETLQALALPRCEVGPGTVPGRSGTLLCQGREFLGDVDLARAA*
Ga0068853_1007622511	3300005539	Corn Rhizosphere	SVEPMALPRCATKNDTVAGRAGTLLVQGPEFLGDVDLAQAA*
Ga0070672_1005231031	3300005543	Miscanthus Rhizosphere	EPMALPRCETILASVPGRTGTLLVQGDEFLGDVDESQAGR*
Ga0068855_1001208811	3300005563	Corn Rhizosphere	PRCETLLSAIPGRTGTLLVQGEEFLGEVDEARREL*
Ga0068855_1019495912	3300005563	Corn Rhizosphere	VRAIYDDLEPMALPRCEVGPGTVPGRSGSLLVQGEEFLAGVDLADAA*
Ga0070664_1018805012	3300005564	Corn Rhizosphere	LLRDDVEPLALPRCETGFAPIEGRTGTVLMQGDEFLGDVDGTR*
Ga0070664_1020956331	3300005564	Corn Rhizosphere	MGPVRALYESVEPMALPRCTTGPGTVEGRTGTVLVQGEEFLADVDLAQAA*
Ga0066702_109481291	3300005575	Soil	ALPRCEVGPATVSGRSGTLLCQGREFLGDVDLARGA*
Ga0066708_101269011	3300005576	Soil	AVEPMALPRCEVGLGTIAGRTGTLLTQSDEFLAGVDLPEAA*
Ga0068857_1016457642	3300005577	Corn Rhizosphere	EVGPVRAIYDDLEPMALPRCEVGPGTVPGRSGSLLVQGEEFLAGVDLADAA*
Ga0073904_107870901	3300005660	Activated Sludge	VRAIYDAVEPMALPRCAVHAGTVPGRSGTLLVQGEEFLQDVDLATAA*
Ga0068861_1004449421	3300005719	Switchgrass Rhizosphere	YESFEPMALPRCEVSSGTVPGRSGTLFVQRGEFLADVPLGEAA*
Ga0066903_1061137682	3300005764	Tropical Forest Soil	ETFQPLALPRCEVGFGAVQGRSGTLLVQGEEFLGDVDLAQAA*
Ga0068851_104253641	3300005834	Corn Rhizosphere	YETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA*
Ga0075282_10409611	3300005896	Rice Paddy Soil	VVEPLALPRCEAGLGEIEGRTGTLLVQGEEFLGDVDATRKGL*
Ga0081455_105060601	3300005937	Tabebuia Heterophylla Rhizosphere	PLRALYETFEPMALPRCEVGNGVLKGRSGTLFIQRDEFLADVPLEHAA*
Ga0080026_102056091	3300005952	Permafrost Soil	LPRHEVAPGTVPGRSGTLLVQGKEFLGDVTFVAAA*
Ga0070716_1001132943	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	RLYETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA*
Ga0075014_1003856552	3300006174	Watersheds	WTLCSTRALYDTLQPMALPRCEVRAGTVAGRSGTLLVQGDEFLGDVDLAQAA*
Ga0075521_106800081	3300006642	Arctic Peat Soil	FEAVEPMALPRCTTGPGTVPGRTGTLLVQGPEFLGDVDLARAA*
Ga0079220_114810812	3300006806	Agricultural Soil	LYEAVEPMALPRCEVMPGEIAGRTGTLLVQGDEFLGDLDPRAAA*
Ga0075430_1011156282	3300006846	Populus Rhizosphere	PMALPRCEVSNGTVPGRSGTLFVQRGEFLADAPLDQAA*
Ga0075424_1003622063	3300006904	Populus Rhizosphere	QAMALPRCEVGIGRIPGRSGTLLVQGPEFLAETSLAHGGNPQA*
Ga0075424_1019699022	3300006904	Populus Rhizosphere	EAYEPMALPRCDVANGTVPGRSGTLFVQRGEFLADVPQEQAA*
Ga0105105_104990581	3300009009	Freshwater Sediment	VLEHVQPLALPRCCVGPGVVPGRSGTVLLQGDEFLGDVDVAAA*
Ga0066710_1019465251	3300009012	Grasslands Soil	LYETLQPMALPRCEVGPGTVDGRSGTLLLQGAEFLGDVDLSAAA
Ga0105099_103649663	3300009082	Freshwater Sediment	LALPRCEVEFGTLPGRDGTVLLQGREFLADVDLARAA*
Ga0105047_103237211	3300009083	Freshwater	MALPRCETGPGTIAGRSGTLLVQGPEFLGEVTLN*
Ga0111539_120887631	3300009094	Populus Rhizosphere	MALPRCETILASVPGRTGTLLVQGDEFLGDVDESQAGR*
Ga0105245_121972122	3300009098	Miscanthus Rhizosphere	RTLFESVEPMALPRCATKNDTVAGRAGTLLVQGPEFLGDVDLAQAA*
Ga0105245_124232312	3300009098	Miscanthus Rhizosphere	DAVEPLALPRCENRLGSIAGRTGTLLLQGDEFLGDVDGAESGRGL*
Ga0115026_109528912	3300009111	Wetland	STRTLYESVQALALPRCETGPGTVPGRSGTLLVQGPEFLADVDLADAA*
Ga0066709_1010271651	3300009137	Grasslands Soil	TSMRTLYESLQPLALPRCEVAPGTVPGRTGTVLRQGREFLADVDLAAAA*
Ga0111538_109144061	3300009156	Populus Rhizosphere	TLQPMALPRCEVLLGSVAGRSGTLLVQGVEFLGDVDLAVAA*
Ga0111538_132112612	3300009156	Populus Rhizosphere	PRCEALQGPIPGRSGDVLLQGAEFLGDVDLAEAA*
Ga0113563_126181511	3300009167	Freshwater Wetlands	TLQPLALPRCEVAPGVIEGRSGTLLLQGEEFLAGVDLAQAA*
Ga0074046_107466522	3300010339	Bog Forest Soil	PLRSIYETLQALALPRCEVGPGTVPGRSGTLLSQGREFLGDIDLAEAA*
Ga0126378_127130261	3300010361	Tropical Forest Soil	LPRCQVGPATVPGRSGTLLCQGPEFLAEVDLAQAA*
Ga0126377_134760681	3300010362	Tropical Forest Soil	LPRCEVGPGTVPGRSGNLLVQRDEFLADFALPQAA*
Ga0126381_1019983923	3300010376	Tropical Forest Soil	FALPRCEVGFEPVPGRSGTLFSQGREFLGDVDLAQAA*
Ga0126383_135410371	3300010398	Tropical Forest Soil	SLQTFALPRCEVGLGQVPGRSGRLLTQGREFLGDVDLAQAA*
Ga0134122_132431242	3300010400	Terrestrial Soil	PRCETILASVPGRTGTLLVQGDEFLGDVDESQAGR*
Ga0137388_106700481	3300012189	Vadose Zone Soil	RLVPMRAWYETLQALALPRCEVGPATVPGRSGTLLCQGREFLSDVDLARAA*
Ga0137379_107204073	3300012209	Vadose Zone Soil	PMRTLYESLTFLLPRCEVGPGRVAGRSGTLFSQGDEFLGGVDLAQAA*
Ga0137370_107325822	3300012285	Vadose Zone Soil	YESLQALALPRCEVGPGTIPGRSGTLFSQGGEFLADVDLTQAA*
Ga0137387_104631483	3300012349	Vadose Zone Soil	YESLQALALPRCEAQLGTVPGRSGTLLAQGGEFLAGVDLAQAA*
Ga0137387_107956252	3300012349	Vadose Zone Soil	QPMALPRCEVAPGTVPGRSGTVLRQGREFLADVDLAAAA*
Ga0137384_111431222	3300012357	Vadose Zone Soil	TLYESLQPMALPRCEVAPGTVPGRSGTVLRQGREFLADVDLAAAA*
Ga0157318_10040402	3300012482	Arabidopsis Rhizosphere	LETLQPLALPRCEIGPGTVEGRSGPLLVQGREFLAEVDLAQAA*
Ga0126369_129020922	3300012971	Tropical Forest Soil	LGTTRALFETLQPMALPRCEITPGTVEGRSGTLMVQGPEFLGDVDLSAAA*
Ga0164305_103095753	3300012989	Soil	LALPRCETGLATVDGRTGTLLVQGNEFLGDVDATR*
Ga0157370_100363261	3300013104	Corn Rhizosphere	GYRLSSLRRLYETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA*
Ga0157370_114793411	3300013104	Corn Rhizosphere	RCETILASVPGRTGTLLVQGDEFLGDVDESQAGR*
Ga0163162_116061101	3300013306	Switchgrass Rhizosphere	PMALPRCSTGPGTVEGRTGTLLVQGEEFLGEVDLAQAA*
Ga0157375_105073611	3300013308	Miscanthus Rhizosphere	VEPMALPRCETGAGQVDGRSGTLLVQGPEFLADVDLAQAA*
Ga0075345_10351942	3300014312	Natural And Restored Wetlands	MRTLLETLQPLALPRCEVGPGVIEGRSGTLLLQGDEFLADVDLAQAA*
Ga0075352_11609711	3300014324	Natural And Restored Wetlands	AMRTLLETLQPLALPRCEVGPGVVEGRSGTLLLQGDEFLADVDLAQAA*
Ga0163163_122294831	3300014325	Switchgrass Rhizosphere	PLALPRCVVGPGEIDGRSGSLLVQREEFLADVDLATAA*
Ga0182019_102168563	3300014498	Fen	LGPTRALFEAVEPMALPRCTTGPGTVPGRTGTLLVQGPEFLGDVDLSRAA*
Ga0167661_10168633	3300015167	Glacier Forefield Soil	PRCEVAPGTIAGRSGKVLRQGREFLGDVDLATAT*
Ga0132258_100452607	3300015371	Arabidopsis Rhizosphere	ESLQPMALPRHVAEVAAVPGRSGTLLVQGREFLGDVNLAAAA*
Ga0132256_1028098651	3300015372	Arabidopsis Rhizosphere	PMALPRCEAGPGTVSGRTGTMLVQGPEFLADVDLVAAV*
Ga0132256_1031989392	3300015372	Arabidopsis Rhizosphere	LGPMRALYETLQPMALPRCETGTGTVPGRSGTLFVQRAEFLGDVDLAQAA*
Ga0132255_1022234761	3300015374	Arabidopsis Rhizosphere	QGFTLGPVRSLYESVEPMALPRCATGPGTVEGRTGTLLVQGEEFLAEVDLAQAA*
Ga0187778_105749231	3300017961	Tropical Peatland	MQGLALPRCEVGPGTVPGRSGTLLCQGPEFLAEVDLARAA
Ga0066669_104882723	3300018482	Grasslands Soil	YRLTSMRTLYESLQPLALPRCEVAPGTVPGRTGMVLRQGREFLADVDLAAAA
Ga0210380_104880691	3300021082	Groundwater Sediment	ALGPVRTLFESVEPMALPRCATNNGTVAGRAGTLLVQGPEFLGNVDLAQAA
Ga0210402_100612974	3300021478	Soil	LYETTQALALPRHEVGPGTVPGRSGTLLVQGREFLGDVDLAAAA
(restricted) Ga0224723_12159572	3300021517	Freshwater Sediment	LRTLYESAEPMALPRCVTGPGTVAGRSGTLLVQQEEFLGDVALVS
Ga0224452_12755351	3300022534	Groundwater Sediment	YRLIPMRAWYETLQALALPRCEVGPGTVPGRSGTLLCQGREFLGNVDLAQAA
Ga0208588_10845002	3300025479	Arctic Peat Soil	EPMALPRCTTGPGTIPGRTGTLLVQGPEFLADVDLAQAA
Ga0210108_11066391	3300025560	Natural And Restored Wetlands	LPRCETGPGAVPGRSGTLLVQGAEFLADVDLAAAV
Ga0207692_103145893	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	PMALPRCEVGMDPVPGRSGTLLCQRREFLGDVDLVRAA
Ga0207710_105790822	3300025900	Switchgrass Rhizosphere	VEPMALPRCMTGPGTVTGRTGTLLVQGDEFLREVDLAAAA
Ga0207684_110620042	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	LFETLQPMALPRCEVESGTVDGRSGTLLVQGVEFLGDVDLAAAA
Ga0207657_105517331	3300025919	Corn Rhizosphere	QGYRLSSLRRLYETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA
Ga0207657_113166824	3300025919	Corn Rhizosphere	ESVEPMALPRCTASPGTVPGRSGTLLIQGPEFLGEVDLAKAA
Ga0207649_113823552	3300025920	Corn Rhizosphere	VEPLALPRCETLLSAIPGRTGTLLVQGEEFLGEVDEARREL
Ga0207659_102659871	3300025926	Miscanthus Rhizosphere	PMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA
Ga0207700_109605162	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	DAVEPLALPRCETMLSTIAGRTGTLLVQGEEFLGEVDEARREL
Ga0207644_104848991	3300025931	Switchgrass Rhizosphere	SLFDTFEPLALPRCEVSNGTVPGRSGTLLVQGGEFLADVPLEQAA
Ga0207706_112663451	3300025933	Corn Rhizosphere	YETFEPMALPRCEVGMDPVPGRSGTLLCQRREFLGDVDLVRAA
Ga0207670_107463441	3300025936	Switchgrass Rhizosphere	VGPVRSLYESVEPMALPRCSTGPGTVEGRTGTLLVQGEEFLGEVDLAQAA
Ga0207669_107317483	3300025937	Miscanthus Rhizosphere	ELHAAVEPMALPRCETILASVPGRTGTLLVQGDEFLGDVDESQAGR
Ga0207669_111677182	3300025937	Miscanthus Rhizosphere	LPRCEVGMDPVPGRSGTLLCQRREFLGDVDLVRAA
Ga0207691_115946151	3300025940	Miscanthus Rhizosphere	FEPMALPRCEVGMGTVPGRSGSLFVQRGEFLADVSLSRAA
Ga0207689_115022501	3300025942	Miscanthus Rhizosphere	PRCETMLASVPGRTGTLLMQGDEFLGDVDESQAGR
Ga0207679_100275751	3300025945	Corn Rhizosphere	IYDDLEPMALPRCEVGPGTVPGRSGSLLVQGEEFLAGVDLADAA
Ga0207640_119271771	3300025981	Corn Rhizosphere	DDVEPLALPRCETGFAPIEGRTGTVLMQGDEFLGDVDGTR
Ga0207999_10114681	3300026010	Rice Paddy Soil	PRCEAGLGEIEGRTGTLLVQGEEFLGDVDATRQGL
Ga0207677_108454001	3300026023	Miscanthus Rhizosphere	HEALEPMALPRCEVGMGTVPGRSGTLFVQRGEFLADVSLSRAA
Ga0207639_108635123	3300026041	Corn Rhizosphere	ESVEPMALPRCATKNDTVAGRAGTLLVQGPEFLGDVDLAQAA
Ga0207639_114329291	3300026041	Corn Rhizosphere	PVRALYESVEPMALPRCTTGPGTVEGRTGTLLVQGDEFLGDVDLAQAA
Ga0207674_117385922	3300026116	Corn Rhizosphere	DLLASVEPMALPRCETLLGSIPGRTGTLLMQGDEFLGDIDETHREL
Ga0207698_108897093	3300026142	Corn Rhizosphere	VEPLALPRCEALQGPIPGRSGDVLLQGAEFLGDVDLAEAA
Ga0209056_101127351	3300026538	Soil	ALPRCEVAQGIVPGRSGTLLTQGDEFLAEADLAHAA
Ga0209969_10808942	3300027360	Arabidopsis Thaliana Rhizosphere	EPMALPRCETSLAAVAGRTGTLLVQGEEFLGDVHDETREGL
Ga0209995_10250421	3300027471	Arabidopsis Thaliana Rhizosphere	YEASEPMALPRCETSLAAVAGRTGTLLVQGEEFLGDVHDETREGL
Ga0209982_10291111	3300027552	Arabidopsis Thaliana Rhizosphere	ASEPMALPRCETSLAAVAGRTGTLLVQGEEFLGDVHDETREGL
Ga0209011_10057405	3300027678	Forest Soil	LALPRCEVAPGTIPGRSGTVFRQGREFLGDVDLATAA
Ga0209073_104371272	3300027765	Agricultural Soil	LYEAVEPMALPRCEVMPGEIAGRTGTLLVQGDEFLGDLDPRAAA
Ga0209074_101915691	3300027787	Agricultural Soil	ALPRCEAQLTSIDGRSGRLLVQGDEFLGDVDGTRQGL
Ga0209262_101459961	3300027841	Freshwater	TRMLFESLQPMALPRCTVGPGEVPGRTGTLLLQGPEFLGDVGLAAAA
Ga0209397_101854031	3300027871	Wetland	PLALPRCEVAPGAVAGREGNVLLQGAEFLADVDLARAA
Ga0209481_106984461	3300027880	Populus Rhizosphere	PTRALYDAVEPMALPRCETGAGQVDGRSGTLLVQGPEFLADVDLAQAA
Ga0209253_106931302	3300027900	Freshwater Lake Sediment	VAMRAMIERLHPLALPRCEVGPGGIPGRSGTVLLQGREFLGDVDPAAA
Ga0209048_107646201	3300027902	Freshwater Lake Sediment	QPLALPRCEVGPGAVEGRSGTLLVQRGEFLADVDLAQAA
Ga0268265_103388631	3300028380	Switchgrass Rhizosphere	PMALPRCTTGPGTVPGRSGTLLMQGPEFLGDVDLAQAA
Ga0268265_116537012	3300028380	Switchgrass Rhizosphere	ESVEPMALPRCTTGPGTIEGRTGTLLVQGDEFLGDVDLARAA
Ga0268264_116881532	3300028381	Switchgrass Rhizosphere	WALGPVGELHAAVEPMALPRCETILASVPGRTGTLVVQGDEFLGDVDESQAGR
Ga0247828_110059911	3300028587	Soil	EQGLALGPVGELHAAVEPMALPRCETILASVPGRTGTLLVQGDEFLGDVDESQAGR
Ga0302163_100110093	3300028868	Fen	RTLFESVEPMALPRCTTGPGSIPGRTGTLLIQGPEFLADVDLAEAA
Ga0311365_113678351	3300029989	Fen	LGPMRTLFESVEPMALPRCTTGPGTVPGRTGTLLVQGPQFLADIDLAQAA
Ga0311360_112770121	3300030339	Bog	ALPRCTTGHGTIPGRTGTLLVQGPEFLADVDLAEAA
Ga0311335_108018962	3300030838	Fen	TRTLFESVEPMALPRCTTGPGTIPGRTGTLLVQGPEFLADVDLAEAA
Ga0311366_100403321	3300030943	Fen	LFESVEPMALPRCTTGPGTIPGRTGTLLVQGPEFLADVDLAEAA
Ga0302323_1006038401	3300031232	Fen	GWTLGTTRALFESVEPMALPRCTTGPGAIPGRTGTLLLQGPEFLADVDLAQAA
Ga0311364_110671392	3300031521	Fen	LFESVEPMALPRCTTGPGSIPGRTGTLLVQGPEFLADVDLAAAA
Ga0307469_110590172	3300031720	Hardwood Forest Soil	ALPRCEVSNGAVPGRSGTLFVQGEEFLADVPLEQAA
Ga0311351_110040172	3300031722	Fen	EPMALPRCTTGPGTIPGRTGTLLVQGPEFLADVDLAEAA
Ga0302321_1008810661	3300031726	Fen	LGPTRRLFEAVEPMALPRCTTGPGSIPGRTGTMLVQGPEFLADVDLAEAA
Ga0307473_113612731	3300031820	Hardwood Forest Soil	TLASMRSLLEAVQPLALPRCDVAPGTVAGRAGELLVQGSEFLADVDLAQAA
Ga0315290_101035081	3300031834	Sediment	LLETLQPLALPRCEVGPGALDGRSGTLLLQGDEFLAGVDLARAA
Ga0315290_106686051	3300031834	Sediment	MALLRCEVGIGEVPRRTGTLLVQAREFLADVDLPAMT
Ga0310892_110368772	3300031858	Soil	KAQGLSVGPVRSLYESVEPMALPRCSTGPGTVEGRTGTLLVQGEEFLGEVDLAQAA
Ga0302322_1000100309	3300031902	Fen	TRTLFESVEPMALPRCTTGPGSIPGRTGTLLIQGPEFLADVDLAEAA
Ga0315278_109883221	3300031997	Sediment	SMRTLLDTLQPLALPRCEVGPGTIEGRSGTLLLQRDEFLADVDLAAAA
Ga0318553_104885531	3300032068	Soil	LALPRCEVGPGSVPGRSGTLLCQGPDFLAEVDLAQAA
Ga0318577_101945172	3300032091	Soil	LHETLQPLALPRCEVGPGSVPGRSGTLLCQGPDFLAEVDLAQAA
Ga0315283_119601422	3300032164	Sediment	LLETLQPFALPRCEVGPGTIDGRSGMLLVQRNEFLADVDLAQAA
Ga0307470_101816311	3300032174	Hardwood Forest Soil	GLYDTLQALALPRCEVGAGAVPGRSGTLLCQGPEFLAEVDLAQAA
Ga0307472_1013014861	3300032205	Hardwood Forest Soil	LALPRCEVGPGTVFGRSGMLFCQGPEFLAEVDLAQAA
Ga0335080_109570012	3300032828	Soil	ALLETMQGLALPRCEVGPGTVPGRSGTLLCQGPEFLAEVDLARAA
Ga0316605_122241242	3300033408	Soil	LVPVRALRDAVEPLALPRCEVEFGTVPGRDGTVLTQGREFLADVDLARAA
Ga0310810_106272671	3300033412	Soil	SSLRRLYETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA
Ga0316603_121617532	3300033413	Soil	DSVEPMALPRCATGPGTVPGRTGTLLVQGEEFLGDVDLARAA
Ga0316625_1018138571	3300033418	Soil	LGSTRRLFETLQPMALPRCEVGPGEIEGRSGTVLVQRDEFLGDVDLAQAA
Ga0316625_1023436181	3300033418	Soil	ETLQPLALPRCEVGPGVIDGRSGTLLLQGGEFLADVDLAQAA
Ga0326726_112072821	3300033433	Peat Soil	LGSMRALLDTLQPLALPRCVVGPGEIDGRSGTLLVQREEFLADVDLAAAA
Ga0316600_105203143	3300033481	Soil	ALRDAVEPLALPRCEVEFGTVPGRDGTVLLQGREFLADVDLARAA
Ga0326723_0219226_1_111	3300034090	Peat Soil	ALPRCEAQLGRVPGRSGTLFVQGGEFLAGVDLAQAA
Ga0364929_0246945_481_600	3300034149	Sediment	QPLALPRCEVGPGTIEGRSGTLLLQRDEFLADVDLAAAA
Ga0364941_079714_5_118	3300034417	Sediment	MALPRCATKNGTVAGRSGTLLVQGPEFVGDVDLAQAA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign