| Basic Information | |
|---|---|
| Family ID | F038356 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 166 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MASVSQNFMKLFRGSSGGAEAATPQVAQKLTRRSSGLGELSRLWE |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.36 % |
| % of genes near scaffold ends (potentially truncated) | 99.40 % |
| % of genes from short scaffolds (< 2000 bps) | 89.76 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.398 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.651 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.108 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.241 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.29% β-sheet: 0.00% Coil/Unstructured: 76.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF04519 | Bactofilin | 94.58 |
| PF13378 | MR_MLE_C | 3.61 |
| PF07714 | PK_Tyr_Ser-Thr | 0.60 |
| PF13462 | Thioredoxin_4 | 0.60 |
| PF16901 | DAO_C | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 94.58 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.40 % |
| Unclassified | root | N/A | 0.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10115712 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300001356|JGI12269J14319_10161005 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300001471|JGI12712J15308_10004741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3878 | Open in IMG/M |
| 3300001545|JGI12630J15595_10042487 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300001593|JGI12635J15846_10283241 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300001867|JGI12627J18819_10157086 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300004133|Ga0058892_1277162 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005437|Ga0070710_10088037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1826 | Open in IMG/M |
| 3300005437|Ga0070710_11347419 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005439|Ga0070711_101668362 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005445|Ga0070708_100051558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3646 | Open in IMG/M |
| 3300005471|Ga0070698_101732503 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005541|Ga0070733_10062512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2339 | Open in IMG/M |
| 3300005541|Ga0070733_10654897 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005542|Ga0070732_10272669 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005556|Ga0066707_10518247 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005577|Ga0068857_101030017 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005602|Ga0070762_11052463 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005610|Ga0070763_10186838 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005610|Ga0070763_10458519 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006162|Ga0075030_100675724 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300006174|Ga0075014_100400492 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300006176|Ga0070765_100116094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2340 | Open in IMG/M |
| 3300006354|Ga0075021_11109162 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300007788|Ga0099795_10063759 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300009038|Ga0099829_11365886 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009624|Ga0116105_1008281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2115 | Open in IMG/M |
| 3300009665|Ga0116135_1276469 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300009762|Ga0116130_1244364 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010046|Ga0126384_10309386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
| 3300010159|Ga0099796_10145329 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300010343|Ga0074044_10996645 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010359|Ga0126376_11477771 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300010361|Ga0126378_11558260 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300010366|Ga0126379_10383348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1448 | Open in IMG/M |
| 3300010371|Ga0134125_11476094 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300010373|Ga0134128_11576233 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010379|Ga0136449_100049193 | All Organisms → cellular organisms → Bacteria | 9518 | Open in IMG/M |
| 3300010398|Ga0126383_11755464 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300010859|Ga0126352_1135652 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300011040|Ga0138587_148215 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300011065|Ga0138533_1008360 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300011071|Ga0138595_1049117 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300011084|Ga0138562_1041222 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300011120|Ga0150983_14279485 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300011271|Ga0137393_10431873 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012353|Ga0137367_10995363 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012357|Ga0137384_11048875 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012359|Ga0137385_11179632 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012917|Ga0137395_10265069 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300012918|Ga0137396_10955053 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012923|Ga0137359_11694456 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012930|Ga0137407_11918390 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300014159|Ga0181530_10185929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300014161|Ga0181529_10404730 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300014200|Ga0181526_10623362 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300014489|Ga0182018_10135813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1414 | Open in IMG/M |
| 3300014489|Ga0182018_10226500 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300014657|Ga0181522_10073418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1950 | Open in IMG/M |
| 3300015241|Ga0137418_10637128 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300016341|Ga0182035_11845227 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300016698|Ga0181503_1194908 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300016750|Ga0181505_10246978 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300017823|Ga0187818_10031659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2269 | Open in IMG/M |
| 3300017924|Ga0187820_1081325 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300017942|Ga0187808_10229631 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300017972|Ga0187781_10455549 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300017975|Ga0187782_10994123 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300017975|Ga0187782_11593209 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300017994|Ga0187822_10378456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300018007|Ga0187805_10139734 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300018025|Ga0187885_10349600 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300018035|Ga0187875_10270231 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300018035|Ga0187875_10396383 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018085|Ga0187772_10345993 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300018085|Ga0187772_10431340 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300018086|Ga0187769_10140918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1760 | Open in IMG/M |
| 3300018090|Ga0187770_11136791 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300019182|Ga0184598_145107 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300019242|Ga0181502_1058840 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300019256|Ga0181508_1150339 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300019256|Ga0181508_1388012 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300019273|Ga0187794_1561048 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300019278|Ga0187800_1882863 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300019284|Ga0187797_1277440 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300020579|Ga0210407_11153170 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300020582|Ga0210395_11141611 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300020582|Ga0210395_11219581 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021168|Ga0210406_11212520 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021171|Ga0210405_10911580 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300021403|Ga0210397_10290543 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300021475|Ga0210392_10635044 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300021475|Ga0210392_11149016 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021476|Ga0187846_10041321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2059 | Open in IMG/M |
| 3300021477|Ga0210398_10832208 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300021477|Ga0210398_11055695 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021559|Ga0210409_10063210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3454 | Open in IMG/M |
| 3300021559|Ga0210409_10310799 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300021860|Ga0213851_1354966 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300022504|Ga0242642_1083529 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300022508|Ga0222728_1067241 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300022510|Ga0242652_1031468 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300022531|Ga0242660_1120798 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300022532|Ga0242655_10144801 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300022721|Ga0242666_1180305 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300022722|Ga0242657_1149701 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300022726|Ga0242654_10209059 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300022873|Ga0224550_1056967 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300022873|Ga0224550_1058634 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300023012|Ga0228597_100400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1576 | Open in IMG/M |
| 3300023019|Ga0224560_104500 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300024271|Ga0224564_1132134 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025612|Ga0208691_1084467 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300025898|Ga0207692_10624967 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300025915|Ga0207693_10683241 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300026552|Ga0209577_10844130 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300026928|Ga0207779_1017481 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300026998|Ga0208369_1028868 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300027537|Ga0209419_1051458 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300027678|Ga0209011_1059107 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300027745|Ga0209908_10089192 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027795|Ga0209139_10265020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 606 | Open in IMG/M |
| 3300027842|Ga0209580_10014938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3391 | Open in IMG/M |
| 3300027842|Ga0209580_10433975 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300027853|Ga0209274_10028878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2560 | Open in IMG/M |
| 3300027855|Ga0209693_10029910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2650 | Open in IMG/M |
| 3300027889|Ga0209380_10359055 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300027889|Ga0209380_10411214 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300027895|Ga0209624_10315506 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300027898|Ga0209067_10189488 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300027908|Ga0209006_10103043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2529 | Open in IMG/M |
| 3300027911|Ga0209698_10004648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14982 | Open in IMG/M |
| 3300027911|Ga0209698_11217261 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300028747|Ga0302219_10280992 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300028765|Ga0302198_10310394 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300028798|Ga0302222_10375209 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300028866|Ga0302278_10032602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3518 | Open in IMG/M |
| 3300028906|Ga0308309_10234987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1527 | Open in IMG/M |
| 3300029636|Ga0222749_10674116 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300029910|Ga0311369_10771917 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300029911|Ga0311361_10629734 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300029945|Ga0311330_10735525 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300030580|Ga0311355_11147750 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300030618|Ga0311354_10023823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7487 | Open in IMG/M |
| 3300031028|Ga0302180_10090951 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300031028|Ga0302180_10518484 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031231|Ga0170824_105639631 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031231|Ga0170824_125218425 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031421|Ga0308194_10288653 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031446|Ga0170820_15108426 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031663|Ga0307484_112846 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031708|Ga0310686_108523388 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300031720|Ga0307469_10211565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1524 | Open in IMG/M |
| 3300031820|Ga0307473_11000135 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031829|Ga0316050_107363 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031938|Ga0308175_100839598 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300031962|Ga0307479_10518586 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300032120|Ga0316053_112752 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300032160|Ga0311301_12066793 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300032180|Ga0307471_102012626 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300032261|Ga0306920_103437734 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300032515|Ga0348332_13634130 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300032782|Ga0335082_11146570 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300033158|Ga0335077_10431530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1409 | Open in IMG/M |
| 3300034091|Ga0326724_0223390 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.22% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.22% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.01% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.01% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.01% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.41% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.20% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.20% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.20% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.60% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.60% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004133 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011040 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 79 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031663 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031829 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101157121 | 3300001356 | Peatlands Soil | VASVTQNFMKIFRGSSGGAEAEAPPPVPKLTRRSSGLGELARLWDSE |
| JGI12269J14319_101610053 | 3300001356 | Peatlands Soil | MASVTQNFMKLFRGSSGGAEAATPQVAPKLTRRSSGLGE |
| JGI12712J15308_100047411 | 3300001471 | Forest Soil | MASVSQNFMKLFRGSSSGSETTATQGSQKLTRRSSGLGELARVWDSE |
| JGI12630J15595_100424871 | 3300001545 | Forest Soil | MASVAQNFMKLFRGSSGGSETTTPAQASQKLTRRSSGLGEAARSWDTE |
| JGI12635J15846_102832411 | 3300001593 | Forest Soil | VSSVSQNFMKLFRGSSGPETVPAQGSQKLTRRSSGLGELSRTWETAESL |
| JGI12627J18819_101570861 | 3300001867 | Forest Soil | MASVTQNFMKLFRGSSGGTEATTPQGAQKLTRRSSSLGELARVWEADTPLCVL |
| Ga0058892_12771621 | 3300004133 | Forest Soil | MASVTQNFMKLFRGSSGGAEAAIPQVAQKLTRRSSGLAELSR |
| Ga0070710_100880373 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSVSQNFMKLFRGSSGPETTPPQGSQKLTRRSSGLGELSRAWESAEALCVL |
| Ga0070710_113474192 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVTQNFMKLFRGSSGNPPAETPQVAQKLTRRSSGLGELSRLW |
| Ga0070711_1016683622 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVTQNFMKLFRSSSSSSPSETPQAQQKLTRRSSGLGELARVWDSETPLCV |
| Ga0070708_1000515581 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVTQNFMKFFRSSSSGPEATNPAQSSQKLTRRSSGLGELARSWD |
| Ga0070698_1017325031 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVTQNFMKLFRGSSGGTEATPAQAAQKLTRRSSGLGELSRVWEADTPL |
| Ga0070733_100625124 | 3300005541 | Surface Soil | VASVTNNFMKLFRGSSSGTQAETPQAAQKLTRRSSSLGELARLWD |
| Ga0070733_106548971 | 3300005541 | Surface Soil | MASVTQNFMKLFRGSSGAPEAVTAQTSQKLGRKSSGLGEVARAW |
| Ga0070732_102726691 | 3300005542 | Surface Soil | MASVTQNFMKLFRGSSGGPEAVIPPAAQKLTRRSSGLGELSRLWDADTPL |
| Ga0066707_105182472 | 3300005556 | Soil | MASVVQNFMKLFRGSSGGSETTTPAQASQKLTRRSSGLGEAARSWDTEQTLCILDL |
| Ga0068857_1010300171 | 3300005577 | Corn Rhizosphere | MASVTQNFMKLFRGSSSGTSAQTPAATQKLTRRSSGLGELARLWNSETPLCVL |
| Ga0070762_110524631 | 3300005602 | Soil | MASVTQNFMKLFRGSSGSTQGQTPQPAQKLTRRSSGLGE |
| Ga0070763_101868381 | 3300005610 | Soil | MASVTQNFMKLFRGSSGGTEAATPLAAQKLTRRSSGLGELSRVWESE |
| Ga0070763_104585191 | 3300005610 | Soil | MASVTQNFMKLFRGSSGSTQGQTPQPAQKLTRRSSGLGELSRLWDSD |
| Ga0075030_1006757243 | 3300006162 | Watersheds | MASVTQNFMKLFRGSSGGAEAATPQVAQKLTRRSSGLG |
| Ga0075014_1004004922 | 3300006174 | Watersheds | MASVTQNFMKLFRGSSRGTQAETPQAAQKLTRRSSGLGELSRLWDTDTPLC |
| Ga0070765_1001160941 | 3300006176 | Soil | MSSVSQTFMKFFRGSSGPETIPAQGSQKLTRRSSGLGELARSWETAEGL |
| Ga0075021_111091622 | 3300006354 | Watersheds | MASVSQNFMKLFRGSSGGTEATTPQAAQKLTRRSS |
| Ga0099795_100637591 | 3300007788 | Vadose Zone Soil | MASVTQNFMKFFRSSSSGPEATNPAQSSQKLTRRSSGLGELARNWDSKETL |
| Ga0099829_113658862 | 3300009038 | Vadose Zone Soil | MKLFRGSSGPETVPAQGSQKLIRRSSGLGELSRTWVSADGLCILD |
| Ga0116105_10082811 | 3300009624 | Peatland | VSSVSQTFMKLFRGSSGPDAVPAQGSQKLTRRSSGLGELTRSWESAEDLC |
| Ga0116135_12764692 | 3300009665 | Peatland | MKLFRGSSGGAEPPTSAQTSQRLNRRSSGLGEVARTWDTETPLCVLDLG |
| Ga0116130_12443642 | 3300009762 | Peatland | MASVTQNFMKLFRGSSGGTEAALPQAAQKLTRRSSGLGELSRVWESE |
| Ga0126384_103093861 | 3300010046 | Tropical Forest Soil | MEAGPMASVTHNFMKLFRGSSGSTPAETPQAAQKLTRRSSGLGELARLWDQ |
| Ga0099796_101453292 | 3300010159 | Vadose Zone Soil | MASVTQNFMKFFRSSSSGPEATNPAQSSQKLTRRSSGLGELAR |
| Ga0074044_109966452 | 3300010343 | Bog Forest Soil | MSSVSQNFMKLFRGSSGPETIPEQGSQKLTRRSSGLGELSRTWESA |
| Ga0126376_114777711 | 3300010359 | Tropical Forest Soil | MATVSQNFMKLFRGSSGRAPADQPEVTQKLTRRSSVLGELARLWESQTP |
| Ga0126378_115582602 | 3300010361 | Tropical Forest Soil | MEAGPMASVTHNFMKLFRGSSGSTPAETPQAAQKL |
| Ga0126379_103833483 | 3300010366 | Tropical Forest Soil | MASVTHNFMKLFRGSSSGSPAETPQVQQKLARRSSGLGELARLWDSE |
| Ga0134125_114760941 | 3300010371 | Terrestrial Soil | MASVTQNFMKLFRSTSSGTPAQTPQGGQKLTRRSSGL |
| Ga0134128_115762331 | 3300010373 | Terrestrial Soil | MASVTQNFMKLFRGSSSSTSAQMPAASQKLTRRSSGLGELARLWN |
| Ga0136449_1000491931 | 3300010379 | Peatlands Soil | MASVTQNFMKLFRGSSGGAEAATPQVAQKLTRRSSGLGE |
| Ga0126383_117554641 | 3300010398 | Tropical Forest Soil | MASVTQNFMKLFRGSSSAPQADTQQAAQKLTRRSSGLGELSR |
| Ga0126352_11356521 | 3300010859 | Boreal Forest Soil | MKFFRGSSGPETIPAQGSQKLTRRSSGLGELSRTW |
| Ga0138587_1482151 | 3300011040 | Peatlands Soil | MASVTQNFMKLFRGSSSGPEAATPPDLQKLTRRSSGLGELS |
| Ga0138533_10083601 | 3300011065 | Peatlands Soil | MASVTQNFMKLFRGSSSGPEAATPPDLQKLTRRSSGLGELSRLWES |
| Ga0138595_10491171 | 3300011071 | Peatlands Soil | MASVTQNFMKLFRGSSSGPEAATPPDLQKLTRRSSG |
| Ga0138562_10412221 | 3300011084 | Peatlands Soil | MASVTQNFMKLFRGSSSGPEAATPPDLQKLTRRSSGLGELSRLWESD |
| Ga0150983_142794852 | 3300011120 | Forest Soil | VSSVSQNFMKFFRGSSGPETIPAQGSQKLTRRSSGLAELSRSWETA |
| Ga0137393_104318733 | 3300011271 | Vadose Zone Soil | MASVTQNFMKLFRGSSGGAEAATPQAAQKLTRRSSGLGELS |
| Ga0137367_109953631 | 3300012353 | Vadose Zone Soil | MASVAQNFMKLFRGSSSGSPAETPQAAQKLTRRSSGLGELARL |
| Ga0137384_110488751 | 3300012357 | Vadose Zone Soil | MASVTQNFMKFFRGSSSGTRAETSQAAQKLTRRSSGLGELSRLWDGDSPL |
| Ga0137385_111796322 | 3300012359 | Vadose Zone Soil | MASVTQNFMKLFRGSSSGPQAETPQAAQKLTRRSSGLGELSRVWNSET |
| Ga0137395_102650691 | 3300012917 | Vadose Zone Soil | MASVAQNFMKFFRGSSGGSETTTPAQASQKLTRRSSGL |
| Ga0137396_109550532 | 3300012918 | Vadose Zone Soil | MASVAQTFMKLFRGSSSGSETTTPAQASQKLTRRSSGLGEAARSWD |
| Ga0137359_116944561 | 3300012923 | Vadose Zone Soil | MKLFRGSSGPETIPAQGSQKLTRRSSGLGELSRTWESAEGLCILDL |
| Ga0137407_119183901 | 3300012930 | Vadose Zone Soil | MASVTQNFMKLFRGSSGGPEATSPQASQKLTRRSSGLGELARTWDNDKPL |
| Ga0181530_101859291 | 3300014159 | Bog | MASTAHNFMKLFRGSSRGTEASPPVPQNLTRRSSGLAELSRLWDSESP |
| Ga0181529_104047301 | 3300014161 | Bog | VSSVSQTFMKLFRGSSGPDAVPAQGSQKLTRRSSGLGELTRSWESAEDLCVL |
| Ga0181526_106233621 | 3300014200 | Bog | MKFFRGSSGAETIPAQGAQKLTRRSSGLGELARTWQSAEGLTILD |
| Ga0182018_101358131 | 3300014489 | Palsa | MASVSQTFMKFFRGSGPETTTPAPGSQKLTRRSSGLGELSRLWESG |
| Ga0182018_102265003 | 3300014489 | Palsa | MKLFRGSSGAETIPAQGAEKLTRRSSGLGELSRTWK |
| Ga0181522_100734184 | 3300014657 | Bog | MKLFRGSSGTETIPVQGAQKLTRRSSGLGELSRMW |
| Ga0137418_106371283 | 3300015241 | Vadose Zone Soil | MKLFRGSSGPEAVPAQGSQKLTRRSSGLGELSRTWESAEGLCIL |
| Ga0182035_118452272 | 3300016341 | Soil | MASVTQNFMKLFRGSSSGAQAETPQTPQKLTRRSSGLGELVRLWES |
| Ga0181503_11949083 | 3300016698 | Peatland | VSSVSQTFMKLFRGSSGPDAVPAQGSQKLTRRSSGLGELTRSWESAED |
| Ga0181505_102469781 | 3300016750 | Peatland | LSSVSQNFMKFFRGASGPETVPAQGSQKLTRRSSGLGELSRSWESAENL |
| Ga0187818_100316591 | 3300017823 | Freshwater Sediment | MKLFRGSSSGTQAETPQPVQKLVRRSSDLGELVRLWDSETPLC |
| Ga0187820_10813251 | 3300017924 | Freshwater Sediment | MASVTQNFMKLFRGSSGGAQAAIPQPAPKMTRRSSGLVELSRFWESDTP |
| Ga0187808_102296311 | 3300017942 | Freshwater Sediment | MASTQNFMKLFRGSSGGTEAATPQAAQKLTRRSSG |
| Ga0187781_104555492 | 3300017972 | Tropical Peatland | MKLFRGSSRGTEAETPLAPQRVTRRSSGLAELSPLWDSETPLCVLDL |
| Ga0187782_109941231 | 3300017975 | Tropical Peatland | MASVSQNFMKLFRGSSGGTQAETPQPVQKLTRRSSGLAELKRVWDTQTPLCV |
| Ga0187782_115932092 | 3300017975 | Tropical Peatland | MASTAQNIMKLFRGSSRGTESAAPQAAERITRRSSGLAELSPLWDA |
| Ga0187822_103784561 | 3300017994 | Freshwater Sediment | MATVSQNFMKLFRGSSGRTPAEASEVAQKLTRRSSGLGELARLWESETPLC |
| Ga0187805_101397343 | 3300018007 | Freshwater Sediment | MASVTQNFMKLFRGSSGASEAASPHAAEKLTRRSSGLG |
| Ga0187885_103496001 | 3300018025 | Peatland | MSSVSQNFMKLFRGSSGPETVPAQGSQKLTRRSSGLGELSRIWESAEDLCVLD |
| Ga0187875_102702313 | 3300018035 | Peatland | VSQTFMKLFRGSTGPETLPAQGSQKLTRRSSGLGELSRTWESAEALCILDL |
| Ga0187875_103963832 | 3300018035 | Peatland | MASVTQNFMKLFRGSSGGTEAATAQPAAKLTRRSSGLGELSRLWEGDSPLCVL |
| Ga0187772_103459933 | 3300018085 | Tropical Peatland | MKLFRGSLRGTEAETPQAPQRVTRRSSGLAELSPLWD |
| Ga0187772_104313402 | 3300018085 | Tropical Peatland | MASVAQGFMKLFRGSATGSEPRARTGQAKLTRRSSGLAELT |
| Ga0187769_101409181 | 3300018086 | Tropical Peatland | MKLFRGSSGAETLPEQRVQKLTRRSSGLAELSRVWESA |
| Ga0187770_111367911 | 3300018090 | Tropical Peatland | MASTQNFMKLFRGSSRSTEAVPPVPQKLTRRSSGLSE |
| Ga0184598_1451071 | 3300019182 | Soil | MSSVSQNFMKLFRGSSGPETIPAQGSQKLTRRSSGLGELSRSWESA |
| Ga0181502_10588401 | 3300019242 | Peatland | MRFFRGSGTETLPAQPAQKLTRRSSGLAELSRGWDAAENLCVLDL |
| Ga0181508_11503391 | 3300019256 | Peatland | MASVTQNFMKLFRGSSSSTQGQTPQPAQKLTRRSSGLGELSRLWD |
| Ga0181508_13880121 | 3300019256 | Peatland | MASVSQNFMKLFRGSSGGAEAATPPPAEKPTRRSSGLGELSRVWESETPLTVLDL |
| Ga0187794_15610481 | 3300019273 | Peatland | MASVTQNFMKLFRSGPETPTPAQAQQKLTRRSSGLAELARTWNATKNTE |
| Ga0187800_18828631 | 3300019278 | Peatland | MASVTQNFMKLFRGSSGTQAATPPTAQKLTRRSSGLGELA |
| Ga0187797_12774401 | 3300019284 | Peatland | MASTAQNFMKLFRGSSRGTEAETPPSAQRPTRRSSGLNELS |
| Ga0210407_111531702 | 3300020579 | Soil | MASVTQNFMKLFRGSSGGAEAAIPQVAQKLTRRSSGLA |
| Ga0210395_111416111 | 3300020582 | Soil | MASVTQNFMKLFRGSSGGAEAAIPQVAQKLTRRSSGLAELSRVWEAD |
| Ga0210395_112195811 | 3300020582 | Soil | MKLFRGSSGTETIPVQGAQKLTRRSSGLGELSRMWES |
| Ga0210406_112125202 | 3300021168 | Soil | MSSVSQNFMKFFRGSSGPEVTPAQSSQKLTRRSSGLAELSRSWE |
| Ga0210405_109115802 | 3300021171 | Soil | MASVSQNFMKLFRGSSGGAEAATPQVAQKLTRRSSGLGELSRLWE |
| Ga0210397_102905431 | 3300021403 | Soil | MKLFRGSSGPETIPAQGSQKLTRRSSGLGELSRLWESSEDLCI |
| Ga0210392_106350441 | 3300021475 | Soil | MATTQNFMKLFRGSSGGTEAATPQAAQKLTRRSSGLGELARVWE |
| Ga0210392_111490161 | 3300021475 | Soil | VSSVSQTFMKLFRGSSGPDSIPAQSPQKLTRRSSGLGELSRTWE |
| Ga0187846_100413211 | 3300021476 | Biofilm | MASVTQNFMKLFRGSSSSGSSAETPQAPQKLNRRSSGLGELSRLWESETPLCV |
| Ga0210398_108322081 | 3300021477 | Soil | MKFFRGSSGPETIPAQGSQKLTRRSSGLGELSRIWES |
| Ga0210398_110556951 | 3300021477 | Soil | MASVTQNFMKLFRGSSGGTEAALPQAAQKLTRRSSGLGEL |
| Ga0210409_100632105 | 3300021559 | Soil | MASVTQNFMKLFRGSSGGAEAAIPQVAQKLTRRSSGLAELS |
| Ga0210409_103107993 | 3300021559 | Soil | MATVAQNFMKLFRGSSSGSQAETPQGPQKLTRRSSGLGELAR |
| Ga0213851_13549662 | 3300021860 | Watersheds | MASVTQNFMKLFRGSSGSSEAATPHAAEKLTRRSSGLGELSRLWN |
| Ga0242642_10835292 | 3300022504 | Soil | MASVAQNFMKLFRGSSGGSETTTPAQASQKLTRRSSGLGEAARS |
| Ga0222728_10672412 | 3300022508 | Soil | MATVAQNFMKLFRGSSNSSQAETPQGPPKLTRRSS |
| Ga0242652_10314681 | 3300022510 | Soil | MASVTQNFMKLFRGSSGGTEAAAPQAAQKLTRRSSGLGELSRV |
| Ga0242660_11207982 | 3300022531 | Soil | MKLFRGSSGGTEATTSQGAQKLTRRSSSLGELSRVWEAD |
| Ga0242655_101448011 | 3300022532 | Soil | MASVAQNFMKLFRGSSGGSETTTPAQASQKLTRRSSGLGEAARSWDTEQTLCILD |
| Ga0242666_11803051 | 3300022721 | Soil | MKFFRGSSAPERPSAEAAEKLTRRSSGLGELSRSWE |
| Ga0242657_11497011 | 3300022722 | Soil | MASVTQNFMKLFRGSSGGTEAATPLAAQKLTRRSSGLGELSRVWE |
| Ga0242654_102090591 | 3300022726 | Soil | MKLFRGSSGGTEAATPQAAQKLTRRSSGLGELSRAWEADTPL |
| Ga0224550_10569672 | 3300022873 | Soil | MKLFRGSSGAETIPAQGAEKLTRRSSGLGELSRTWKTAEGLCVLDL |
| Ga0224550_10586342 | 3300022873 | Soil | MKLFRGSSGAETIPAQGAEKLTRRSSGLGELSRTWKTAEGLCVL |
| Ga0228597_1004001 | 3300023012 | Plant Litter | MSSVSQNFMKLFRGSSGPETIPAQGSQKLTRRSSGLGELSR |
| Ga0224560_1045001 | 3300023019 | Soil | VASVSQTFMKFFRGSSGPETIPAQGSQKLIRRSSGLGELSR |
| Ga0224564_11321341 | 3300024271 | Soil | MSSVSQTFMKLFRGSSGTETIPAQGSQKLTRRSSGLGELSRIWESA |
| Ga0208691_10844672 | 3300025612 | Peatland | MSSVSQTFMKLFRGSSGPDTIPAQGSQKLTRRSSGLGELT |
| Ga0207692_106249672 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVTQNFMKLFRGSSSSTSAQTPAATQKLTRRSSGLGELARLWNSETPLCVLD |
| Ga0207693_106832411 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVTQNFMKLFRSSSSSSPSETPQAQQKLTRRSSGL |
| Ga0209577_108441301 | 3300026552 | Soil | MKLFRGSSGGTQAQTPQTGQKPTRRSSGLGELSRVWNSES |
| Ga0207779_10174811 | 3300026928 | Tropical Forest Soil | MASVTQNFMKLFRGSSGGAEAVTPQPAQKLTRRSSGLGELSRLWESDSPL |
| Ga0208369_10288682 | 3300026998 | Forest Soil | MATVAQNFMKLFRGSSSGSQAETPQGPQKLTRRSSGLGELA |
| Ga0209419_10514581 | 3300027537 | Forest Soil | MASVTQNFMKLFRGSSGGTEANPAQAAQKLTRRSSGLGELS |
| Ga0209011_10591071 | 3300027678 | Forest Soil | MASVAQNFMKLFRGSSGGSETTTPAQASQKLTRRSSGLGEAARSWDTEQTLC |
| Ga0209908_100891921 | 3300027745 | Thawing Permafrost | MKLFRGSSGAETIPAQGAEKLTRRSSGLGELSRTWKTAE |
| Ga0209139_102650201 | 3300027795 | Bog Forest Soil | MKLFRGSSGTETIPVQGAQKLTRRSSGLGELSRMWESAEDLCIL |
| Ga0209580_100149381 | 3300027842 | Surface Soil | MKLFRGSSGSPESAENQAAQKLTRRSSGLGELSRL |
| Ga0209580_104339751 | 3300027842 | Surface Soil | MASVTQNFMKLFRGSTGGGTEATPSQAAQKLVRRSSSLGELARVWQTET |
| Ga0209274_100288781 | 3300027853 | Soil | MASVTQNFMKLFRGSSGGTEAATAQPAAKLTRRSSGLGELSRLWEGDSPLCV |
| Ga0209693_100299104 | 3300027855 | Soil | MKLFRGSSGGTEAALPQVAQKLTRRSSGLGELSRVWESETPL |
| Ga0209380_103590551 | 3300027889 | Soil | MKLFRGSSGPETIPEQGSQKLIRRSSGLGELSRTWESAEGLCV |
| Ga0209380_104112141 | 3300027889 | Soil | VSSVSQTFMKLFRGSSGPEAVPAQGSQKLTRRSSGL |
| Ga0209624_103155061 | 3300027895 | Forest Soil | VSSVSQTFMKLFRGSSGPETIPAQGSQKLTRRSSGLGELSRTW |
| Ga0209067_101894881 | 3300027898 | Watersheds | MATVAQNFMKLFRGSSSGSPAETPQVSQKLTRRSSGLGELARLW |
| Ga0209006_101030431 | 3300027908 | Forest Soil | MASVTQNFMKLFRGSSGGTDAATPPAAQKLTRRSSGLGELSRLWDSETPM |
| Ga0209698_1000464813 | 3300027911 | Watersheds | MASVTQNFMKLFRGSSSGTGAETPQAAQKLTRRSSGLGELSRLWESETPLCVLD |
| Ga0209698_112172611 | 3300027911 | Watersheds | MASVTQNFMKLFRGSSGGTEATTPHSAQKLTRRSSGLGELSRLWDSESP |
| Ga0302219_102809922 | 3300028747 | Palsa | MSSVSQNFMKLFRGSSGPEAIAEQGSQKLTRRSSGLGELSRTWES |
| Ga0302198_103103942 | 3300028765 | Bog | MSSVSQTFMKLFRGSSGPDTIPAQGSQKLTRRSSGLGELTRTWESAENLCILDLG |
| Ga0302222_103752091 | 3300028798 | Palsa | MKFFRGSSGMETAVPAPGVPKLTRRSSGLGELTRTWDAAENFCVL |
| Ga0302278_100326025 | 3300028866 | Bog | MKLFRGSSGPETIAEQGSQKLSRRSSGLGELSRTWESAEALCVLD |
| Ga0308309_102349871 | 3300028906 | Soil | MASVTHNFMKLFRGSAAGGTEAATAQAAQKLTRRSSGLGELSRLWDGDTPICVLD |
| Ga0222749_106741162 | 3300029636 | Soil | MASVSQNFMKLFRGSSGGAEAANPQPAQNLTRRSSGLGELSRLWDV |
| Ga0311369_107719171 | 3300029910 | Palsa | MKFFRGSGGAETAQAEAPLATRRSSGLAELARRWDS |
| Ga0311361_106297343 | 3300029911 | Bog | VSSVSQTFMKLFRGSSGPETIAAQGSQKLTRRSSGL |
| Ga0311330_107355251 | 3300029945 | Bog | MSSVSQTFMKLFRGSSGPDTIPAQGSQKLTRRSSGLGELTRT |
| Ga0311355_111477501 | 3300030580 | Palsa | MSSVSQTFMKLFRGSSGPETIPAQGSQKLTRRSSGLGELSRTWQSA |
| Ga0311354_100238238 | 3300030618 | Palsa | MSSVSQNFMKLFRGSSGAETIPAQGAEKLTRRSSGLGELSRTWKTAEGL |
| Ga0302180_100909511 | 3300031028 | Palsa | MKLFRGSSGGPEPPTSTQTSQRLNRRSSGLGEVARTWDTET |
| Ga0302180_105184841 | 3300031028 | Palsa | MSSVSQTFMKLFRGSSGTETIPAQGSQKLTRRSSGLGELSRT |
| Ga0170824_1056396311 | 3300031231 | Forest Soil | MASVTQNFMKLFRGSSGGTEAATPQAAQKLTRRSSGLGELSRLWDADSPLC |
| Ga0170824_1252184251 | 3300031231 | Forest Soil | MATVSQNFMKLFRGSSGRTPADAPDVAQKLTRRSSGLGELARLWESETPLC |
| Ga0308194_102886531 | 3300031421 | Soil | MASVTQNFMKLFRGSSGGPEATSPQASQKLTRRSSGLGESA |
| Ga0170820_151084261 | 3300031446 | Forest Soil | MASVTQNFMKLFRGSSGGTEAATPQAAQKLTRRSSGLGELSRLWDAD |
| Ga0307484_1128461 | 3300031663 | Hardwood Forest Soil | MASVTQNFMKLFRGSSGSPESAENQAAQKLTRRSSGLGELSRL |
| Ga0310686_1085233881 | 3300031708 | Soil | MASVSQNFMKLFRSSGGTEAALPQAAQKLTRRSSGLGELSRL |
| Ga0307469_102115653 | 3300031720 | Hardwood Forest Soil | MASVTHNFMKLFRGSSSGSAAETPQVSQKLTRRSSG |
| Ga0307473_110001352 | 3300031820 | Hardwood Forest Soil | MATVAQNFMKLFRGSSNSSQAETPQGAPKLTRRSSGLGELARLW |
| Ga0316050_1073632 | 3300031829 | Soil | MSSVSQNFMKLFRGSSGPETIPAQGSQKLTRRSSGLGELSRS |
| Ga0308175_1008395981 | 3300031938 | Soil | MASVTQNFMKLFRGTSSGTPAQTPQGGQKLTRRSSGLGELSRVWNSET |
| Ga0307479_105185863 | 3300031962 | Hardwood Forest Soil | MATVSQNFMKLFRGSSGRTPADAPDVAQKLTRRSSGLGELARLWESE |
| Ga0316053_1127521 | 3300032120 | Soil | VSAVSQTFMKFFRGSSGPETVPAQGSQKLTRRSSGLGELTRSWESA |
| Ga0311301_120667932 | 3300032160 | Peatlands Soil | VSSVSQTFMKLFRGSSGPETVPAQGSPKLTRRSSGLGEL |
| Ga0307471_1020126261 | 3300032180 | Hardwood Forest Soil | MASVTHNFMKLFRGSSGSTPAETSQAAQKLTRRSSGLGE |
| Ga0306920_1034377341 | 3300032261 | Soil | MASVTQNAMKLFRGSSSGSPAEPQIPQKLTRRSSGLSELARVWASETPL |
| Ga0348332_136341301 | 3300032515 | Plant Litter | MSSVSQNFMKLFRGSSGPEPTPAQGSQKLTRRSSGLGELSR |
| Ga0335082_111465702 | 3300032782 | Soil | MASVTQNFMKLFRGSSSGTQAETSQAAQKLTRRSSG |
| Ga0335076_110539302 | 3300032955 | Soil | MKLFRGSSGSAAGVEMATLQKAQRLTRRSSGLGELAKPL |
| Ga0335077_104315303 | 3300033158 | Soil | MKLFRGSSGSTPAETPQVAQKLTRRSSGLGELARLWDSETPLC |
| Ga0326724_0223390_3_155 | 3300034091 | Peat Soil | MSSVTQTFMKLFRGSSGPEAIPAQGSQKLTRRSSGLGELTRSWEAAEDLCV |
| ⦗Top⦘ |