| Basic Information | |
|---|---|
| Family ID | F038307 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 166 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MSHLENIATRQRKSLVRDALFVTFVALAAIVSISTVTQAVVASSVVAHR |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.25 % |
| % of genes near scaffold ends (potentially truncated) | 28.92 % |
| % of genes from short scaffolds (< 2000 bps) | 87.35 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.651 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.651 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.313 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.361 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 61.04% β-sheet: 0.00% Coil/Unstructured: 38.96% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF14681 | UPRTase | 63.25 |
| PF07958 | DUF1688 | 13.25 |
| PF01381 | HTH_3 | 1.81 |
| PF00496 | SBP_bac_5 | 1.81 |
| PF07883 | Cupin_2 | 1.20 |
| PF16697 | Yop-YscD_cpl | 0.60 |
| PF12483 | GIDE | 0.60 |
| PF04828 | GFA | 0.60 |
| PF00925 | GTP_cyclohydro2 | 0.60 |
| PF08308 | PEGA | 0.60 |
| PF02518 | HATPase_c | 0.60 |
| PF00067 | p450 | 0.60 |
| PF00069 | Pkinase | 0.60 |
| PF00909 | Ammonium_transp | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.41 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.60 |
| COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 0.60 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.60 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.65 % |
| Unclassified | root | N/A | 37.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100319792 | Not Available | 668 | Open in IMG/M |
| 3300001686|C688J18823_10875804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 570 | Open in IMG/M |
| 3300004153|Ga0063455_100202918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
| 3300004798|Ga0058859_11608520 | Not Available | 571 | Open in IMG/M |
| 3300004801|Ga0058860_11807813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 537 | Open in IMG/M |
| 3300004801|Ga0058860_12157993 | Not Available | 966 | Open in IMG/M |
| 3300005093|Ga0062594_101513816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 689 | Open in IMG/M |
| 3300005329|Ga0070683_100551852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1102 | Open in IMG/M |
| 3300005329|Ga0070683_101283717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 704 | Open in IMG/M |
| 3300005332|Ga0066388_102963075 | Not Available | 868 | Open in IMG/M |
| 3300005332|Ga0066388_104756967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 691 | Open in IMG/M |
| 3300005332|Ga0066388_104910496 | Not Available | 680 | Open in IMG/M |
| 3300005334|Ga0068869_100293365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300005334|Ga0068869_102121712 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005340|Ga0070689_100067917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2779 | Open in IMG/M |
| 3300005340|Ga0070689_100330996 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300005343|Ga0070687_100705295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300005345|Ga0070692_10639768 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005439|Ga0070711_101406957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300005440|Ga0070705_100624629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 837 | Open in IMG/M |
| 3300005441|Ga0070700_101256842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 620 | Open in IMG/M |
| 3300005458|Ga0070681_11487405 | Not Available | 602 | Open in IMG/M |
| 3300005466|Ga0070685_10652128 | Not Available | 763 | Open in IMG/M |
| 3300005466|Ga0070685_11073960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300005530|Ga0070679_100987101 | Not Available | 786 | Open in IMG/M |
| 3300005534|Ga0070735_10929073 | Not Available | 510 | Open in IMG/M |
| 3300005617|Ga0068859_101716136 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005617|Ga0068859_102949832 | Not Available | 520 | Open in IMG/M |
| 3300005713|Ga0066905_102054174 | Not Available | 531 | Open in IMG/M |
| 3300005764|Ga0066903_102743006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 8X | 956 | Open in IMG/M |
| 3300005836|Ga0074470_11235014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005881|Ga0075294_1035581 | Not Available | 525 | Open in IMG/M |
| 3300005937|Ga0081455_10225457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1386 | Open in IMG/M |
| 3300006028|Ga0070717_10380551 | Not Available | 1265 | Open in IMG/M |
| 3300006177|Ga0075362_10352087 | Not Available | 737 | Open in IMG/M |
| 3300006195|Ga0075366_10191758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1242 | Open in IMG/M |
| 3300006237|Ga0097621_100461372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1146 | Open in IMG/M |
| 3300006755|Ga0079222_11591192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300006755|Ga0079222_12125039 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300006954|Ga0079219_10782117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 745 | Open in IMG/M |
| 3300009098|Ga0105245_11108899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 838 | Open in IMG/M |
| 3300009101|Ga0105247_10971047 | Not Available | 661 | Open in IMG/M |
| 3300009156|Ga0111538_12044970 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009174|Ga0105241_12450035 | Not Available | 522 | Open in IMG/M |
| 3300009177|Ga0105248_10956855 | Not Available | 967 | Open in IMG/M |
| 3300009553|Ga0105249_13103859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300009792|Ga0126374_10402950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 957 | Open in IMG/M |
| 3300010046|Ga0126384_10943390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 782 | Open in IMG/M |
| 3300010046|Ga0126384_12201234 | Not Available | 531 | Open in IMG/M |
| 3300010047|Ga0126382_11421643 | Not Available | 634 | Open in IMG/M |
| 3300010337|Ga0134062_10375933 | Not Available | 690 | Open in IMG/M |
| 3300010358|Ga0126370_10784905 | Not Available | 847 | Open in IMG/M |
| 3300010360|Ga0126372_11592143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 692 | Open in IMG/M |
| 3300010362|Ga0126377_10972551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300010399|Ga0134127_10237195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1719 | Open in IMG/M |
| 3300010399|Ga0134127_12457069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 601 | Open in IMG/M |
| 3300010400|Ga0134122_12097677 | Not Available | 606 | Open in IMG/M |
| 3300010400|Ga0134122_12937708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300010401|Ga0134121_10005062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10738 | Open in IMG/M |
| 3300010403|Ga0134123_10489579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1154 | Open in IMG/M |
| 3300010403|Ga0134123_10886496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 896 | Open in IMG/M |
| 3300010403|Ga0134123_12106355 | Not Available | 624 | Open in IMG/M |
| 3300011431|Ga0137438_1033920 | Not Available | 1495 | Open in IMG/M |
| 3300011431|Ga0137438_1078818 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300011438|Ga0137451_1011413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2570 | Open in IMG/M |
| 3300011438|Ga0137451_1091459 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300011442|Ga0137437_1002083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 7075 | Open in IMG/M |
| 3300011442|Ga0137437_1083445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1092 | Open in IMG/M |
| 3300012212|Ga0150985_100206675 | Not Available | 1240 | Open in IMG/M |
| 3300012212|Ga0150985_103990582 | Not Available | 616 | Open in IMG/M |
| 3300012212|Ga0150985_107507788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 810 | Open in IMG/M |
| 3300012212|Ga0150985_114809684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 611 | Open in IMG/M |
| 3300012212|Ga0150985_120105753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 815 | Open in IMG/M |
| 3300012212|Ga0150985_121151376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 737 | Open in IMG/M |
| 3300012469|Ga0150984_113795836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300012469|Ga0150984_116588098 | Not Available | 1364 | Open in IMG/M |
| 3300012469|Ga0150984_123233565 | Not Available | 658 | Open in IMG/M |
| 3300012924|Ga0137413_10937094 | Not Available | 675 | Open in IMG/M |
| 3300012924|Ga0137413_11278201 | Not Available | 588 | Open in IMG/M |
| 3300012929|Ga0137404_10698864 | Not Available | 917 | Open in IMG/M |
| 3300012930|Ga0137407_11998581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 553 | Open in IMG/M |
| 3300012957|Ga0164303_10587874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300012971|Ga0126369_13012473 | Not Available | 551 | Open in IMG/M |
| 3300014325|Ga0163163_10292069 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300018051|Ga0184620_10135784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300018083|Ga0184628_10410218 | Not Available | 707 | Open in IMG/M |
| 3300018476|Ga0190274_12328019 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300019269|Ga0184644_1232056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 579 | Open in IMG/M |
| 3300019874|Ga0193744_1006663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2112 | Open in IMG/M |
| 3300019880|Ga0193712_1029623 | Not Available | 1176 | Open in IMG/M |
| 3300019880|Ga0193712_1080609 | Not Available | 710 | Open in IMG/M |
| 3300021082|Ga0210380_10334792 | Not Available | 690 | Open in IMG/M |
| 3300021445|Ga0182009_10304936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300022530|Ga0242658_1178349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 565 | Open in IMG/M |
| 3300022530|Ga0242658_1200900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300022531|Ga0242660_1240061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300022718|Ga0242675_1085802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 585 | Open in IMG/M |
| 3300022721|Ga0242666_1054872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 848 | Open in IMG/M |
| 3300022756|Ga0222622_10892134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 652 | Open in IMG/M |
| 3300023270|Ga0247784_1074281 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300025899|Ga0207642_10038118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2077 | Open in IMG/M |
| 3300025905|Ga0207685_10694424 | Not Available | 553 | Open in IMG/M |
| 3300025912|Ga0207707_11643126 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300025918|Ga0207662_10064033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2211 | Open in IMG/M |
| 3300025918|Ga0207662_10746269 | Not Available | 688 | Open in IMG/M |
| 3300025921|Ga0207652_10686618 | Not Available | 914 | Open in IMG/M |
| 3300025924|Ga0207694_11556337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 558 | Open in IMG/M |
| 3300025930|Ga0207701_11078198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 667 | Open in IMG/M |
| 3300025936|Ga0207670_10075398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2344 | Open in IMG/M |
| 3300025936|Ga0207670_11222980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 636 | Open in IMG/M |
| 3300025942|Ga0207689_10371336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1190 | Open in IMG/M |
| 3300025942|Ga0207689_11452074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 574 | Open in IMG/M |
| 3300025944|Ga0207661_11273478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 676 | Open in IMG/M |
| 3300026088|Ga0207641_10092635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2647 | Open in IMG/M |
| 3300026088|Ga0207641_11058414 | Not Available | 809 | Open in IMG/M |
| 3300027986|Ga0209168_10631375 | Not Available | 511 | Open in IMG/M |
| 3300028293|Ga0247662_1106645 | Not Available | 513 | Open in IMG/M |
| 3300028380|Ga0268265_11336651 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300028381|Ga0268264_11398802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300028381|Ga0268264_12412268 | Not Available | 532 | Open in IMG/M |
| 3300028732|Ga0302264_1000818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 8306 | Open in IMG/M |
| 3300028741|Ga0302256_10000006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 32608 | Open in IMG/M |
| 3300028786|Ga0307517_10057443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3769 | Open in IMG/M |
| 3300028794|Ga0307515_10006000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 24459 | Open in IMG/M |
| 3300028870|Ga0302254_10310931 | Not Available | 582 | Open in IMG/M |
| 3300029923|Ga0311347_10371234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 872 | Open in IMG/M |
| 3300029989|Ga0311365_10944553 | Not Available | 745 | Open in IMG/M |
| 3300030002|Ga0311350_10700570 | Not Available | 909 | Open in IMG/M |
| 3300030010|Ga0302299_10666236 | Not Available | 512 | Open in IMG/M |
| 3300030050|Ga0302255_1013654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1488 | Open in IMG/M |
| 3300030521|Ga0307511_10333104 | Not Available | 663 | Open in IMG/M |
| 3300030904|Ga0308198_1089155 | Not Available | 528 | Open in IMG/M |
| 3300030905|Ga0308200_1065980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 709 | Open in IMG/M |
| 3300031093|Ga0308197_10068284 | Not Available | 971 | Open in IMG/M |
| 3300031093|Ga0308197_10296118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 594 | Open in IMG/M |
| 3300031094|Ga0308199_1090026 | Not Available | 662 | Open in IMG/M |
| 3300031200|Ga0307496_10001030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2496 | Open in IMG/M |
| 3300031232|Ga0302323_100001263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 20544 | Open in IMG/M |
| 3300031232|Ga0302323_102975832 | Not Available | 541 | Open in IMG/M |
| 3300031238|Ga0265332_10066224 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300031421|Ga0308194_10258128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300031456|Ga0307513_10044442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae | 4866 | Open in IMG/M |
| 3300031474|Ga0170818_100465512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 582 | Open in IMG/M |
| 3300031507|Ga0307509_10037163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5325 | Open in IMG/M |
| 3300031507|Ga0307509_10044573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4791 | Open in IMG/M |
| 3300031507|Ga0307509_10054345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 4265 | Open in IMG/M |
| 3300031507|Ga0307509_10395417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
| 3300031616|Ga0307508_10798007 | Not Available | 561 | Open in IMG/M |
| 3300031715|Ga0307476_10095335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2094 | Open in IMG/M |
| 3300031720|Ga0307469_10498140 | Not Available | 1067 | Open in IMG/M |
| 3300031720|Ga0307469_11084252 | Not Available | 752 | Open in IMG/M |
| 3300031726|Ga0302321_103447234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300031938|Ga0308175_100000136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 56323 | Open in IMG/M |
| 3300031938|Ga0308175_101306510 | Not Available | 808 | Open in IMG/M |
| 3300032180|Ga0307471_104013179 | Not Available | 520 | Open in IMG/M |
| 3300033557|Ga0316617_100225278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300034643|Ga0370545_013517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1277 | Open in IMG/M |
| 3300034643|Ga0370545_036738 | Not Available | 905 | Open in IMG/M |
| 3300034643|Ga0370545_062440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 747 | Open in IMG/M |
| 3300034643|Ga0370545_086909 | Not Available | 662 | Open in IMG/M |
| 3300034643|Ga0370545_128394 | Not Available | 573 | Open in IMG/M |
| 3300034644|Ga0370548_065169 | Not Available | 678 | Open in IMG/M |
| 3300034644|Ga0370548_134478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300034659|Ga0314780_198118 | Not Available | 523 | Open in IMG/M |
| 3300034681|Ga0370546_027986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 786 | Open in IMG/M |
| 3300034681|Ga0370546_073306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.65% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 5.42% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 5.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.22% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.01% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.81% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.81% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.20% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.20% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Host-Associated | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030050 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1003197923 | 3300000364 | Soil | MSHLDNIAMRQRKSLVRDALFIAFVALAAIVSISTVTEAVVASSVVAHR* |
| C688J18823_108758041 | 3300001686 | Soil | MSHLQNIATRQRKSIVRDAFFAVVVAIAAVISISTVGQAVQASSIVAHR* |
| Ga0063455_1002029182 | 3300004153 | Soil | MSHLENIATRQRKSRVRDALFATFVALAAITAVTTVTQAVVASA |
| Ga0058859_116085201 | 3300004798 | Host-Associated | MSRLDNIATRQRKSLLRDALFASFVALAAIVSITTVTQVAAASSTVAHR* |
| Ga0058860_118078132 | 3300004801 | Host-Associated | QRPQNRKPEMSHLQNIATRQRKGLLRDALFVTFVALATIVSASTVTTAVQASSLVAHR* |
| Ga0058860_121579931 | 3300004801 | Host-Associated | MSHLDNIATRQRKGLVRDALFAAFIALAAIVSITTVTKAVVASSVAAHR* |
| Ga0062594_1015138161 | 3300005093 | Soil | MSHLQNIATRQRKGMLRDVVFVTLVALATVVSASTVSTAVQASSLIAHR* |
| Ga0070683_1005518522 | 3300005329 | Corn Rhizosphere | MSHLENIATRQRKSRVRDALFATFVALAAITAVTTVTQAVVASSPNQHR* |
| Ga0070683_1012837171 | 3300005329 | Corn Rhizosphere | MSHLENIAMRQRRSRVRDALFAAFVALAAITAVTTVTQAVVASSPSQHR* |
| Ga0066388_1029630752 | 3300005332 | Tropical Forest Soil | MNHLQNIAKRQRRNLLRDALFATFIALAAIVSITTVTQAVVASAMQHH* |
| Ga0066388_1047569671 | 3300005332 | Tropical Forest Soil | MSHLDNIATRQRKSLLRDALFVALVAIATIVSASTVTTAVQASSLVAHR* |
| Ga0066388_1049104962 | 3300005332 | Tropical Forest Soil | MSHLQNIAKRQRRSLIRDALFAAFIAVAAIVSITTVTQAVVASARLHR* |
| Ga0068869_1002933651 | 3300005334 | Miscanthus Rhizosphere | MSHLENIATRQRSGLLRDAIFATIVAIAAIVSISTVTQAVEASSHTLPR* |
| Ga0068869_1021217121 | 3300005334 | Miscanthus Rhizosphere | MGFSSAAMPQNRKSEMSHLQNIATRQRTGLIRDVVFVTLVAIATIVSASTVTTAV |
| Ga0070689_1000679174 | 3300005340 | Switchgrass Rhizosphere | MSHLDNIATRQRKGLVRDALFAAFIALAAIVSITTVTKAVVASSVVAHR* |
| Ga0070689_1003309961 | 3300005340 | Switchgrass Rhizosphere | MSHLQNIATRQRKGLLRDALFVTFVALATIVSASTVTTAVQASSLVAHR* |
| Ga0070687_1007052951 | 3300005343 | Switchgrass Rhizosphere | MSHLENIATRQRKGLVRDALFATLVAFAAFVSISTVTQAVVASSVVTHR* |
| Ga0070692_106397682 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYLENIATRQRKSRVRDALFATFVALAAITAVTTVTKAVVASSPSQHR* |
| Ga0070711_1014069572 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYLENIETRQRKSRIRDALFALFVALAAITAVTTVTKAVVMSSQSQHR* |
| Ga0070705_1006246292 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYLQNIAKRQRRNLLRDALFATFIALAAIVSITTVTQAVVASAMQHH* |
| Ga0070700_1012568421 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | ATRQRKGLLRDALFVTFVALATIVSASTVTTAVQASSLVAHR* |
| Ga0070681_114874051 | 3300005458 | Corn Rhizosphere | ATRQRKSLVRDTLFATFVALAAIVSITTVTKAVVASSASLHR* |
| Ga0070685_106521281 | 3300005466 | Switchgrass Rhizosphere | RQRKSLLRDALFASFVALAAIVSITTVTQVAAASSTVAHR* |
| Ga0070685_110739601 | 3300005466 | Switchgrass Rhizosphere | MSHLDNIATRQRKGLVRDAFFAAFIALAAIVSITTVTKAVVASSVVAHR* |
| Ga0070679_1009871012 | 3300005530 | Corn Rhizosphere | MSYLENIATRQRRSRVRDALFATFVALAAITAVTTVTKAVVASAPSQHR* |
| Ga0070735_109290731 | 3300005534 | Surface Soil | MSYLENIATRQRRSRVRDALFAAFVALAAITAVTTVTQAVVASSPSHHR* |
| Ga0068859_1017161361 | 3300005617 | Switchgrass Rhizosphere | MSHLQNIATRQRKGMLRDVVFVTLVALATVVSASTVSTAVQASSLVAHR* |
| Ga0068859_1029498321 | 3300005617 | Switchgrass Rhizosphere | MSHLDSIATRQRKSLVRDALFAALVALAAIVSITTVTQ |
| Ga0066905_1020541742 | 3300005713 | Tropical Forest Soil | MSHLENIATRQRKSRVRDALFATFVALAAITAVTTVTQAVVASSPILHR* |
| Ga0066903_1027430061 | 3300005764 | Tropical Forest Soil | MSHLQNIATRQRKSLVRDALFATFVALATIVSITTVTQAVVASSATLHR* |
| Ga0074470_112350142 | 3300005836 | Sediment (Intertidal) | MNHLDSITSRQRKSLVRDALFAAFVALAAIVSVTTVTQVAAASSAVARR* |
| Ga0075294_10355812 | 3300005881 | Rice Paddy Soil | MSHLENIATRQRIGLLRDVLFVALLAIATAVSASTVSKAVEASSAIVHR* |
| Ga0081455_102254572 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSHLQNIATRQRKGLVRDALFVTFVALAAIVSASTVTTAVQASSLVAHR* |
| Ga0070717_103805513 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHLDNIATRQRKSLVRDALFATFVALAAVVAISTVTQAVAASSVVAHR* |
| Ga0075362_103520871 | 3300006177 | Populus Endosphere | MRHLENIETRQRKSLVRDALFAMFVAIAAITAITTVSQAVVASAPIQHR* |
| Ga0075366_101917582 | 3300006195 | Populus Endosphere | MSRLDNIATRQRQSLVRDALFATFVALAAIVSISTVSQAVRASAQITQR* |
| Ga0097621_1004613722 | 3300006237 | Miscanthus Rhizosphere | MSRLDNIATRQRQSLVRDALFATFVALAAIVSISTVSQAVRASAQTTQR* |
| Ga0079222_115911922 | 3300006755 | Agricultural Soil | MSHLQNIETRQRKGLLRDALFVTFVALATIVSASTVTTAVQASSLVAHR* |
| Ga0079222_121250392 | 3300006755 | Agricultural Soil | MSHLENIAMRQRRSRVRDALFAAFVALAAITAVTTVTTAVVASSPSQHR* |
| Ga0079219_107821171 | 3300006954 | Agricultural Soil | HNRKSEMSHLQNIETRQRKGLLRDALFVTFVALATIVSASTVTTAVQASSLVAHR* |
| Ga0105245_111088991 | 3300009098 | Miscanthus Rhizosphere | MSHLENIASRQRKSRVRDALFATFVALAAITAITTVSQAVVASSPNQHR* |
| Ga0105247_109710472 | 3300009101 | Switchgrass Rhizosphere | MSYLENIATRQRKSRVRDALFAMFVALAAITAVTTVTKAVVASSTSQHR* |
| Ga0111538_120449702 | 3300009156 | Populus Rhizosphere | MSHLENIATRQRSGLLRDAIFATIVAIAAIVSISTVTQAVEA |
| Ga0105241_124500351 | 3300009174 | Corn Rhizosphere | MSHLENIATRQRSGLLRDAIFATIVAIAAIVSISTVTQAVEASSHTL |
| Ga0105248_109568551 | 3300009177 | Switchgrass Rhizosphere | MSYLENIATRQRKSRVRDALFAMFVALAAITAVTTVTKAVVASSPNQHR* |
| Ga0105249_131038592 | 3300009553 | Switchgrass Rhizosphere | SKMSHLDSITARQRKSRVRDALFAAFIALAAIVSISTLAQAVLASSVATHH* |
| Ga0126374_104029503 | 3300009792 | Tropical Forest Soil | MRHLENIATRQRKSLVRDALFALFVALAAITAITTVTQAVVASSASQHR* |
| Ga0126384_109433901 | 3300010046 | Tropical Forest Soil | MSHLENIATRQRKSRVRDALFATFVALAAITAVTTVTQAVVASSPSQHR* |
| Ga0126384_122012341 | 3300010046 | Tropical Forest Soil | MGHLENIAIRQRKSLVRDALFVTLVALATVVSISTFTKAVEASAVVAHR* |
| Ga0126382_114216432 | 3300010047 | Tropical Forest Soil | RHCRTNRKSNMRYLENIEKRQRKNLVRDALFATFIALAAIVSIATVTQAVVASSTAMHR* |
| Ga0134062_103759332 | 3300010337 | Grasslands Soil | MSYLQNIEKRQRRSLVRDALFATFVALATIVSVTTVAQAVLASATAVHR* |
| Ga0126370_107849051 | 3300010358 | Tropical Forest Soil | MSYLQNIAKRQRRSLVRDALFATFIALTAIVSITTVTQAVVASARLHH* |
| Ga0126372_115921432 | 3300010360 | Tropical Forest Soil | MSYLENIATRQRKSRVRDALFAAFVALAAITAVTTVTKAVVASSPSQHR* |
| Ga0126377_109725512 | 3300010362 | Tropical Forest Soil | MSNMNYLQNIAKRQRRNLLRDALFATFIALAAIVSITTVTQAVVASAMQHH* |
| Ga0134127_102371951 | 3300010399 | Terrestrial Soil | MGFSSAAMPQNRKSDMSHLQNIATRQRTGLIRDVVFVTLVAIATIVSASTVTTAVKASSLVAHR* |
| Ga0134127_124570691 | 3300010399 | Terrestrial Soil | QETDMSHLQNIATRQRKGMLRDVVFVTLVALATVVSASTVSTAVQASSLIAHR* |
| Ga0134122_120976772 | 3300010400 | Terrestrial Soil | MSHLENIATRQRKSIVRDAFFAALVAIAAILSISTVSQAVQASSIVAHR* |
| Ga0134122_129377081 | 3300010400 | Terrestrial Soil | SRNMRHLENIETRQRKSLVRDALFAMFVAIATITAITTVSQAVVASAPIQHR* |
| Ga0134121_100050622 | 3300010401 | Terrestrial Soil | MSHLDNIATRQRKSLVRDALFVAFVALAAIVSISTVTKAVVPSSVVAHR* |
| Ga0134123_104895791 | 3300010403 | Terrestrial Soil | MNHLEAIEARQRKSLLRDALFVALLAFATIVSVAPFTNAIVASAVVAHR* |
| Ga0134123_108864962 | 3300010403 | Terrestrial Soil | MGFSSAAMPQNRKSEMSHLQNIATRQRTGLIRDVVFVTLVAIATIVSASTVTTAVKASSLVAHR* |
| Ga0134123_121063551 | 3300010403 | Terrestrial Soil | MSYLENIATRQRKSRVRDALFAMFVALAAITAVTTVTKAVVASSPSQHR* |
| Ga0137438_10339204 | 3300011431 | Soil | MSHLENIATRQRKSLVRDALFAALVAIATVVSVSTVTQAVEASSVAAHR* |
| Ga0137438_10788182 | 3300011431 | Soil | MSHLDNIATRQRKSLVRDAIFAAFVAFATIMSISTVSTAVEASSTLVAHR* |
| Ga0137451_10114132 | 3300011438 | Soil | MSHLENIATRQRKSLVRDALFVTFVALASIVSISTVTQAVVASSVVAHR* |
| Ga0137451_10914592 | 3300011438 | Soil | MSHLDNIATRQRKSLVRDALFATLVALAAIVSISTVTQAVAASSVVAHR* |
| Ga0137437_10020834 | 3300011442 | Soil | MSHLENIATRQRKSLVRDALFVTFVALAAIVSISTVTQAVVASSVVAHG* |
| Ga0137437_10834453 | 3300011442 | Soil | SHLENIAKRQRKSLVRDAIFATFVALATIVSITTVTQVVVAGSALR* |
| Ga0150985_1002066752 | 3300012212 | Avena Fatua Rhizosphere | MSHLENIATRQKKSLVRDALFATFVALAAIVSISTVTQVAAASSAVAHR* |
| Ga0150985_1039905821 | 3300012212 | Avena Fatua Rhizosphere | HLENIATRQRKSRVRDALFATFVALAAITAVTTVTRAVVASSPNQHR* |
| Ga0150985_1075077881 | 3300012212 | Avena Fatua Rhizosphere | LPQKRETNMSHLDNIAIRQRKSLVRDALFAALVAVAAFVSISTVGQAAQASSIVAHR* |
| Ga0150985_1148096841 | 3300012212 | Avena Fatua Rhizosphere | HRAANRKSPKMSHLQNIATRQRKSIVRDAFFAVVVAIAAVISISTVGQAVQASSIVAHR* |
| Ga0150985_1201057532 | 3300012212 | Avena Fatua Rhizosphere | MSHLQNIATRQRKSLVRDALFAALVVVATILSISMVGQVVQASSIIAHR* |
| Ga0150985_1211513762 | 3300012212 | Avena Fatua Rhizosphere | AAPTGSRTMNKLQNIAARQRKSLVRDALFATFVALAAVVAASTVTQAVVAGAQFQHR* |
| Ga0150984_1137958362 | 3300012469 | Avena Fatua Rhizosphere | MNKLQNIAARQRKSLVRDALFATFVALAAVVAASTVTQAVVAGAQFQHR* |
| Ga0150984_1165880981 | 3300012469 | Avena Fatua Rhizosphere | MSHLENIATRQKHSLVRDALFAAFVALAAIVSISTVSQCASASSTVAHR* |
| Ga0150984_1232335651 | 3300012469 | Avena Fatua Rhizosphere | AAQQEVETMNKLQNIAARQRNGLVRDALFVTVVAFAAIVSASTVTQAVVASAQFQHR* |
| Ga0137413_109370941 | 3300012924 | Vadose Zone Soil | MSHLENIATRQRKSLVRDTLFVALVALATVVSASTVSQAVKASAIVAHR* |
| Ga0137413_112782011 | 3300012924 | Vadose Zone Soil | MPQKRKSQMSHLENIAIRQRKSLVRDALFASFVALATIVSITTVTQVAAASSTVAHR* |
| Ga0137404_106988643 | 3300012929 | Vadose Zone Soil | MSHLQDIATRQRHSLVLDALFVALLALAAIVAATTVTQAVKASSIAAPR* |
| Ga0137407_119985811 | 3300012930 | Vadose Zone Soil | MTRLDNIATRQRKSLVRDALFATLVALAAIVSISTVSQAVRASAQITQR* |
| Ga0164303_105878742 | 3300012957 | Soil | MNRLDTIASRQRKSRVRDVLFAALVAVAAAVSISSMHTAIVASSQIAHG* |
| Ga0126369_130124731 | 3300012971 | Tropical Forest Soil | MSKLQNIAKRQRRSLIRDALFAAFIAVAAIVSITTVTQAVVASASLHR* |
| Ga0163163_102920694 | 3300014325 | Switchgrass Rhizosphere | MSHLDNIATRQRKSRVRDALFATFVALAAITAVTTVTKAVVASSPSQHR* |
| Ga0184620_101357842 | 3300018051 | Groundwater Sediment | MSHLDNIATRQRKSLVRDALFATFVALAAIVSITTVTQVAAAGCAVAHR |
| Ga0184628_104102181 | 3300018083 | Groundwater Sediment | MSHLENIATRQRKSLVRDALFVTFVALAAIVSISTVTQAVVASSVVAHR |
| Ga0190274_123280192 | 3300018476 | Soil | MSHLQNIATRQRNGLLRDALFATLVAIATIVSASTVTTAVQASALVAHR |
| Ga0184644_12320562 | 3300019269 | Groundwater Sediment | GRITGSHHMSHLENIATRQRKSIVRDAFFAALVAIAAILSISTVGQAVQASSIVAHR |
| Ga0193744_10066632 | 3300019874 | Soil | MSHLENIAKRQRKSLVRDAIFATFVALATIVSITTVTQVVVAGSALR |
| Ga0193712_10296232 | 3300019880 | Soil | MSHLENIATRQRTGLVRDALFVTLVALATIVSVSTVSQAVKASSVVAHFVHR |
| Ga0193712_10806091 | 3300019880 | Soil | GFSSAATLQNRKPDMSHLENIENRQRKSLLRDAVFVALVAIATIVSASTVTTAVQASSLVAHR |
| Ga0210380_103347923 | 3300021082 | Groundwater Sediment | MSHLENIATRQRKSLVRDALFVTFVALAAIVSVSTVTQA |
| Ga0182009_103049361 | 3300021445 | Soil | MSHLENIATRQRKSRVRDALFATFVALAAITAVTTVTQAVVASAPNHR |
| Ga0242658_11783492 | 3300022530 | Soil | SPAEQEVATMSHLENIATRQRKSLVRDAFFAALVAVMAAVSISTLGHVAVQTGTMIAHR |
| Ga0242658_12009001 | 3300022530 | Soil | ASPGKLDMTRLDNIATRQRKSLVRDALFATLVALAAIVSISTVSQAVRMSSQTTQR |
| Ga0242660_12400611 | 3300022531 | Soil | REQRREVRMNRLDTIASRQRKSRVRDALFAALIAVAAAVSISSMHTAIVASSQIAHG |
| Ga0242675_10858021 | 3300022718 | Soil | TAAPTGSWNMRYLENIATRQRRSRVRDALFATFVALAAITAVTTVTQAVVASSPILHR |
| Ga0242666_10548721 | 3300022721 | Soil | TMSHLENIATRQRKSLVRDAFFAALVAVMAAVSISTLGHVAVQTGTMIAHR |
| Ga0222622_108921342 | 3300022756 | Groundwater Sediment | IMSHLQNIATRQRKGLLRDAFFVAALALAAIVSATSVTKAVEASSVIAHR |
| Ga0247784_10742813 | 3300023270 | Plant Litter | MKRGFLAAALAAETGSLNMSHLESIATRQRQGRLRDVLFVAIVAIAAVVSTSTVSQAVHASSIVAHR |
| Ga0207642_100381182 | 3300025899 | Miscanthus Rhizosphere | MSHLENIATRQRSGLLRDAIFATIVAIAAIVSISTVTQAVEASSHTLPR |
| Ga0207685_106944241 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHLDNIATRQRKSLVRDALFVAFVALAAIVSISTVTKAVVPSSVVAHR |
| Ga0207707_116431262 | 3300025912 | Corn Rhizosphere | MNKLQNIAARQRKSLVRDALFATFVALAVIVSASTVTQAVVASAQFQHR |
| Ga0207662_100640333 | 3300025918 | Switchgrass Rhizosphere | MSHLQNIATRQRKGMLRDVVFVTLVALATVVSASTVSTAVQASSLIAHR |
| Ga0207662_107462692 | 3300025918 | Switchgrass Rhizosphere | LDNIATRQRKGLVRDALFAAFIALAAIVSITTVTKAVVASSVVAHR |
| Ga0207652_106866182 | 3300025921 | Corn Rhizosphere | MSYLENIATRQRRSRVRDALFATFVALAAITAVTTVTKAVVASAPSQHR |
| Ga0207694_115563372 | 3300025924 | Corn Rhizosphere | MSHLENIATRQRKSRVRDALFAAFVALAAITAVTTVSQAVVASSPSQHR |
| Ga0207701_110781981 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | SHLENIAMRQRRSRVRDALFAAFVALAAITAVTTVTQAVVASSPSQHR |
| Ga0207670_100753984 | 3300025936 | Switchgrass Rhizosphere | MSHLDNIATRQRKGLVRDALFAAFIALAAIVSITTVTKAVVASSVVAHR |
| Ga0207670_112229802 | 3300025936 | Switchgrass Rhizosphere | MSHLQNIATRQRNGLLRDALFVALVAIATIVSASTVTTAVQASALVAHR |
| Ga0207689_103713362 | 3300025942 | Miscanthus Rhizosphere | MGHLESIATRQRKSLVRDAMFAALVTLAAIVSISSVGKAVQASSATVHTSSPALVAHR |
| Ga0207689_114520742 | 3300025942 | Miscanthus Rhizosphere | HLQNIATRQRKSLLRDALFATFVALAAIVSASTVTTAVQASSLVAHR |
| Ga0207661_112734781 | 3300025944 | Corn Rhizosphere | MSHLENIAMRQRRSRVRDALFAAFVALAAITAVTTVTQAVVASSPSQHR |
| Ga0207641_100926354 | 3300026088 | Switchgrass Rhizosphere | MSHLDNIATRQRKGLVRDAFFAAFIALAAIVSITTVTKAVVASSVVAHR |
| Ga0207641_110584141 | 3300026088 | Switchgrass Rhizosphere | MNYLQNIAKRQRRNLLRDALFATFIALAAIVSITTVTQAVVASAMQHH |
| Ga0209168_106313751 | 3300027986 | Surface Soil | MSYLENIATRQRRSRVRDALFAAFVALAAITAVTTVTQAVVASSPSHHR |
| Ga0247662_11066451 | 3300028293 | Soil | MSYLENIATRQRKSRVRDALFAMFVALAAITAVTTVTKAVVASSTSQHR |
| Ga0268265_113366511 | 3300028380 | Switchgrass Rhizosphere | MSHLENIATRQRSGLLRDAIFATIVAIAAIVSISTV |
| Ga0268264_113988022 | 3300028381 | Switchgrass Rhizosphere | MNYLQNIAKRQRRNLLRDALFATFIALAAIMSITTVTQAVVASAMQHH |
| Ga0268264_124122681 | 3300028381 | Switchgrass Rhizosphere | MSHLDNIATRQRKGLVRDALFAAFIALAAIVSITTVTKAVVASSVAAHR |
| Ga0302264_10008182 | 3300028732 | Fen | MNHLDSIASRQRKSLVRDAFFAALVAVAAFVSISTVGQAVHASSIVAHR |
| Ga0302256_1000000620 | 3300028741 | Fen | MNHLDSIATRQRKSLVRDAFFAALVAVAAFVSISTVGQAVHASSIVAHR |
| Ga0307517_100574434 | 3300028786 | Ectomycorrhiza | MSHLQNIATRQRKSLVRDVLFATLVALAAVVSVSTVSQAVHASSIVAHR |
| Ga0307515_100060009 | 3300028794 | Ectomycorrhiza | MSHLENIATRQRKSLVRDALFATFVALAAIVSITSVSKAVAASSATLHH |
| Ga0302254_103109311 | 3300028870 | Fen | MSHLENIAIRQRKSLVRDALFAALVAVAAFVSISTVGQAVQA |
| Ga0311347_103712342 | 3300029923 | Fen | MTHLDQIATRQRKSLVRDAVFAVIVAFAAIVSASTVSQVAAANATIAHR |
| Ga0311365_109445532 | 3300029989 | Fen | MSHLENIAIRQRKSLVRDALFAALVAVAAFVSISTVGQAVQASSIVAHR |
| Ga0311350_107005701 | 3300030002 | Fen | MNHLDNITSRQRKSLVRDALFATFVALAAIVSVTTVTQVAAASSAVAHR |
| Ga0302299_106662361 | 3300030010 | Fen | MSHLDNIAIRQRKSLVRDALFAALVAVAAFVSISTVGQAV |
| Ga0302255_10136543 | 3300030050 | Fen | NMNHLDSIASRQRKSLVRDAFFAALVAVAAFVSISTVGQAVHASSIVAHR |
| Ga0307511_103331042 | 3300030521 | Ectomycorrhiza | MSHLHNIATRQRNGLVRDALFAGFVALATISAVTTVTKAVVASAAVQHTHRS |
| Ga0308198_10891551 | 3300030904 | Soil | HNRKSRNMSHLENIATRQRKSIVRDAFFAALVAIAAILSISTVSQAVQASSIVAHR |
| Ga0308200_10659801 | 3300030905 | Soil | PQNRKSEMSHLQNIATRQRKGLLRDALFVTFVALATIVSASTVTTAVQASSLVAHR |
| Ga0308197_100682841 | 3300031093 | Soil | QTESLNMKHLDNIATRQRKSLVRDAFFAALVAVAAFVSISTVGQAVHASSIVAHR |
| Ga0308197_102961181 | 3300031093 | Soil | NAGQKRKSDMSHLENIATRQRKSLLRDALFVALVGIATIVSASTVTTAVRASSLVAHR |
| Ga0308199_10900262 | 3300031094 | Soil | ATRQRKSLVRDALFAMLIALAAIVSISTVGQAVVASSATMHR |
| Ga0307496_100010303 | 3300031200 | Soil | MSYLQNIATRQRKGLVRDALFATFIALAAIVSISTVGQAVVASSTTLHR |
| Ga0302323_10000126318 | 3300031232 | Fen | RQRKSLVRDAFFAALVAVAAFVSISTVGQAVHASSIVAHR |
| Ga0302323_1029758321 | 3300031232 | Fen | MSHLENIATRQRKSLVRDAIFATLVALVAIVSVSTVTQAV |
| Ga0265332_100662243 | 3300031238 | Rhizosphere | MRYLENIATRQRKSLVRDALFATFVALAAITAVTTVTHAVVMSSSIQHR |
| Ga0308194_102581281 | 3300031421 | Soil | MSHLENIATRQRKSIVRDAFFAALVAIAAILSISTVGQAVQASSIVAHR |
| Ga0307513_100444425 | 3300031456 | Ectomycorrhiza | RKSQMSHLDNIAIRQRKSLVRDALFATFVALATIVSITTVTQVAAASSTVAHR |
| Ga0170818_1004655121 | 3300031474 | Forest Soil | AATGSRNMRHLDDITMRQRKSLVRDALFATFIALAAVVSITTVSKAVVASSTIQHR |
| Ga0307509_100371634 | 3300031507 | Ectomycorrhiza | MSHLENIATRQKKSLVRDALFATFVALAAIVSISTVTQVAAASSAVAHR |
| Ga0307509_100445736 | 3300031507 | Ectomycorrhiza | MNKLQNIAARQRKSLVRDALFATFVALAAVVAASTVTQAVVPGAQFQHR |
| Ga0307509_100543454 | 3300031507 | Ectomycorrhiza | MSHLENIATRQRKSLVRDAIFATFVALAAIVSITTVTQVVVAGSALR |
| Ga0307509_103954171 | 3300031507 | Ectomycorrhiza | MSHLQNIATRQRKSLVRDVLFATLVALAAIVSVSTVSQAVHASSIVAHR |
| Ga0307508_107980072 | 3300031616 | Ectomycorrhiza | MNHLDNIASRQRKSLVRDALFATFVALAAIVSVTTVTQVAAANAAVAHR |
| Ga0307476_100953352 | 3300031715 | Hardwood Forest Soil | MSHLENIATRQRKSRVRDALFATFVALAAITAVTTVSQAVVASSPSQHR |
| Ga0307469_104981402 | 3300031720 | Hardwood Forest Soil | MSHLENIATRQRKSRIRDALFATFVALAAITAASTVTKAVVASAPGQHR |
| Ga0307469_110842522 | 3300031720 | Hardwood Forest Soil | MSHLDNIATRQRKGLVRDALFAAFIALAAIVSITTVTKAVVASSVVAHG |
| Ga0302321_1034472342 | 3300031726 | Fen | MSHLENIATRQRKSLVRDAIFATLVALVAIVSVSTVTQAVEASCVVAHR |
| Ga0308175_10000013638 | 3300031938 | Soil | MSHLDNIAARHRKGLVRDAFFAAFIALAAIASITTVTKAVVASAVVAHR |
| Ga0308175_1013065101 | 3300031938 | Soil | MNKLQNIAARQRKSLVRDALFATFVALAAIVSATTVTQAVVASAQFQHR |
| Ga0307471_1040131791 | 3300032180 | Hardwood Forest Soil | MSYLENIATRQRKSRIRDALFATFVALAAITALTTVTKAVVMSSPSQHR |
| Ga0316617_1002252782 | 3300033557 | Soil | MNHLDNIASRQRKSLVRDALFATFVALATIVSVTTVTQVAAASSVAAHR |
| Ga0370545_013517_894_1043 | 3300034643 | Soil | MSHLDNIAARQRKSLVRDALFATLVAFATLVSISTVTQAVHASSVVAHR |
| Ga0370545_036738_28_174 | 3300034643 | Soil | MSHLDNIATRQRKSLVRDALFATLVALAAIVSISTVTQAVAASSVVAH |
| Ga0370545_062440_570_746 | 3300034643 | Soil | MPAQQEVQIMSHLDNIATRQRKSLLRDALFVTALAFAAIVSATSVTKAVEASSVIAHR |
| Ga0370545_086909_25_174 | 3300034643 | Soil | MSHLENIATRQRKSLVRDALFAALVALVAIVSVSTVTQAVEASCVVAHR |
| Ga0370545_128394_24_173 | 3300034643 | Soil | MSHLDNIAARQRKSLVRDAIFAAFVAFAAIVSISTVGTAVHASSVVAHR |
| Ga0370548_065169_3_176 | 3300034644 | Soil | MPQKRKSQMSRLDNIATRQRKSLVRDALFASFVALATIVSITTVTQVAAASSTIAHR |
| Ga0370548_134478_365_514 | 3300034644 | Soil | MSHLENIAIRQRKSLVRDAVFAALVAVAAFVSISTVGQAVQASSIVAHR |
| Ga0314780_198118_352_501 | 3300034659 | Soil | MSHLDNIAIRQRKSLVRDALFASFVALATIVSVTTVTQVAAASSTVAHR |
| Ga0370546_027986_24_173 | 3300034681 | Soil | MSHLDNIATRQRKSLLRDALFVTALAFAAIVSATSVTKAVQASSVIAHR |
| Ga0370546_073306_27_176 | 3300034681 | Soil | MSHLENIATRQRKSIVRDAFFAALVAIAAILSISTVSQAVQASSIVAHR |
| ⦗Top⦘ |