| Basic Information | |
|---|---|
| Family ID | F038232 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 166 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNKINGDKLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 78.66 % |
| % of genes near scaffold ends (potentially truncated) | 16.27 % |
| % of genes from short scaffolds (< 2000 bps) | 56.02 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (69.880 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic (19.880 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.458 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.494 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 9.21% Coil/Unstructured: 65.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF11171 | DUF2958 | 14.46 |
| PF02467 | Whib | 4.82 |
| PF12957 | DUF3846 | 3.01 |
| PF01464 | SLT | 2.41 |
| PF03457 | HA | 1.20 |
| PF00271 | Helicase_C | 1.20 |
| PF03692 | CxxCxxCC | 1.20 |
| PF06067 | DUF932 | 1.20 |
| PF01381 | HTH_3 | 1.20 |
| PF01844 | HNH | 0.60 |
| PF13419 | HAD_2 | 0.60 |
| PF05065 | Phage_capsid | 0.60 |
| PF00291 | PALP | 0.60 |
| PF00454 | PI3_PI4_kinase | 0.60 |
| PF00691 | OmpA | 0.60 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.60 |
| PF02668 | TauD | 0.60 |
| PF02371 | Transposase_20 | 0.60 |
| PF13619 | KTSC | 0.60 |
| PF00899 | ThiF | 0.60 |
| PF03167 | UDG | 0.60 |
| PF13489 | Methyltransf_23 | 0.60 |
| PF14464 | Prok-JAB | 0.60 |
| PF04851 | ResIII | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.60 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.60 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.60 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.60 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.57 % |
| Unclassified | root | N/A | 8.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10018761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2569 | Open in IMG/M |
| 3300000756|JGI12421J11937_10068425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1074 | Open in IMG/M |
| 3300002161|JGI24766J26685_10131415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300002396|B570J29629_1009347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300002408|B570J29032_109088721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300002408|B570J29032_109148513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300002408|B570J29032_109475215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300002408|B570J29032_109850525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1649 | Open in IMG/M |
| 3300002835|B570J40625_100003457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29586 | Open in IMG/M |
| 3300002835|B570J40625_100014399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13944 | Open in IMG/M |
| 3300002835|B570J40625_100017776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12249 | Open in IMG/M |
| 3300002835|B570J40625_100045658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6379 | Open in IMG/M |
| 3300002835|B570J40625_100290061 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
| 3300002835|B570J40625_100928628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300003493|JGI25923J51411_1000770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6158 | Open in IMG/M |
| 3300004240|Ga0007787_10000120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22141 | Open in IMG/M |
| 3300005580|Ga0049083_10001479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8900 | Open in IMG/M |
| 3300005580|Ga0049083_10008144 | All Organisms → Viruses → Predicted Viral | 3879 | Open in IMG/M |
| 3300005580|Ga0049083_10043683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1589 | Open in IMG/M |
| 3300005580|Ga0049083_10067450 | Not Available | 1254 | Open in IMG/M |
| 3300005580|Ga0049083_10083184 | Not Available | 1116 | Open in IMG/M |
| 3300005580|Ga0049083_10124874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300005580|Ga0049083_10325922 | Not Available | 512 | Open in IMG/M |
| 3300005581|Ga0049081_10093654 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300005582|Ga0049080_10270570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300005583|Ga0049085_10000273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21330 | Open in IMG/M |
| 3300005583|Ga0049085_10000377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17866 | Open in IMG/M |
| 3300005583|Ga0049085_10006869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4498 | Open in IMG/M |
| 3300005583|Ga0049085_10119355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300005584|Ga0049082_10000505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11199 | Open in IMG/M |
| 3300005584|Ga0049082_10001501 | Not Available | 7299 | Open in IMG/M |
| 3300005584|Ga0049082_10031724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1848 | Open in IMG/M |
| 3300005584|Ga0049082_10060761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1326 | Open in IMG/M |
| 3300005585|Ga0049084_10006654 | Not Available | 4826 | Open in IMG/M |
| 3300005585|Ga0049084_10030480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2101 | Open in IMG/M |
| 3300005662|Ga0078894_10177852 | All Organisms → Viruses → Predicted Viral | 1921 | Open in IMG/M |
| 3300005662|Ga0078894_10238684 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
| 3300005662|Ga0078894_11341642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300005662|Ga0078894_11474426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300005758|Ga0078117_1011463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13430 | Open in IMG/M |
| 3300006484|Ga0070744_10125548 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 739 | Open in IMG/M |
| 3300006484|Ga0070744_10226556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300006641|Ga0075471_10226155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300007562|Ga0102915_1306268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300007603|Ga0102921_1347314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300007639|Ga0102865_1023509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1774 | Open in IMG/M |
| 3300007639|Ga0102865_1233234 | Not Available | 548 | Open in IMG/M |
| 3300007973|Ga0105746_1047966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1338 | Open in IMG/M |
| 3300007973|Ga0105746_1078584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
| 3300007992|Ga0105748_10166572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300008055|Ga0108970_11018421 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300008107|Ga0114340_1010254 | All Organisms → Viruses → Predicted Viral | 4668 | Open in IMG/M |
| 3300008107|Ga0114340_1027637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5146 | Open in IMG/M |
| 3300008110|Ga0114343_1004042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8069 | Open in IMG/M |
| 3300008110|Ga0114343_1090132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300008113|Ga0114346_1033529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2674 | Open in IMG/M |
| 3300008113|Ga0114346_1095921 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300008120|Ga0114355_1228861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300008120|Ga0114355_1230351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300008261|Ga0114336_1043515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2826 | Open in IMG/M |
| 3300008962|Ga0104242_1055174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300009051|Ga0102864_1224616 | Not Available | 510 | Open in IMG/M |
| 3300009152|Ga0114980_10000137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 47709 | Open in IMG/M |
| 3300009152|Ga0114980_10200678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300009155|Ga0114968_10171121 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300009155|Ga0114968_10219784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1093 | Open in IMG/M |
| 3300009158|Ga0114977_10006040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7690 | Open in IMG/M |
| 3300009158|Ga0114977_10374346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 798 | Open in IMG/M |
| 3300009181|Ga0114969_10000243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 45948 | Open in IMG/M |
| 3300009181|Ga0114969_10040432 | All Organisms → Viruses → Predicted Viral | 3168 | Open in IMG/M |
| 3300009181|Ga0114969_10737485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300009183|Ga0114974_10041948 | All Organisms → Viruses → Predicted Viral | 3105 | Open in IMG/M |
| 3300009183|Ga0114974_10067226 | All Organisms → Viruses → Predicted Viral | 2359 | Open in IMG/M |
| 3300009183|Ga0114974_10512240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300009184|Ga0114976_10355886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 773 | Open in IMG/M |
| 3300009185|Ga0114971_10713353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300009466|Ga0126448_1017217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1753 | Open in IMG/M |
| 3300009474|Ga0127390_1012041 | Not Available | 2594 | Open in IMG/M |
| 3300010354|Ga0129333_10269517 | All Organisms → Viruses → Predicted Viral | 1530 | Open in IMG/M |
| 3300010885|Ga0133913_10002616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 44197 | Open in IMG/M |
| 3300010885|Ga0133913_10085631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8453 | Open in IMG/M |
| 3300010885|Ga0133913_13629831 | Not Available | 1001 | Open in IMG/M |
| 3300013004|Ga0164293_10032934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4289 | Open in IMG/M |
| 3300013004|Ga0164293_10104153 | All Organisms → Viruses → Predicted Viral | 2173 | Open in IMG/M |
| 3300013005|Ga0164292_10059300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2983 | Open in IMG/M |
| 3300013372|Ga0177922_10001646 | Not Available | 1454 | Open in IMG/M |
| 3300013372|Ga0177922_10500302 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
| 3300017766|Ga0181343_1112500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300017766|Ga0181343_1188535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300017766|Ga0181343_1227057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300019784|Ga0181359_1031990 | All Organisms → Viruses → Predicted Viral | 2035 | Open in IMG/M |
| 3300020141|Ga0211732_1141046 | All Organisms → Viruses → Predicted Viral | 2721 | Open in IMG/M |
| 3300020141|Ga0211732_1349194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3836 | Open in IMG/M |
| 3300020151|Ga0211736_10751633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300020151|Ga0211736_10963387 | All Organisms → Viruses → Predicted Viral | 3539 | Open in IMG/M |
| 3300020151|Ga0211736_11011275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8685 | Open in IMG/M |
| 3300020159|Ga0211734_10918825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300020498|Ga0208050_1003530 | All Organisms → Viruses → Predicted Viral | 1997 | Open in IMG/M |
| 3300020521|Ga0208482_1042095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300020526|Ga0208085_1037015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300020527|Ga0208232_1000666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6669 | Open in IMG/M |
| 3300020556|Ga0208486_1018380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300021141|Ga0214163_1005164 | All Organisms → Viruses → Predicted Viral | 4800 | Open in IMG/M |
| 3300021519|Ga0194048_10000633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17182 | Open in IMG/M |
| 3300022752|Ga0214917_10089877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
| 3300023174|Ga0214921_10000249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 106648 | Open in IMG/M |
| 3300023179|Ga0214923_10291410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300023184|Ga0214919_10243482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
| 3300024239|Ga0247724_1003025 | All Organisms → Viruses → Predicted Viral | 2801 | Open in IMG/M |
| 3300024346|Ga0244775_10049067 | All Organisms → Viruses → Predicted Viral | 3682 | Open in IMG/M |
| 3300024346|Ga0244775_10132001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2113 | Open in IMG/M |
| 3300024346|Ga0244775_10170579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1832 | Open in IMG/M |
| 3300024348|Ga0244776_10926150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300024483|Ga0255224_1076671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300027563|Ga0209552_1009628 | All Organisms → Viruses → Predicted Viral | 3008 | Open in IMG/M |
| 3300027586|Ga0208966_1000332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15070 | Open in IMG/M |
| 3300027586|Ga0208966_1003036 | Not Available | 5156 | Open in IMG/M |
| 3300027586|Ga0208966_1041131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
| 3300027586|Ga0208966_1178711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300027621|Ga0208951_1004645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5124 | Open in IMG/M |
| 3300027621|Ga0208951_1006349 | All Organisms → Viruses → Predicted Viral | 4238 | Open in IMG/M |
| 3300027621|Ga0208951_1011008 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Pacebacteria → Candidatus Pacebacteria bacterium CG10_big_fil_rev_8_21_14_0_10_40_26 | 3034 | Open in IMG/M |
| 3300027621|Ga0208951_1028541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1716 | Open in IMG/M |
| 3300027621|Ga0208951_1111878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300027627|Ga0208942_1000297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21650 | Open in IMG/M |
| 3300027627|Ga0208942_1000548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14920 | Open in IMG/M |
| 3300027627|Ga0208942_1014783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2557 | Open in IMG/M |
| 3300027649|Ga0208960_1059428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
| 3300027649|Ga0208960_1086797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
| 3300027754|Ga0209596_1000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 171522 | Open in IMG/M |
| 3300027754|Ga0209596_1001915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17435 | Open in IMG/M |
| 3300027759|Ga0209296_1280402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300027797|Ga0209107_10161055 | Not Available | 1138 | Open in IMG/M |
| 3300027797|Ga0209107_10346120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300027805|Ga0209229_10006099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5037 | Open in IMG/M |
| 3300027805|Ga0209229_10010154 | All Organisms → Viruses → Predicted Viral | 3967 | Open in IMG/M |
| 3300027805|Ga0209229_10104921 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
| 3300027973|Ga0209298_10000271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34185 | Open in IMG/M |
| 3300028113|Ga0255234_1078056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300031857|Ga0315909_10174905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1733 | Open in IMG/M |
| 3300031951|Ga0315904_10272858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1603 | Open in IMG/M |
| 3300032050|Ga0315906_10416335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1165 | Open in IMG/M |
| 3300032050|Ga0315906_10859920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300033980|Ga0334981_0002764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11260 | Open in IMG/M |
| 3300033981|Ga0334982_0302065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300033992|Ga0334992_0000029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 144450 | Open in IMG/M |
| 3300033992|Ga0334992_0034141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3009 | Open in IMG/M |
| 3300033992|Ga0334992_0034704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2980 | Open in IMG/M |
| 3300033992|Ga0334992_0129349 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
| 3300033993|Ga0334994_0144339 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
| 3300033995|Ga0335003_0004597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6940 | Open in IMG/M |
| 3300034082|Ga0335020_0000090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 68525 | Open in IMG/M |
| 3300034082|Ga0335020_0235270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300034102|Ga0335029_0343671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300034102|Ga0335029_0447109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300034104|Ga0335031_0582179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300034106|Ga0335036_0020341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5337 | Open in IMG/M |
| 3300034106|Ga0335036_0032478 | All Organisms → Viruses → Predicted Viral | 4097 | Open in IMG/M |
| 3300034106|Ga0335036_0784608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300034116|Ga0335068_0308723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300034122|Ga0335060_0057178 | All Organisms → Viruses → Predicted Viral | 2443 | Open in IMG/M |
| 3300034200|Ga0335065_0003258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11534 | Open in IMG/M |
| 3300034200|Ga0335065_0114763 | All Organisms → Viruses → Predicted Viral | 1818 | Open in IMG/M |
| 3300034284|Ga0335013_0078890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2334 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 19.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.47% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.63% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.61% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.01% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.41% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.41% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.81% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.20% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.20% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.60% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.60% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.60% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.60% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002396 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020521 | Freshwater microbial communities from Lake Mendota, WI - 26SEP2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020526 | Freshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_1001876110 | 3300000756 | Freshwater And Sediment | MKKINANKLRKKLQKLIPNSSFDKDNEGQVIIYTGLKETKDGNYKELS* |
| JGI12421J11937_100684251 | 3300000756 | Freshwater And Sediment | INGNKLRKKLHKLLPNSSFDEDNEGQVIIYTGLKETKNGNYKELS* |
| JGI24766J26685_101314151 | 3300002161 | Freshwater And Sediment | MKTIDGDKLRKALEKLIPSCDMDVDNEGQVIIYTNLKELRNGNYKXIK* |
| B570J29629_10093473 | 3300002396 | Freshwater | MKNXDGEKLRKALEKLIPSCDLDVDNEGQVIIYTNLKETKNGNYKKIK* |
| B570J29032_1090887211 | 3300002408 | Freshwater | MKTIDGDRLRKALEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK* |
| B570J29032_1091485132 | 3300002408 | Freshwater | MMDGLQMNKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMK* |
| B570J29032_1094752152 | 3300002408 | Freshwater | MSKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| B570J29032_1098505253 | 3300002408 | Freshwater | MKNIDGEKLRKALEKLIPSCDLDVDNEGQVIIYTNLKETKNGNYKKIK* |
| B570J40625_10000345752 | 3300002835 | Freshwater | MNKIDGDQLRNNLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| B570J40625_10001439918 | 3300002835 | Freshwater | MMDGLQMSKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| B570J40625_10001777618 | 3300002835 | Freshwater | MKTIDGDKLRKALEKLIPSCDMDVDNEGQVIIYTNLKELRNGNYKEIK* |
| B570J40625_1000456584 | 3300002835 | Freshwater | MSKIDGDKLRSKIEKLLPNCSFDEDNEGQVVIYTNLKETTNGNYKELK* |
| B570J40625_1002900615 | 3300002835 | Freshwater | NKLRKQLEKLIPTCDLDVDNEGQVIIYTNLRELRNGNYKEIN* |
| B570J40625_1009286281 | 3300002835 | Freshwater | MNKIDGDQLRNNLEKLMPNCSFDEDNEGQVIIYTNLKETTDGNYKELK* |
| JGI25923J51411_100077011 | 3300003493 | Freshwater Lake | MKTKTIDGNKLRKQLEKLIPTCDMDVDNEGQVIIYTNLRELRNGDYKEIN* |
| Ga0007787_100001204 | 3300004240 | Freshwater Lake | MRKINGKKLRKKLHKILPNSSFDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0049083_100014796 | 3300005580 | Freshwater Lentic | MRKINGKKLRKKLEKLIPTSSFGEDNEGQVIIYTGLKETKDGNYKDLS* |
| Ga0049083_100081442 | 3300005580 | Freshwater Lentic | MKTIDGNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKEIK* |
| Ga0049083_100436836 | 3300005580 | Freshwater Lentic | MNKIDGDQLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0049083_100674503 | 3300005580 | Freshwater Lentic | MTKINGNKLRKKLQKLLPYIYFDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0049083_100831841 | 3300005580 | Freshwater Lentic | MRKINGNKLRKKLHKLLPYIYIDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0049083_101248741 | 3300005580 | Freshwater Lentic | MNKIDGDQLRNKLEKLMPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0049083_103259222 | 3300005580 | Freshwater Lentic | MRKINGNKLRKKLQKLLPYIYFDKDNEGQVIIYTGLKETKDGNYKELS* |
| Ga0049081_100936542 | 3300005581 | Freshwater Lentic | MNKINGDQLRNKLEKLLPNCSFDKDNEGQVIIYTNLKETANGNYKELK* |
| Ga0049080_102705702 | 3300005582 | Freshwater Lentic | MNKINGNKLRKKLQKLLPGSSFDEDNEGQVIIYTGLKETTNGNYKELK* |
| Ga0049085_100002732 | 3300005583 | Freshwater Lentic | MSKINGNKLRKKLHKILPYIYIDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0049085_1000037717 | 3300005583 | Freshwater Lentic | MKKKINGKKLRKKLDKLIPTSSFSEDNEGQFIIYTGLKETENGNYKELS* |
| Ga0049085_100068692 | 3300005583 | Freshwater Lentic | MRKINGNKLRKKLQKLLPYIYLDKDNEGQVIIYTGLKETKDGNYKELS* |
| Ga0049085_101193552 | 3300005583 | Freshwater Lentic | MRKINGNKLRKKLHKLLPYIYIDKDNEGQVIIYTGLKETKDGNYKELS* |
| Ga0049082_100005051 | 3300005584 | Freshwater Lentic | MRKINGNKLRKKLQKLIPNFSFDKDNEGQVIIYTGLKETKDGNYKELK* |
| Ga0049082_100015014 | 3300005584 | Freshwater Lentic | MNGQKLRSKLEKLMPNCAMEEDNDGQVIIYTNLIEDDNGNYEEITE* |
| Ga0049082_100317246 | 3300005584 | Freshwater Lentic | VKKINGNKLRKKLHKILPYIYIDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0049082_100607613 | 3300005584 | Freshwater Lentic | MKKINGNKLRKKLQKILPYIYIDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0049084_100066541 | 3300005585 | Freshwater Lentic | RKMKNIDGDKLRKALEKLIPSCDLDVDNEGQVIIYTNLKETKNGNYKKIK* |
| Ga0049084_100304802 | 3300005585 | Freshwater Lentic | MSKINGNKLRKKLQKLLPYIYFDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0078894_101778522 | 3300005662 | Freshwater Lake | MKTKTIDGNKLRKQLEKLIPTCDLDVDNEGQVIIYTNLRELRNGNYKEIK* |
| Ga0078894_102386841 | 3300005662 | Freshwater Lake | MKTKTIDGDKLRKQLEKLIPTCDFDVDNEGQVIIYTNLRELRNGNYKEIK* |
| Ga0078894_113416422 | 3300005662 | Freshwater Lake | MKTIDGDKLRKALEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK* |
| Ga0078894_114744263 | 3300005662 | Freshwater Lake | MMDGLRMNKINGDKLRNKLEKLLPNCSFDEDNEGQVIIYTNLKET |
| Ga0078117_10114635 | 3300005758 | Lake Water | MKAKTIDGDKLRKQLEKLIPTCDMDVDNEGQVIIYTNLRELRNGDYKEIN* |
| Ga0070744_101255483 | 3300006484 | Estuarine | MKKINGNKLRKKLHKLLPNSSFGEDNEGQVIIYTGLKETKNENYKELS* |
| Ga0070744_102265562 | 3300006484 | Estuarine | MRKINGKKLRKKLEKLIPTSSFGEDNEGQVIIYTGLKEIKDGNYKDLS* |
| Ga0075471_102261551 | 3300006641 | Aqueous | VGTYIDGKKLREALEKLMPNCNLDVDNEGQVIIYTNLKEISNGNYKEIQ* |
| Ga0102915_13062683 | 3300007562 | Estuarine | MNKINGDQLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0102921_13473142 | 3300007603 | Estuarine | MKTIDGNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK* |
| Ga0102865_10235093 | 3300007639 | Estuarine | MNKINGNKLRKKLQKLLPGSSFDKDNEGQVIIYTGLKETTNGNYKELK* |
| Ga0102865_12332342 | 3300007639 | Estuarine | MKKINGNKLRKKLQKLLPYIYIDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0105746_10479666 | 3300007973 | Estuary Water | VKKINGKKLRKKLEKLILTSSFGEDNEGQVVIYTGLKETKDGNYKDLS* |
| Ga0105746_10785842 | 3300007973 | Estuary Water | MKTIDGDKLRKALAKLIPTCDFDVDNEGQEIIYTNLKELKNGNYKEIK* |
| Ga0105748_101665725 | 3300007992 | Estuary Water | MKKINGNKLRKKLHKILPNSSFDKDNEGQVIIYTGLKETKNENYKELS* |
| Ga0108970_110184215 | 3300008055 | Estuary | MKTIDGEKLRKKLEKLIPSCDMDTDNEGQVIIYTNLKETKNGNYKEI |
| Ga0114340_101025413 | 3300008107 | Freshwater, Plankton | MSKIDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0114340_10276371 | 3300008107 | Freshwater, Plankton | VKINGDKLRAKLEKLIPNCAFDTDNEGQVIIYTNLKE |
| Ga0114343_100404217 | 3300008110 | Freshwater, Plankton | VKINGDKLRAKLEKLIPNCAFDTDNEGQVIIYTNLKETKSGNYRDMDERS* |
| Ga0114343_10901322 | 3300008110 | Freshwater, Plankton | MSKVDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETASGNYKEMK* |
| Ga0114346_10335292 | 3300008113 | Freshwater, Plankton | MSKIDGDKLRSKLEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMK* |
| Ga0114346_10959213 | 3300008113 | Freshwater, Plankton | MKTKTIDGNKLRKQLEKLIPTCDFDVDNEGQVIIYTNLRELRNGNYKEIK* |
| Ga0114355_10589211 | 3300008120 | Freshwater, Plankton | IEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0114355_12288611 | 3300008120 | Freshwater, Plankton | MNKIDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKET |
| Ga0114355_12303513 | 3300008120 | Freshwater, Plankton | MSKIDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKET |
| Ga0114336_10435157 | 3300008261 | Freshwater, Plankton | MSKIDGDQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETASGNYKEMK* |
| Ga0104242_10551743 | 3300008962 | Freshwater | MSKIDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKQTTNNNYKELK* |
| Ga0102864_12246161 | 3300009051 | Estuarine | MRKINGKKLRKKLEKLIPTSSFGEDNEGQVVIYTGLKETKDGNYKDLS* |
| Ga0114980_1000013732 | 3300009152 | Freshwater Lake | MKRINGKKLRKKLEKLIPTSSFGEDNEGQVIIYTGLKETKDGNYKDLS* |
| Ga0114980_102006782 | 3300009152 | Freshwater Lake | MMDGLKMNKVSGDQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0114968_101711213 | 3300009155 | Freshwater Lake | MDYMNKIDGDQLRNKLEKLMPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0114968_102197842 | 3300009155 | Freshwater Lake | MSKINGNKLRKKLHKILPNSSFGKDNEGQVIIYTGLKETKDGNYKELK* |
| Ga0114977_1000604022 | 3300009158 | Freshwater Lake | MSKVNGDQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0114977_103743463 | 3300009158 | Freshwater Lake | MKKINGNKLRKKLHKLLPNSSFDKDNEGQVIIYTGLKETKNGKYKELS* |
| Ga0114969_1000024347 | 3300009181 | Freshwater Lake | MSKINANKLRKKLQKLIPNSSFDKDNEGQVIIYTGLKETKDGNYKELK* |
| Ga0114969_100404326 | 3300009181 | Freshwater Lake | MQTIDGNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKEIK* |
| Ga0114969_107374852 | 3300009181 | Freshwater Lake | MNKIDGDQLRNNLEKLLPNCSFDEDNEGQVVIYTNLKETTNGNYKELK* |
| Ga0114974_100419481 | 3300009183 | Freshwater Lake | GNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKEIK* |
| Ga0114974_100672266 | 3300009183 | Freshwater Lake | MKTIDGNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKE |
| Ga0114974_105122403 | 3300009183 | Freshwater Lake | GNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKEVK* |
| Ga0114976_103558863 | 3300009184 | Freshwater Lake | MKTIDGNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKEVK* |
| Ga0114971_107133532 | 3300009185 | Freshwater Lake | MKKINGNKLRKKLQKLLPGSSFDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0126448_10172177 | 3300009466 | Meromictic Pond | MKKINGNKLRKKLQKLLPYTYLDKDNEGQVIIYTGLKETKNEKYKK |
| Ga0127390_101204111 | 3300009474 | Meromictic Pond | MKKINGNKLRKKLQKLLPYIYLDKDNEGQVIIYTGLKETKNGNYKEFS* |
| Ga0129333_102695172 | 3300010354 | Freshwater To Marine Saline Gradient | MQKKKIDGEWLRRELERLMPECSLDEDNEGQVVIYTNLVETANGDYKVMS* |
| Ga0133913_1000261648 | 3300010885 | Freshwater Lake | MKKINGNKLRKKLHKILPNSSFDKDNEGQVIIYTGLKETKNQNYKVKK* |
| Ga0133913_100856314 | 3300010885 | Freshwater Lake | MNKINGDKLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0133913_136298314 | 3300010885 | Freshwater Lake | MKKINGNKLRKKLNKILPYIYIDKDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0164293_100329346 | 3300013004 | Freshwater | MNKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0164293_101041533 | 3300013004 | Freshwater | MKINGDELRTRIEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMK* |
| Ga0164292_100593008 | 3300013005 | Freshwater | MSKLDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK* |
| Ga0177922_100016464 | 3300013372 | Freshwater | MRKINGKKLRKKLEKLIPTSSFGEDNEGQVIIYTGLKETKNGNYKELS* |
| Ga0177922_105003024 | 3300013372 | Freshwater | MKNIDGDKLRKALEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKEIK* |
| Ga0181343_11125002 | 3300017766 | Freshwater Lake | MITKVGLQMSKIDGDQLRSKIEKLLPNCSFDEDNEGQVVIYTNLKETANGNYKEMK |
| Ga0181343_11885351 | 3300017766 | Freshwater Lake | MMDGLRMNKINGDKLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMR |
| Ga0181343_12270571 | 3300017766 | Freshwater Lake | MKTKTIDGNKLRKQLEKLIPTCDFDVDNEGQVIIYTNLRELRNGNYKEIK |
| Ga0181359_10319901 | 3300019784 | Freshwater Lake | MKTKTIDGNKLRKQLEKLIPTCDMDVDNEGQVIIYTNLRELRNG |
| Ga0211732_11410462 | 3300020141 | Freshwater | MKTIDGDKLRKALEKLIPTCDFDVDNEGQVIIYTNLKELRNGNYKEIK |
| Ga0211732_13491944 | 3300020141 | Freshwater | MSKINGNKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKEMK |
| Ga0211736_107516331 | 3300020151 | Freshwater | MNKIDGDKLRNKLEKLMPNCSFDEDNEGQVIIYTNLKETTSGNYK |
| Ga0211736_109633878 | 3300020151 | Freshwater | VKINGDKLRAKLEKLIPNCAFDTDNEGQVIIYTNLKETKSGNYRDMDERS |
| Ga0211736_1101127514 | 3300020151 | Freshwater | MKTVNKIDGDKLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0211734_109188251 | 3300020159 | Freshwater | MNKIDGDKLRNKLEKLMPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0208050_10035302 | 3300020498 | Freshwater | MKTKTIDGNKLRKQLEKLIPTCDLDVDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0208482_10420952 | 3300020521 | Freshwater | MKNIDGEKLRKALEKLIPSCDLDVDNEGQVIIYTNLKETKNGNYKKIK |
| Ga0208085_10370152 | 3300020526 | Freshwater | MKNIDGDKLRKALEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0208232_100066613 | 3300020527 | Freshwater | MNKIDGDQLRNNLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0208486_10183802 | 3300020556 | Freshwater | MMDGLQMSKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKELK |
| Ga0214163_10051641 | 3300021141 | Freshwater | IGITKRGRRRLMKTIDGDRLRKALEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0194048_1000063318 | 3300021519 | Anoxic Zone Freshwater | MKTIDGNKLRKKLEKLMPSCDMDVDNEGQVIIYTNLKELKNGNYKEIN |
| Ga0214917_100898771 | 3300022752 | Freshwater | MKKINGNKLRKKLHKILPNSSFDKDNEGQVIIYTGLKETKNQNYKVKK |
| Ga0214921_10000249142 | 3300023174 | Freshwater | MSKIDGDQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMK |
| Ga0214923_102914102 | 3300023179 | Freshwater | MSKVNGDQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0214919_102434822 | 3300023184 | Freshwater | MSEINGEQLRLKIEKLLPNCSFDEDNEGQVIIYTNLKQTTNNNYKELK |
| Ga0247724_10030252 | 3300024239 | Deep Subsurface Sediment | MKTIDGDKLRKALEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0244775_100490673 | 3300024346 | Estuarine | MKKINGNKLRKKLHKLLPNSSFGEDNEGQVIIYTGLKETKNENYKELS |
| Ga0244775_101320015 | 3300024346 | Estuarine | MNKIDGDQLRNKLEKLMPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0244775_101705795 | 3300024346 | Estuarine | VNMMDGQRMNKIDGDQLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0244776_109261502 | 3300024348 | Estuarine | MNKIDGDQLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0255224_10766712 | 3300024483 | Freshwater | MKTIDGEKLRKKLEKLIPSCDMDTDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0209552_10096282 | 3300027563 | Freshwater Lake | MKTKTIDGNKLRKQLEKLIPTCDMDVDNEGQVIIYTNLRELRNGDYKEIN |
| Ga0208966_100033227 | 3300027586 | Freshwater Lentic | MRKINGNKLRKKLQKLIPNSSFDKDNEGQVIIYTGLKETKDGNYKELK |
| Ga0208966_10030364 | 3300027586 | Freshwater Lentic | MNGQKLRSKLEKLMPNCAMEEDNDGQVIIYTNLIEDDNGNYEEITE |
| Ga0208966_10411313 | 3300027586 | Freshwater Lentic | MKKINGNKLRKKLQKILPYIYIDKDNEGQVIIYTGLKETKNGNYKELS |
| Ga0208966_11787112 | 3300027586 | Freshwater Lentic | MNKINGDQLRNKLEKLMPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0208951_10046454 | 3300027621 | Freshwater Lentic | MRKINGNKLRKKLHKLLPYIYIDKDNEGQVIIYTGLKETKNGNYKELS |
| Ga0208951_10063496 | 3300027621 | Freshwater Lentic | MKTIDGNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKEIK |
| Ga0208951_10110085 | 3300027621 | Freshwater Lentic | MRKINGKKLRKKLEKLIPTSSFGEDNEGQVIIYTGLKETKDGNYKDLS |
| Ga0208951_10285415 | 3300027621 | Freshwater Lentic | MSKINANKLRKKLQKLIPNSSFDKDNEGQVIIYTGLKETKDGNYKELS |
| Ga0208951_11118783 | 3300027621 | Freshwater Lentic | SMKKINANKLRKKLQKLIPNSSFDKDNEGQVIIYTGLKETKDGNYKELK |
| Ga0208942_10002976 | 3300027627 | Freshwater Lentic | MSKINGNKLRKKLHKILPYIYIDKDNEGQVIIYTGLKETKNGNYKELS |
| Ga0208942_100054817 | 3300027627 | Freshwater Lentic | MKKKINGKKLRKKLDKLIPTSSFSEDNEGQFIIYTGLKETENGNYKELS |
| Ga0208942_101478312 | 3300027627 | Freshwater Lentic | NMRKINGNKLRKKLQKLLPYIYLDKDNEGQVIIYTGLKETKDGNYKELS |
| Ga0208960_10594283 | 3300027649 | Freshwater Lentic | RKMKNIDGDKLRKALEKLIPSCDLDVDNEGQVIIYTNLKETKNGNYKKIK |
| Ga0208960_10867973 | 3300027649 | Freshwater Lentic | MSKINGNKLRKKLQKLLPYIYFDKDNEGQVIIYTGLKETKNGNYKELS |
| Ga0209596_100001642 | 3300027754 | Freshwater Lake | MSKINANKLRKKLQKLIPNSSFDKDNEGQVIIYTGLKETKDGNYKELK |
| Ga0209596_10019153 | 3300027754 | Freshwater Lake | MNKINGNKLRKKLQKLLPGSSFDKDNEGQVIIYTGLKETTNGNYKELK |
| Ga0209296_12804023 | 3300027759 | Freshwater Lake | DGNKLRKQLEKLIPSCDMDVDNEGQVIIYTNLKELKNGNYKEVK |
| Ga0209107_101610552 | 3300027797 | Freshwater And Sediment | MKKINGNKLRKKLHKILPYIYIDKDNEGQVIIYTGLKETKNGNYKELS |
| Ga0209107_103461201 | 3300027797 | Freshwater And Sediment | MKKINANKLRKKLQKLIPNSSFDKDNEGQVIIYTGLKETKDGNYKELS |
| Ga0209229_100060999 | 3300027805 | Freshwater And Sediment | MKTKTIDGNKLRKQLEKLIPTCDFDVDNEGQVIIYTNLRELRNGNYKEIN |
| Ga0209229_100101544 | 3300027805 | Freshwater And Sediment | MKTIDGDKLRKALEKLIPSCDMDVDNEGQVIIYTNLKELRNGNYKEIK |
| Ga0209229_101049214 | 3300027805 | Freshwater And Sediment | MKTKTIDGNKLRKQLEKLIPTCDLDVDNEGQVIIYTNLRELRNGNYKEIN |
| Ga0209298_1000027134 | 3300027973 | Freshwater Lake | MKRINGKKLRKKLEKLIPTSSFGEDNEGQVIIYTGLKETKDGNYKDLS |
| Ga0255234_10780561 | 3300028113 | Freshwater | LRGAIMKNIDGDKLRKALEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0315909_101749057 | 3300031857 | Freshwater | MMDGLQMNKIDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGN |
| Ga0315904_102728581 | 3300031951 | Freshwater | MSKIDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLK |
| Ga0315906_104163352 | 3300032050 | Freshwater | MSKIDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0315906_108599203 | 3300032050 | Freshwater | MIVMDGLKMSKIDGDKLRSKLEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMK |
| Ga0334981_0002764_6139_6285 | 3300033980 | Freshwater | MSKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0334982_0302065_150_293 | 3300033981 | Freshwater | MKINGDELRIRIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKEMK |
| Ga0334992_0000029_31354_31500 | 3300033992 | Freshwater | MKNIDGDKLRKKLEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0334992_0034141_52_207 | 3300033992 | Freshwater | MDYMNKIDGDQLRNNLEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0334992_0034704_2517_2663 | 3300033992 | Freshwater | MNKIDGDQLRNNLEKLMPNCSFDEDNEGQVIIYTNLKETTDGNYKELK |
| Ga0334992_0129349_1_129 | 3300033992 | Freshwater | MNKIDGDKLRIRLEKLMPNCSFDEDNEGQVIIYTNLKETTDGN |
| Ga0334994_0144339_3_149 | 3300033993 | Freshwater | MKTIDGDRLRKALEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0335003_0004597_2181_2327 | 3300033995 | Freshwater | MNKIDGDKLRIRLEKLMPNCSFDEDNEGQVIIYTNLKETTDGNYKELK |
| Ga0335020_0000090_67581_67742 | 3300034082 | Freshwater | MDGVRMNKIDGNQLRSKLEKLMPHCSLDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0335020_0235270_80_226 | 3300034082 | Freshwater | MSKVDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMK |
| Ga0335029_0343671_714_875 | 3300034102 | Freshwater | MDGVRMNKIDGNQLRNKLEKLMPHCSLDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0335029_0447109_1_111 | 3300034102 | Freshwater | MNKIDGNQLRNKLEKLMPHCSLDEDNEGQVIIYTNLK |
| Ga0335031_0582179_186_332 | 3300034104 | Freshwater | MNKIDGNQLRNKLEKLMPHCSLDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0335036_0020341_4175_4321 | 3300034106 | Freshwater | MNKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0335036_0032478_788_958 | 3300034106 | Freshwater | MITKVGLKMSKLDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKEIK |
| Ga0335036_0784608_399_545 | 3300034106 | Freshwater | MNKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMK |
| Ga0335068_0308723_195_356 | 3300034116 | Freshwater | MDGLRMNKINGDKLRNKLEKLLPNCSFDEDNEGQVIIYTNLKETANGNYKEMR |
| Ga0335060_0057178_2_124 | 3300034122 | Freshwater | LRKALEKLIPSCDMDVDNEGQVIIYTNLKETKNGNYKEIK |
| Ga0335065_0003258_1824_1985 | 3300034200 | Freshwater | MDGLQMSKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| Ga0335065_0114763_519_665 | 3300034200 | Freshwater | MSKLDGDKLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKEIK |
| Ga0335065_0537835_576_692 | 3300034200 | Freshwater | KKLEKLIPTSSFGEDNEGQVIIYTGLKETKDGNYKDLS |
| Ga0335013_0078890_182_343 | 3300034284 | Freshwater | MDGLQMNKIDGNQLRSKIEKLLPNCSFDEDNEGQVIIYTNLKETTNGNYKELK |
| ⦗Top⦘ |