| Basic Information | |
|---|---|
| Family ID | F038221 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 166 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MMSERFDLIVIGGGSAARDAAGKAAREHGARVALVE |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.19 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.37 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.952 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (27.711 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.120 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.831 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.88% β-sheet: 12.50% Coil/Unstructured: 65.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF04542 | Sigma70_r2 | 24.10 |
| PF08281 | Sigma70_r4_2 | 13.25 |
| PF00174 | Oxidored_molyb | 7.83 |
| PF00723 | Glyco_hydro_15 | 7.23 |
| PF04199 | Cyclase | 6.63 |
| PF04107 | GCS2 | 5.42 |
| PF13490 | zf-HC2 | 5.42 |
| PF07992 | Pyr_redox_2 | 2.41 |
| PF00970 | FAD_binding_6 | 2.41 |
| PF06202 | GDE_C | 1.81 |
| PF03640 | Lipoprotein_15 | 1.81 |
| PF01344 | Kelch_1 | 1.20 |
| PF09948 | DUF2182 | 0.60 |
| PF01204 | Trehalase | 0.60 |
| PF13964 | Kelch_6 | 0.60 |
| PF13520 | AA_permease_2 | 0.60 |
| PF02896 | PEP-utilizers_C | 0.60 |
| PF00160 | Pro_isomerase | 0.60 |
| PF14742 | GDE_N_bis | 0.60 |
| PF13464 | DUF4115 | 0.60 |
| PF01636 | APH | 0.60 |
| PF01019 | G_glu_transpept | 0.60 |
| PF04228 | Zn_peptidase | 0.60 |
| PF13418 | Kelch_4 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 24.10 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 24.10 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 24.10 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 24.10 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 7.83 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 7.83 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 7.23 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 6.63 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 1.81 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.81 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.60 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG1626 | Neutral trehalase | Carbohydrate transport and metabolism [G] | 0.60 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.95 % |
| Unclassified | root | N/A | 12.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig138422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 2140918013|NODE_10053_length_1191_cov_7.155332 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300000041|ARcpr5oldR_c021779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10111738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 573 | Open in IMG/M |
| 3300000956|JGI10216J12902_120563468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300004114|Ga0062593_102626494 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300004114|Ga0062593_103153692 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300004157|Ga0062590_101967689 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300004479|Ga0062595_100978016 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300004479|Ga0062595_101659389 | Not Available | 599 | Open in IMG/M |
| 3300004480|Ga0062592_101511746 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005093|Ga0062594_100428206 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300005093|Ga0062594_102257204 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005148|Ga0066819_1022157 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005158|Ga0066816_1027450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300005178|Ga0066688_10590095 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005178|Ga0066688_10965770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300005179|Ga0066684_11066433 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005406|Ga0070703_10223563 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300005446|Ga0066686_10390135 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300005518|Ga0070699_101292420 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005535|Ga0070684_102148488 | Not Available | 527 | Open in IMG/M |
| 3300005535|Ga0070684_102191007 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005545|Ga0070695_101310324 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005545|Ga0070695_101805726 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005552|Ga0066701_10078082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1892 | Open in IMG/M |
| 3300005557|Ga0066704_10443643 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005569|Ga0066705_10674310 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005575|Ga0066702_10352153 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300005614|Ga0068856_100348342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1500 | Open in IMG/M |
| 3300005618|Ga0068864_101819112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300005719|Ga0068861_100454345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1149 | Open in IMG/M |
| 3300005842|Ga0068858_102052939 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006046|Ga0066652_101542018 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006058|Ga0075432_10541135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300006581|Ga0074048_13493390 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300006791|Ga0066653_10081397 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300006806|Ga0079220_11301364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 609 | Open in IMG/M |
| 3300006854|Ga0075425_101473579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
| 3300009090|Ga0099827_11245214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 647 | Open in IMG/M |
| 3300009098|Ga0105245_10601346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1126 | Open in IMG/M |
| 3300009100|Ga0075418_10042029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4935 | Open in IMG/M |
| 3300009100|Ga0075418_11167295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
| 3300009137|Ga0066709_102776870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300009148|Ga0105243_10313813 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300009545|Ga0105237_12775075 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009840|Ga0126313_10294832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300010038|Ga0126315_10756775 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010041|Ga0126312_10832453 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300010044|Ga0126310_10978835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300010147|Ga0126319_1614169 | Not Available | 1200 | Open in IMG/M |
| 3300010166|Ga0126306_11009630 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010304|Ga0134088_10615427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 541 | Open in IMG/M |
| 3300010335|Ga0134063_10363871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300010336|Ga0134071_10724285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300010359|Ga0126376_12064276 | Not Available | 613 | Open in IMG/M |
| 3300010360|Ga0126372_12790871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300010364|Ga0134066_10094025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
| 3300010364|Ga0134066_10138339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300010375|Ga0105239_12263595 | Not Available | 632 | Open in IMG/M |
| 3300010403|Ga0134123_13366543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300011003|Ga0138514_100158502 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300011400|Ga0137312_1073150 | Not Available | 591 | Open in IMG/M |
| 3300012207|Ga0137381_10897398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300012207|Ga0137381_11715089 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012208|Ga0137376_10121836 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300012209|Ga0137379_11819237 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012211|Ga0137377_11290582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 660 | Open in IMG/M |
| 3300012349|Ga0137387_10620875 | Not Available | 783 | Open in IMG/M |
| 3300012350|Ga0137372_10070317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3016 | Open in IMG/M |
| 3300012353|Ga0137367_10245347 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300012356|Ga0137371_10157924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1778 | Open in IMG/M |
| 3300012356|Ga0137371_11168886 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012356|Ga0137371_11197320 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012358|Ga0137368_10175201 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300012360|Ga0137375_10316354 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300012532|Ga0137373_10282647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1326 | Open in IMG/M |
| 3300012532|Ga0137373_10426344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1026 | Open in IMG/M |
| 3300012885|Ga0157287_1088039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 557 | Open in IMG/M |
| 3300012914|Ga0157297_10002354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3724 | Open in IMG/M |
| 3300012915|Ga0157302_10574420 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012958|Ga0164299_10440517 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012958|Ga0164299_10863711 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012971|Ga0126369_13033680 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012972|Ga0134077_10248334 | Not Available | 736 | Open in IMG/M |
| 3300012986|Ga0164304_10509980 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300012987|Ga0164307_10809898 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300014166|Ga0134079_10364140 | Not Available | 662 | Open in IMG/M |
| 3300014325|Ga0163163_12940405 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300014488|Ga0182001_10540736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300015077|Ga0173483_10203734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 913 | Open in IMG/M |
| 3300015372|Ga0132256_100736426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1102 | Open in IMG/M |
| 3300015373|Ga0132257_101432072 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300015373|Ga0132257_103279848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300016387|Ga0182040_11856398 | Not Available | 516 | Open in IMG/M |
| 3300018027|Ga0184605_10174346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300018077|Ga0184633_10477453 | Not Available | 610 | Open in IMG/M |
| 3300018431|Ga0066655_10164139 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300018433|Ga0066667_11191948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300018482|Ga0066669_10255335 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300018482|Ga0066669_10526550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1027 | Open in IMG/M |
| 3300018482|Ga0066669_11764020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300019362|Ga0173479_10260454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300019362|Ga0173479_10340794 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300019878|Ga0193715_1074710 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300019885|Ga0193747_1081813 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300020002|Ga0193730_1097302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300020003|Ga0193739_1117336 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300021073|Ga0210378_10351591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300021080|Ga0210382_10021220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2348 | Open in IMG/M |
| 3300021080|Ga0210382_10285534 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300021080|Ga0210382_10385725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300021080|Ga0210382_10409241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300021344|Ga0193719_10095177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1294 | Open in IMG/M |
| 3300021445|Ga0182009_10709006 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300024310|Ga0247681_1071222 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300025917|Ga0207660_10018937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4598 | Open in IMG/M |
| 3300025927|Ga0207687_10753659 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300026524|Ga0209690_1107617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
| 3300026532|Ga0209160_1047312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2524 | Open in IMG/M |
| 3300026542|Ga0209805_1219221 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300026550|Ga0209474_10392389 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300026816|Ga0207509_100146 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
| 3300026816|Ga0207509_105197 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300027379|Ga0209842_1082711 | Not Available | 555 | Open in IMG/M |
| 3300027882|Ga0209590_10421550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
| 3300028707|Ga0307291_1053587 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300028711|Ga0307293_10162566 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300028716|Ga0307311_10143867 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300028717|Ga0307298_10197943 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300028719|Ga0307301_10162675 | Not Available | 720 | Open in IMG/M |
| 3300028720|Ga0307317_10069663 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300028722|Ga0307319_10006162 | All Organisms → cellular organisms → Bacteria | 3644 | Open in IMG/M |
| 3300028744|Ga0307318_10139796 | Not Available | 829 | Open in IMG/M |
| 3300028755|Ga0307316_10045712 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300028782|Ga0307306_10136633 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300028784|Ga0307282_10653140 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300028787|Ga0307323_10251183 | Not Available | 637 | Open in IMG/M |
| 3300028799|Ga0307284_10000726 | All Organisms → cellular organisms → Bacteria | 7741 | Open in IMG/M |
| 3300028799|Ga0307284_10083611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300028799|Ga0307284_10440716 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300028807|Ga0307305_10292264 | Not Available | 742 | Open in IMG/M |
| 3300028810|Ga0307294_10223450 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300028824|Ga0307310_10553251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300028824|Ga0307310_10663887 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300028828|Ga0307312_10235674 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300028828|Ga0307312_10430084 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300028828|Ga0307312_10754004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300028828|Ga0307312_11018890 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300028875|Ga0307289_10175798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
| 3300028878|Ga0307278_10223638 | Not Available | 837 | Open in IMG/M |
| 3300028878|Ga0307278_10495667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300028880|Ga0307300_10090545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 913 | Open in IMG/M |
| 3300028881|Ga0307277_10018428 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
| 3300028881|Ga0307277_10535227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300028885|Ga0307304_10514126 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031092|Ga0308204_10136857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300031680|Ga0318574_10692024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
| 3300031792|Ga0318529_10376448 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031854|Ga0310904_10333060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300031911|Ga0307412_11748841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300032066|Ga0318514_10762524 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032067|Ga0318524_10079398 | Not Available | 1605 | Open in IMG/M |
| 3300032074|Ga0308173_10907865 | Not Available | 815 | Open in IMG/M |
| 3300032954|Ga0335083_10553831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300033551|Ga0247830_10895902 | Not Available | 707 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 27.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.01% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.20% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.60% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.60% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.60% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.60% | |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026816 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01880880 | 2124908016 | MTREHYDLIAIGAGSAARDGARKAHSEHGARVALVEHTRWGGS | |
| Iowa-Corn-GraphCirc_02302680 | 2140918013 | Soil | MSNSYDLIVLGSGSAAREGAARAAREHGASVAITE |
| ARcpr5oldR_0217792 | 3300000041 | Arabidopsis Rhizosphere | MATQTYDLIVLGAGSAARDGAGKAAREHGARVAMVERT |
| AF_2010_repII_A001DRAFT_101117382 | 3300000793 | Forest Soil | MGKQRYDLIVIGAGSAARYGANKAANEHGAKVALIEHERWGG |
| JGI10216J12902_1205634682 | 3300000956 | Soil | MTPEQFDLIVLGAGSAARDGAKKAAAEHGARVALVERTRWG |
| Ga0062593_1026264942 | 3300004114 | Soil | MADKFDLIVIGAGSAARDAAAKASREHGARVALIERTRWGG |
| Ga0062593_1031536921 | 3300004114 | Soil | MRLVGERFDLVVLGGGSAARDAANMAMRDYDAGVALVERERWGGSCPN |
| Ga0062590_1019676891 | 3300004157 | Soil | MADKFDLIVIGAGSAARDAAARASREYGARVALIERTRWGGS |
| Ga0062595_1009780161 | 3300004479 | Soil | VLASETMPLVAERFDLVVLGGGSAARDGANMAMRDYDARVALVERVRWGGS |
| Ga0062595_1016593891 | 3300004479 | Soil | MPTEIYDLVVLGAGSAARDAASRAAREHGARVALVESTRWG |
| Ga0062592_1015117461 | 3300004480 | Soil | VEHYDLIVLGSGSAARNGAGKAAREHGARVALIEHRLWGGSC |
| Ga0062594_1004282063 | 3300005093 | Soil | MERYDLIAIGAGSAARDAARKAATDFGAKVALVEQTRWGGS |
| Ga0062594_1022572042 | 3300005093 | Soil | VSAEQFDLIVIGAGSAARDAAGKAKREHGASVAMIERERWGGSCP |
| Ga0066819_10221573 | 3300005148 | Soil | VNRYDLIVLGSGSAARDAAAKAVQQCDASVALVESTRWGGSCPNV |
| Ga0066816_10274501 | 3300005158 | Soil | VNRYDLIVLGSGSAARDAAAKAVQQFDASVALVESTRWGGSCPNVA |
| Ga0066688_105900952 | 3300005178 | Soil | MSADHYDLIVLGSGSAARDGAGKAAREFGARVALVEHQLWGGSCPHVA |
| Ga0066688_109657701 | 3300005178 | Soil | MKSEHYDLIVIGAGSAARDGAKKAAKEYGAKVALIERERWG |
| Ga0066684_110664331 | 3300005179 | Soil | MSGERFDLIVLGAGSAARDGAAKAKREFGANVAMIERELWGGSCPNI |
| Ga0070703_102235632 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VLASETMPIVAERFDLVVLGGGSAARDGANMAMRDYDARVALVERVRWGGS |
| Ga0066686_103901353 | 3300005446 | Soil | MSTDQYDLLVLGSGSAARAGANKAAQEYGARVALVEHRLWG |
| Ga0070699_1012924201 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEHFDLVVIGGGSAARDAAGKAAREHEARVALVEKERWG |
| Ga0070684_1021484881 | 3300005535 | Corn Rhizosphere | MGERFDLVVLGGGSAARDAANMAMRDYDARVALVERERWG |
| Ga0070684_1021910072 | 3300005535 | Corn Rhizosphere | MTADHYDLIVLGAGSAARYGAGKAAREFGAHVALVEHRLW |
| Ga0070695_1013103241 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MTADHYDLIVLGAGSAARDGAGKAAREFGAHVALVEHRLWG |
| Ga0070695_1018057262 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VEHYDLIVLGSGSAARDGAGKAAREHGARVALIEHRLWGG |
| Ga0066701_100780825 | 3300005552 | Soil | MAEQFDLIVLGAGSAARDAAARASRDHGARVALVE |
| Ga0066704_104436432 | 3300005557 | Soil | MNAERYDLIVLGSGSAARAGAGKAAQEHGARVALIEHWLWGG |
| Ga0066705_106743101 | 3300005569 | Soil | MQFDLIVLGAGSAAREAATRAREYGANVALVERGLW |
| Ga0066702_103521532 | 3300005575 | Soil | MKERFDLIVLGAGSAARDAAGKAKREHDANVAIVERERWGGSC |
| Ga0068856_1003483421 | 3300005614 | Corn Rhizosphere | MRVVGERFDLIVIGGGSAARDAANMAMRDYDARVA |
| Ga0068864_1018191121 | 3300005618 | Switchgrass Rhizosphere | VTHYDLIVLGSGSAARDAAAKAVQQCDASVALVESTRWGGSCPN |
| Ga0068861_1004543453 | 3300005719 | Switchgrass Rhizosphere | VLASETMPLVAERFDLVVLGGGSAARDGANMAMRDYDAR |
| Ga0068858_1020529392 | 3300005842 | Switchgrass Rhizosphere | MAEQFDLIVLGAGSAARAGAERAAREHGARVALVESTRW |
| Ga0066652_1015420182 | 3300006046 | Soil | MSADRYDLLVLGSGSAARDGAGRASREFDARVALVEHGLW |
| Ga0075432_105411352 | 3300006058 | Populus Rhizosphere | MERYDLIAIGAGSAARDAARKAAADFGAKVALVEQTRWGGSCP |
| Ga0074048_134933901 | 3300006581 | Soil | MSERFDLIVIGGGSAARDAAGQAARMHGARVALIERER |
| Ga0066653_100813974 | 3300006791 | Soil | MRSEQFDLIVLGAGSAARDGAGKAKREYGATVAMIER |
| Ga0079220_113013642 | 3300006806 | Agricultural Soil | MTERFDLIVIGGGSAARDGANMALKQHGARVALIERE |
| Ga0075425_1014735791 | 3300006854 | Populus Rhizosphere | VRTYDLIVLGSGSAARDGAAKAVQLCGASVALIESTRWGG |
| Ga0099827_112452142 | 3300009090 | Vadose Zone Soil | VTTQQFDLIVIGAGSAARDGAKKAAAEHGANVALV |
| Ga0105245_106013461 | 3300009098 | Miscanthus Rhizosphere | MPTETYDLIVLGAGSAARDGAAKAQREHGARVALVERTRWGGSCPN |
| Ga0075418_100420291 | 3300009100 | Populus Rhizosphere | MGTQRYDLIVIGAGSAARHGAKLAKEHGAKVALVEHE |
| Ga0075418_111672951 | 3300009100 | Populus Rhizosphere | MAERFDLIVIGGGSAARDGANMALKQHGAHVALIERGRW |
| Ga0066709_1027768702 | 3300009137 | Grasslands Soil | MTAEQFDLIVLGAGSGARDGAGKAKREYGANVAIVERERGGGS |
| Ga0105243_103138131 | 3300009148 | Miscanthus Rhizosphere | MRLVSERFDLVVLGGGSAARDEANMAMRDYDAHVA |
| Ga0105237_127750752 | 3300009545 | Corn Rhizosphere | MKSEHYDLVVIGSGSAARDAGKKAVKDYGARVALIERERWG |
| Ga0126313_102948321 | 3300009840 | Serpentine Soil | VTHYDLIVLGSGSAARDAAAKAVQHCDATVALVESTRWGGSCPNVA |
| Ga0126315_107567752 | 3300010038 | Serpentine Soil | MAERFDLIVLGGGSAARDAANTAARKHGARVALVERERWG |
| Ga0126312_108324531 | 3300010041 | Serpentine Soil | MSESFDLIVIGAGSAARDGAMKAQRDYGARVAMVERTRWGGSCPN |
| Ga0126310_109788352 | 3300010044 | Serpentine Soil | VSDEFDLIVSGAGSGARDGAARAFRDCGARVAMIERERWGGGCP |
| Ga0126319_16141691 | 3300010147 | Soil | VEHYDLIVLGSGSAARDGAGRAVREHGARVALIEHWLW |
| Ga0126306_110096301 | 3300010166 | Serpentine Soil | MKNECDLIVIGAGSAAREGAARASQKYGASVAMIERTRWG |
| Ga0134088_106154271 | 3300010304 | Grasslands Soil | MNAERYDLIVLGSGSAARDGAGKAAREHGARVALIEHWLW |
| Ga0134063_103638711 | 3300010335 | Grasslands Soil | MSPQRYDLIVIGAGSAARDGANKAAKEHGAKVALIE |
| Ga0134071_107242852 | 3300010336 | Grasslands Soil | MTRETYDLIVIGAGSAARDGGRKAMAEHGARVALVEHRLWG |
| Ga0126376_120642762 | 3300010359 | Tropical Forest Soil | VQRYDLIVLGSGSAARDAAAKAFQLCDASVALVEK |
| Ga0126372_127908711 | 3300010360 | Tropical Forest Soil | VPERFDLIVIGGGSAARDAAGMASRDYDASVALVEKERW |
| Ga0134066_100940251 | 3300010364 | Grasslands Soil | MSTETYDLIVLGAGSAARDGAGKAAREHGARVAMVERTR |
| Ga0134066_101383392 | 3300010364 | Grasslands Soil | MSPQRYDLIVIGAGSAARDGANKAAKEHGAKVALIERERWG |
| Ga0105239_122635951 | 3300010375 | Corn Rhizosphere | MNAERYDLIVLGSGSAARDGAGKAAREHGARVALIEHRL |
| Ga0134123_133665432 | 3300010403 | Terrestrial Soil | MNDHFDLIVIGAGSAARDGAAKASREHGARVALIERTRW |
| Ga0138514_1001585021 | 3300011003 | Soil | MSADRYDLIVLGSGSAARDGAGKASREFGARVAMVEHRLWGGSC |
| Ga0137312_10731502 | 3300011400 | Soil | MPADPYDLIVLGAGSAARAGAQKAAQEHGAKVALIES |
| Ga0137381_108973982 | 3300012207 | Vadose Zone Soil | MSEQFDLIVIGGGSAARDAAGKATREHGARVALVEK |
| Ga0137381_117150891 | 3300012207 | Vadose Zone Soil | VTTQHFDLIVIGAGSAARDGAKKAATDHGANVALVERT |
| Ga0137376_101218364 | 3300012208 | Vadose Zone Soil | MSTEHYDLIVIGAGSAARDGANKAAKEHGAKVALIER |
| Ga0137379_118192371 | 3300012209 | Vadose Zone Soil | MSAEQFDLIVLGAGSGARDGAGKAKREYGANVALVERER |
| Ga0137377_112905821 | 3300012211 | Vadose Zone Soil | MNAEGYDLMVLGSGSAARDGASKAAREHGARIALIEHWLWGGS |
| Ga0137387_106208751 | 3300012349 | Vadose Zone Soil | MNAEGYDLMVLGSGSAARDGAGKAAREHGARIALIEHWL |
| Ga0137372_100703175 | 3300012350 | Vadose Zone Soil | MSSERYDLIILGAGSAARDAAAKASREFGVSVALVERERGEGSCPNVA |
| Ga0137367_102453474 | 3300012353 | Vadose Zone Soil | MTDHFDLIVIGAGSAARDAAGKAAREFGASVALIER |
| Ga0137371_101579245 | 3300012356 | Vadose Zone Soil | MTRTYDLIVIGAGSAGREAARKATVEYGARVALIES |
| Ga0137371_111688861 | 3300012356 | Vadose Zone Soil | MNAEHFDLIVIGAGSAARDGAKKAATEYDANVALIERTRWG |
| Ga0137371_111973201 | 3300012356 | Vadose Zone Soil | MEHYDLIVLGAGSAARDGAKKAATQYDAKVALVESTR |
| Ga0137368_101752012 | 3300012358 | Vadose Zone Soil | MNAEHFDLIVIGAGSAARDGAKKAATEYGASVALI |
| Ga0137375_103163541 | 3300012360 | Vadose Zone Soil | MNAEHFDLIVIGAGSAARDGAKKAATEYGASVALIERTRWG |
| Ga0137373_102826471 | 3300012532 | Vadose Zone Soil | VSESFDLIVLGSGSAARDGAARAYDLGARVAMIERERWGGS |
| Ga0137373_104263441 | 3300012532 | Vadose Zone Soil | MNAEHFDLIVIGAGSAARDGAKKAATEYGASVALIERTRWGG |
| Ga0157287_10880391 | 3300012885 | Soil | MRVVNDRFDLVVLGGGSAARDAAIMAMRDYDARVALVE |
| Ga0157297_100023547 | 3300012914 | Soil | MPERFDLLVLGSGSAARDAAHAAARDHGARVALIE |
| Ga0157302_105744201 | 3300012915 | Soil | MKSEHYDLVVLGSGSAARDAGKKAMKDYGARVALIERERW |
| Ga0164299_104405171 | 3300012958 | Soil | MRLVGERFDLVVLGGGSAARDAANMAMRDYDARVALVERERWG |
| Ga0164299_108637111 | 3300012958 | Soil | MRLVGEQFDLVVLGGGSAARDAANMAMRDYDARVAL |
| Ga0126369_130336802 | 3300012971 | Tropical Forest Soil | MAAVAERFDLIVIGGGSAARDAAGMASRDYDASVALVEKVRWGG |
| Ga0134077_102483342 | 3300012972 | Grasslands Soil | MANDHFDLIVLGAGSAAREAAARATVDHGKSVALVERLRWGGDCP |
| Ga0164304_105099801 | 3300012986 | Soil | VSAEQFDLIVIGAGSAARDAAGKAKREYGASVAMIERERW |
| Ga0164307_108098982 | 3300012987 | Soil | MNNGHYDLIAIGSGSAARDGANKAAKEYGAKVALIER |
| Ga0134079_103641403 | 3300014166 | Grasslands Soil | MTNDAYDLIVIGAGSAGREAARKATVEHGARVALIEGRF |
| Ga0163163_129404051 | 3300014325 | Switchgrass Rhizosphere | MTENFDLIVIGAGSGARDGAARASRDHGARVALIER |
| Ga0182001_105407362 | 3300014488 | Soil | MTREHYDLIVIGAGSAARDGARKAHTEHGARVALVEHT |
| Ga0173483_102037341 | 3300015077 | Soil | MRVVNDRFDLVVLGGGSAARDAAMMAMRDYDARVALVERERW |
| Ga0132256_1007364261 | 3300015372 | Arabidopsis Rhizosphere | MSTQTFDLVVIGAGSAAREAAARARSDHGARVALVERERWGGS |
| Ga0132257_1014320723 | 3300015373 | Arabidopsis Rhizosphere | VPEHFDLIVIGGGSAARDAAGMAASDYGARVALVEK |
| Ga0132257_1032798481 | 3300015373 | Arabidopsis Rhizosphere | VNYDLIVLGSGSAARDAAAMAFQRCDASVALVESTRWGGS |
| Ga0182040_118563981 | 3300016387 | Soil | MPEQFDLIVLGAGSAARAAAERASREHGARVALVESTRWG |
| Ga0184605_101743461 | 3300018027 | Groundwater Sediment | MSEKFDLIVLGSGSAARDGANRASEHGARVAMVER |
| Ga0184633_104774531 | 3300018077 | Groundwater Sediment | VNRYDLIVLGSGSAARDAAAKAVQQCDASVALVESTRWGGSCPN |
| Ga0066655_101641392 | 3300018431 | Grasslands Soil | MNTEQFDLIVLGAGSAARDGAGKAKREYGANVAMVERERWGG |
| Ga0066667_111919481 | 3300018433 | Grasslands Soil | MNSESYDLVVLGSGSAARDGAGKASREHGANVALVENTRWGGSCP |
| Ga0066669_102553351 | 3300018482 | Grasslands Soil | MTTEQFDLIVLGAGSAARDGAGKAKREHGASIAMIERERWGGSCPN |
| Ga0066669_105265501 | 3300018482 | Grasslands Soil | MTNETYELIVLGAGSAAQDAAGKASREHGARLPAVDGTRWGG |
| Ga0066669_117640201 | 3300018482 | Grasslands Soil | MVTETYDLIVLGAGSAARDGPGNAGREHGARVAMVGSTAWGGSGP |
| Ga0173479_102604542 | 3300019362 | Soil | VKSYDLIVLGSGSAARDGAAKAVQLCGASVALVESTRWGGSC |
| Ga0173479_103407942 | 3300019362 | Soil | MTSEHYDLIVIGSGSAARDAGTKAVKDYGARVAVI |
| Ga0193715_10747102 | 3300019878 | Soil | MSNQHFDLITIGGGSAARDGARKAKDEFGARVALIESTRWGGDCPNVA |
| Ga0193747_10818132 | 3300019885 | Soil | MKTEHYDLIVIGAGSAARDGAQKAAREHGAKVALI |
| Ga0193730_10973023 | 3300020002 | Soil | MTADRYDLIVLGAGSAARDGAGKAAREFGAHVALVE |
| Ga0193739_11173361 | 3300020003 | Soil | MNTDTFDLVVLGAGSAARDGARKAAREYDANVALV |
| Ga0210378_103515912 | 3300021073 | Groundwater Sediment | MNVEHYDLIVLGSGSAARDGAGKAVREHGARVALIEHWLWG |
| Ga0210382_100212205 | 3300021080 | Groundwater Sediment | MNVEHYDLIVLGSGSAARDGAGRAAREHGARVALIEHWLWGG |
| Ga0210382_102855342 | 3300021080 | Groundwater Sediment | MTADHYDLIVLGSGSAARDGAGKAAREFGARVALV |
| Ga0210382_103857251 | 3300021080 | Groundwater Sediment | MSNDQFDLITIGGGSAARDGARKAKDEFGARVALIE |
| Ga0210382_104092412 | 3300021080 | Groundwater Sediment | MNAERYDLIVLGSGSAARAGAGKATQEHGARVTLIEHWLW |
| Ga0193719_100951772 | 3300021344 | Soil | MMSERFDLIVIGGGSAARDAAGKAAREHGARVALVE |
| Ga0182009_107090062 | 3300021445 | Soil | MERYDLIVIGAGSAARDAAAKAAREHGAEVAMVERARW |
| Ga0247681_10712222 | 3300024310 | Soil | VPERFDLIVIGGGSAARDAAGMAAREYGARVALVEKER |
| Ga0207660_1001893710 | 3300025917 | Corn Rhizosphere | MTADHYDLIVLGAGSAARDGAGKAAREFGAHVALVEHRLWGGS |
| Ga0207687_107536591 | 3300025927 | Miscanthus Rhizosphere | MKSEHYDLIAIGAGSAARDGANKAAKDYGAKVALIEAEHW |
| Ga0209690_11076173 | 3300026524 | Soil | MAEQFDLIVLGAGSAARDAAARASRDHGARVALVERT |
| Ga0209160_10473124 | 3300026532 | Soil | MSTEQFDLIVLGAGSAARDGAGKAKREYGANVAMIERER |
| Ga0209805_12192211 | 3300026542 | Soil | MTTEQFDLIVLGAGSAARDGAGKAKREYGANVAMIERERWGG |
| Ga0209474_103923892 | 3300026550 | Soil | MATQFDLIVIGGGSAARDGAKKAADEYGARVAMIERTR |
| Ga0207509_1001461 | 3300026816 | Soil | MTADHYDLIVLGAGSAARDGAGKAAREFGAHVALVEHRLW |
| Ga0207509_1051972 | 3300026816 | Soil | MRLVGERFDLVVLGGGSAARDAANMAMRDYDARVALVERERWGGSCPNV |
| Ga0209842_10827111 | 3300027379 | Groundwater Sand | MPADPYDLIVLGAGSAARAGAQTASQEHGAKVALI |
| Ga0209590_104215503 | 3300027882 | Vadose Zone Soil | MNERYDLIVIGSGSAGREAARKASTDYGARVALVEST |
| Ga0307291_10535871 | 3300028707 | Soil | MAENFDLIVIGAGSGARDGAARASRDHGARVALIER |
| Ga0307293_101625662 | 3300028711 | Soil | MKSEHYDLIAIGAGSAARDGANKAAKDYGAKVALIEA |
| Ga0307311_101438671 | 3300028716 | Soil | MSDRFDLIVIGGGSAARDGANMAAHEHGARVALIEKERWG |
| Ga0307298_101979431 | 3300028717 | Soil | MTADHYDLIVLGAGSAARDGAGKAAREFGARVALVEHRLWGG |
| Ga0307301_101626751 | 3300028719 | Soil | MPADRYDLIVLGAGSAARAGAQKASQEHGTKVALVESTRWGGSCPN |
| Ga0307317_100696634 | 3300028720 | Soil | MRLVNDRFDLVVLGGGSAARDAANMAMRDYDARVAL |
| Ga0307319_100061621 | 3300028722 | Soil | MTQQFDLIVLGSGSGARDGANKAAKEYGARVALVESTR |
| Ga0307318_101397962 | 3300028744 | Soil | MSNDHFDLIVIGGGSAARDGARKAKDEFGARVALI |
| Ga0307316_100457124 | 3300028755 | Soil | MKSEHYDLIAIGAGSAARDGANKAAKDYGAKVALIE |
| Ga0307306_101366331 | 3300028782 | Soil | VDRFDLVVLGGGSAARDAANMAMRDYDARVALVERE |
| Ga0307282_106531401 | 3300028784 | Soil | MPESFDLIVIGAGSAARDGAMTAHRQHGARVAMVERER |
| Ga0307323_102511832 | 3300028787 | Soil | VNRYDLIVLGSGSAARDAAAKAVQQCDASVALVESTR |
| Ga0307284_1000072615 | 3300028799 | Soil | MNAERYDLIVLGSGSAARAGAGKATQEHGARVTLIEHW |
| Ga0307284_100836112 | 3300028799 | Soil | MSERFDLIVIGGGSAARDAAGKAAREHGARGALVEK |
| Ga0307284_104407162 | 3300028799 | Soil | MTADHYDLIVLGAGSAARDGAGKAAREFGARVALVEHRLWG |
| Ga0307305_102922641 | 3300028807 | Soil | MTDNFDLIVIGSGSAARDAAGNATREHGARVALIE |
| Ga0307294_102234501 | 3300028810 | Soil | MSDRFDLIVIGGGSAARDGANMAAHEHGARVALIEKERWGGS |
| Ga0307310_105532512 | 3300028824 | Soil | MSEQFDLIVLGGGSAARDAAGRAAREHDARVALVERERWGG |
| Ga0307310_106638872 | 3300028824 | Soil | MKSEHYDLIAIGAGSAARDGANKAAKDYGAKVALIESER |
| Ga0307312_102356741 | 3300028828 | Soil | MNAEAYDLIVLGSGSAARDGAGKAAREHGARVALIEHWLWGG |
| Ga0307312_104300841 | 3300028828 | Soil | VSEQFDLIVLGGGSAARDAAGRAMREHGARVALVER |
| Ga0307312_107540042 | 3300028828 | Soil | MERYDLIVLGAGSAARDGAAKAMKKYGAKVALVESARWGGS |
| Ga0307312_110188901 | 3300028828 | Soil | MATETYDLIVLGAGSAARDAASKASREHGAHVAIVER |
| Ga0307289_101757981 | 3300028875 | Soil | MSEQFDLIVLGGGSAARDAANVAARKHGANVALVEKER |
| Ga0307278_102236381 | 3300028878 | Soil | VNRYDLIVLGSGSAARDAAAKAVQQCDASVALVEG |
| Ga0307278_104956671 | 3300028878 | Soil | MNADHYDLIVLGSGSGARDGAGKAAREFGARVALVEH |
| Ga0307300_100905453 | 3300028880 | Soil | MQSKGYDLIVIGAGSAARDGANRAAREHGAKVALIE |
| Ga0307277_100184281 | 3300028881 | Soil | VSERFDLIVLGGGSAARDAAGKAAREHGARVALVERERWGGS |
| Ga0307277_105352271 | 3300028881 | Soil | MTREHYDLIVIGAGSAARDGARKAHTEHGARVALVEHKLWG |
| Ga0307304_105141261 | 3300028885 | Soil | MAEQFDLIIIGAGSAARDAAGRATRDYGMRVALIERTRWG |
| Ga0308204_101368571 | 3300031092 | Soil | MERYDLIVLGAGSAARDGAKMAAALYDAKAALVESTRW |
| Ga0318574_106920242 | 3300031680 | Soil | MPEQFDLIVLGAGSAARAAAERASREHGARVALVE |
| Ga0318529_103764481 | 3300031792 | Soil | MAAASFDLIVLGAGSAAREAAAHAVRDHGARVALVERERWG |
| Ga0310904_103330601 | 3300031854 | Soil | MERYDLIAIGAGSAARDAARKASTDFGAKVALVERTR |
| Ga0307412_117488411 | 3300031911 | Rhizosphere | MKAETFDLVVLGGGSAARDGARKAAEEHGANVALV |
| Ga0318514_107625242 | 3300032066 | Soil | MADTFDLIVIGAGSAARNAAEKASREHSARVALIE |
| Ga0318524_100793984 | 3300032067 | Soil | MPEQFDLIVLGAGSAARAAAERASREHGARVALVESTRW |
| Ga0308173_109078653 | 3300032074 | Soil | MATDTYDLIVLGAGSAARDGAGKAAREPGARGAIVERTR |
| Ga0335083_105538311 | 3300032954 | Soil | MSERFDLIVLGGGSAARDAAGRAMRKHGARVALVEKERWGG |
| Ga0247830_108959022 | 3300033551 | Soil | MSHHFDLIVLGSGSGARDGANKAHSEHGASVAIVESTRWGGSC |
| ⦗Top⦘ |