| Basic Information | |
|---|---|
| Family ID | F038149 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 166 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKKPAWSHSSLKDFEGCARRYHEVKVLKKYPFQETEAT |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 66.27 % |
| % of genes near scaffold ends (potentially truncated) | 99.40 % |
| % of genes from short scaffolds (< 2000 bps) | 92.77 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.627 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.506 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.036 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.060 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF00476 | DNA_pol_A | 13.25 |
| PF12705 | PDDEXK_1 | 3.61 |
| PF01612 | DNA_pol_A_exo1 | 2.41 |
| PF06114 | Peptidase_M78 | 1.20 |
| PF08325 | WLM | 1.20 |
| PF05050 | Methyltransf_21 | 0.60 |
| PF13392 | HNH_3 | 0.60 |
| PF00583 | Acetyltransf_1 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 13.25 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.63 % |
| All Organisms | root | All Organisms | 43.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000949|BBAY94_10068694 | Not Available | 979 | Open in IMG/M |
| 3300001282|B570J14230_10095417 | Not Available | 902 | Open in IMG/M |
| 3300001836|RCM27_1029293 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300001849|RCM26_1193134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300001850|RCM37_1087310 | Not Available | 654 | Open in IMG/M |
| 3300002161|JGI24766J26685_10132730 | Not Available | 524 | Open in IMG/M |
| 3300002408|B570J29032_108921216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300003787|Ga0007811_1025081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300003826|Ga0007872_1013009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales | 787 | Open in IMG/M |
| 3300004112|Ga0065166_10178192 | Not Available | 826 | Open in IMG/M |
| 3300004481|Ga0069718_10105895 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300004684|Ga0065168_1011501 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300004771|Ga0007797_1062851 | Not Available | 985 | Open in IMG/M |
| 3300004776|Ga0007800_10090496 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300004777|Ga0007827_10099405 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005582|Ga0049080_10160638 | Not Available | 751 | Open in IMG/M |
| 3300005659|Ga0073900_10131327 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300005739|Ga0076948_1121462 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300006037|Ga0075465_10053541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300006071|Ga0007876_1135219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 623 | Open in IMG/M |
| 3300006120|Ga0007867_1005280 | All Organisms → Viruses → Predicted Viral | 3244 | Open in IMG/M |
| 3300006803|Ga0075467_10364994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300006874|Ga0075475_10096860 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300006920|Ga0070748_1229767 | Not Available | 671 | Open in IMG/M |
| 3300007169|Ga0102976_1083153 | All Organisms → Viruses → Predicted Viral | 4081 | Open in IMG/M |
| 3300007538|Ga0099851_1284178 | Not Available | 586 | Open in IMG/M |
| 3300007540|Ga0099847_1018008 | All Organisms → Viruses → Predicted Viral | 2312 | Open in IMG/M |
| 3300007540|Ga0099847_1156567 | Not Available | 676 | Open in IMG/M |
| 3300007640|Ga0070751_1342905 | Not Available | 549 | Open in IMG/M |
| 3300007973|Ga0105746_1339529 | Not Available | 523 | Open in IMG/M |
| 3300008113|Ga0114346_1149631 | Not Available | 998 | Open in IMG/M |
| 3300008259|Ga0114841_1142387 | Not Available | 964 | Open in IMG/M |
| 3300008450|Ga0114880_1125165 | Not Available | 960 | Open in IMG/M |
| 3300009075|Ga0105090_10308789 | Not Available | 969 | Open in IMG/M |
| 3300009081|Ga0105098_10681135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300009082|Ga0105099_10516860 | Not Available | 725 | Open in IMG/M |
| 3300009111|Ga0115026_11137109 | Not Available | 632 | Open in IMG/M |
| 3300009151|Ga0114962_10611826 | Not Available | 564 | Open in IMG/M |
| 3300009154|Ga0114963_10538935 | Not Available | 617 | Open in IMG/M |
| 3300009159|Ga0114978_10489027 | Not Available | 724 | Open in IMG/M |
| 3300009160|Ga0114981_10085281 | All Organisms → Viruses → Predicted Viral | 1753 | Open in IMG/M |
| 3300009164|Ga0114975_10630235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300009165|Ga0105102_10186429 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300009182|Ga0114959_10422557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300009183|Ga0114974_10127417 | Not Available | 1612 | Open in IMG/M |
| 3300009183|Ga0114974_10511456 | Not Available | 672 | Open in IMG/M |
| 3300009185|Ga0114971_10125385 | Not Available | 1558 | Open in IMG/M |
| 3300009684|Ga0114958_10136591 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300010157|Ga0114964_10567259 | Not Available | 533 | Open in IMG/M |
| 3300010316|Ga0136655_1020840 | Not Available | 2190 | Open in IMG/M |
| 3300010354|Ga0129333_11316580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300010354|Ga0129333_11673548 | Not Available | 518 | Open in IMG/M |
| 3300010370|Ga0129336_10067090 | All Organisms → Viruses → Predicted Viral | 2127 | Open in IMG/M |
| 3300010885|Ga0133913_11914640 | Not Available | 1478 | Open in IMG/M |
| 3300010885|Ga0133913_12543890 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
| 3300011010|Ga0139557_1039560 | Not Available | 817 | Open in IMG/M |
| 3300012012|Ga0153799_1042631 | Not Available | 847 | Open in IMG/M |
| 3300012017|Ga0153801_1027291 | Not Available | 1011 | Open in IMG/M |
| 3300013005|Ga0164292_10578541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300013372|Ga0177922_11118268 | Not Available | 697 | Open in IMG/M |
| 3300015050|Ga0181338_1001685 | All Organisms → Viruses → Predicted Viral | 3971 | Open in IMG/M |
| 3300015050|Ga0181338_1059147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300017716|Ga0181350_1073179 | Not Available | 876 | Open in IMG/M |
| 3300017716|Ga0181350_1135890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300017722|Ga0181347_1132245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300017747|Ga0181352_1071834 | Not Available | 977 | Open in IMG/M |
| 3300017747|Ga0181352_1126509 | Not Available | 686 | Open in IMG/M |
| 3300017747|Ga0181352_1160379 | Not Available | 591 | Open in IMG/M |
| 3300017747|Ga0181352_1194826 | Not Available | 522 | Open in IMG/M |
| 3300017754|Ga0181344_1000976 | All Organisms → Viruses | 10895 | Open in IMG/M |
| 3300017766|Ga0181343_1052902 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
| 3300017774|Ga0181358_1228379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300017777|Ga0181357_1129196 | Not Available | 943 | Open in IMG/M |
| 3300017777|Ga0181357_1223128 | Not Available | 664 | Open in IMG/M |
| 3300017777|Ga0181357_1272742 | Not Available | 582 | Open in IMG/M |
| 3300017777|Ga0181357_1333571 | Not Available | 507 | Open in IMG/M |
| 3300017778|Ga0181349_1224471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300017778|Ga0181349_1261587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300017778|Ga0181349_1313738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300017780|Ga0181346_1040764 | Not Available | 1901 | Open in IMG/M |
| 3300017784|Ga0181348_1182591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300017784|Ga0181348_1254684 | Not Available | 606 | Open in IMG/M |
| 3300017784|Ga0181348_1310718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300017785|Ga0181355_1035404 | All Organisms → Viruses → Predicted Viral | 2147 | Open in IMG/M |
| 3300017785|Ga0181355_1118782 | Not Available | 1083 | Open in IMG/M |
| 3300017785|Ga0181355_1166432 | Not Available | 883 | Open in IMG/M |
| 3300017785|Ga0181355_1193572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300017785|Ga0181355_1254425 | Not Available | 672 | Open in IMG/M |
| 3300017785|Ga0181355_1286668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300017785|Ga0181355_1309815 | Not Available | 590 | Open in IMG/M |
| 3300017785|Ga0181355_1320227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300018416|Ga0181553_10131904 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
| 3300019122|Ga0188839_1031418 | Not Available | 523 | Open in IMG/M |
| 3300019783|Ga0181361_118182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300020221|Ga0194127_10533240 | Not Available | 756 | Open in IMG/M |
| 3300020222|Ga0194125_10170218 | All Organisms → Viruses → Predicted Viral | 1617 | Open in IMG/M |
| 3300020229|Ga0194042_1193295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300020517|Ga0208854_1011858 | Not Available | 1459 | Open in IMG/M |
| 3300020711|Ga0214237_1013257 | Not Available | 1071 | Open in IMG/M |
| 3300021093|Ga0194123_10006180 | Not Available | 12493 | Open in IMG/M |
| 3300021135|Ga0214247_1005769 | Not Available | 3139 | Open in IMG/M |
| 3300021325|Ga0210301_1273300 | Not Available | 796 | Open in IMG/M |
| 3300021519|Ga0194048_10204688 | Not Available | 729 | Open in IMG/M |
| 3300021962|Ga0222713_10742758 | Not Available | 554 | Open in IMG/M |
| 3300022068|Ga0212021_1097673 | Not Available | 603 | Open in IMG/M |
| 3300022179|Ga0181353_1040161 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
| 3300022179|Ga0181353_1075977 | Not Available | 853 | Open in IMG/M |
| 3300022190|Ga0181354_1155749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300022198|Ga0196905_1126671 | Not Available | 667 | Open in IMG/M |
| 3300022200|Ga0196901_1105972 | Not Available | 976 | Open in IMG/M |
| 3300022407|Ga0181351_1013821 | All Organisms → Viruses → Predicted Viral | 3333 | Open in IMG/M |
| 3300022407|Ga0181351_1211526 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300022407|Ga0181351_1256143 | Not Available | 541 | Open in IMG/M |
| 3300024552|Ga0256345_1070554 | Not Available | 673 | Open in IMG/M |
| 3300025366|Ga0208505_1017589 | Not Available | 992 | Open in IMG/M |
| 3300025389|Ga0208257_1013220 | Not Available | 1338 | Open in IMG/M |
| 3300025391|Ga0208740_1018538 | Not Available | 1072 | Open in IMG/M |
| 3300025392|Ga0208380_1040346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300025398|Ga0208251_1001335 | Not Available | 6184 | Open in IMG/M |
| 3300025598|Ga0208379_1124921 | Not Available | 597 | Open in IMG/M |
| 3300025671|Ga0208898_1143890 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300025687|Ga0208019_1205957 | Not Available | 511 | Open in IMG/M |
| 3300025840|Ga0208917_1166158 | Not Available | 757 | Open in IMG/M |
| 3300025848|Ga0208005_1184853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300027333|Ga0255138_1047397 | Not Available | 736 | Open in IMG/M |
| 3300027494|Ga0255094_1087560 | Not Available | 534 | Open in IMG/M |
| 3300027621|Ga0208951_1071864 | Not Available | 976 | Open in IMG/M |
| 3300027732|Ga0209442_1204523 | Not Available | 728 | Open in IMG/M |
| 3300027744|Ga0209355_1140990 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300027746|Ga0209597_1088282 | Not Available | 1429 | Open in IMG/M |
| 3300027764|Ga0209134_10157504 | Not Available | 783 | Open in IMG/M |
| 3300027772|Ga0209768_10088544 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300027777|Ga0209829_10129058 | Not Available | 1183 | Open in IMG/M |
| 3300027782|Ga0209500_10092815 | All Organisms → Viruses → Predicted Viral | 1508 | Open in IMG/M |
| 3300027797|Ga0209107_10358834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300027805|Ga0209229_10061614 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
| 3300027896|Ga0209777_10218638 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300027896|Ga0209777_10782118 | Not Available | 671 | Open in IMG/M |
| 3300027896|Ga0209777_11099377 | Not Available | 537 | Open in IMG/M |
| 3300027976|Ga0209702_10363880 | Not Available | 577 | Open in IMG/M |
| 3300028275|Ga0255174_1032004 | Not Available | 939 | Open in IMG/M |
| 3300028394|Ga0304730_1306363 | Not Available | 545 | Open in IMG/M |
| 3300031746|Ga0315293_10792071 | Not Available | 695 | Open in IMG/M |
| 3300031758|Ga0315907_11251541 | Not Available | 516 | Open in IMG/M |
| 3300031758|Ga0315907_11302742 | Not Available | 502 | Open in IMG/M |
| 3300031784|Ga0315899_11528486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300031951|Ga0315904_10818744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300031951|Ga0315904_10913676 | Not Available | 707 | Open in IMG/M |
| 3300031999|Ga0315274_12115898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300032053|Ga0315284_11316268 | Not Available | 783 | Open in IMG/M |
| 3300032093|Ga0315902_10230834 | Not Available | 1822 | Open in IMG/M |
| 3300032116|Ga0315903_10582796 | Not Available | 863 | Open in IMG/M |
| 3300032116|Ga0315903_10901268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300032164|Ga0315283_12349557 | Not Available | 520 | Open in IMG/M |
| 3300033557|Ga0316617_102643484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300033980|Ga0334981_0069981 | All Organisms → Viruses → Predicted Viral | 1782 | Open in IMG/M |
| 3300034012|Ga0334986_0236559 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300034062|Ga0334995_0425432 | Not Available | 823 | Open in IMG/M |
| 3300034066|Ga0335019_0614205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300034092|Ga0335010_0600548 | Not Available | 558 | Open in IMG/M |
| 3300034093|Ga0335012_0204037 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300034101|Ga0335027_0834267 | Not Available | 530 | Open in IMG/M |
| 3300034104|Ga0335031_0235595 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300034112|Ga0335066_0722491 | Not Available | 501 | Open in IMG/M |
| 3300034117|Ga0335033_0566839 | Not Available | 533 | Open in IMG/M |
| 3300034118|Ga0335053_0559865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 9.04% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.01% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.41% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.41% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.41% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.41% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.81% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.20% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.20% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.20% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.20% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.20% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.60% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.60% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.60% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.60% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.60% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.60% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.60% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.60% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003826 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jul08 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
| 3300004776 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005659 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit | Engineered | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020229 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-12m | Environmental | Open in IMG/M |
| 3300020517 | Freshwater microbial communities from Lake Mendota, WI - 30NOV2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020711 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021135 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025366 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027333 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY94_100686941 | 3300000949 | Macroalgal Surface | MEQKIRWSHSSLKDYEGCARRHYEVKVLKNYPFIETKQVIYGKEFHT |
| B570J14230_100954171 | 3300001282 | Freshwater | MSEANITWSHSGLKDFEGCARRYHEVKVLKNYPFQETTHTIYGKDVHKAIE |
| RCM27_10292933 | 3300001836 | Marine Plankton | MQVKWSHSALKDYEGCPRRYHETKVLKKYPFTDTQATLY |
| RCM26_11931343 | 3300001849 | Marine Plankton | MSEHAVTWSHSGLADFEGCARRYHEVKVLKKYPSKDTVHT |
| RCM37_10873101 | 3300001850 | Marine Plankton | MKTVTWSHSALKDYEGCPRRYHEAKVLKKYPFTDTQATLYG |
| JGI24766J26685_101327301 | 3300002161 | Freshwater And Sediment | VQADPTERIIRWSHSALKDYEGCARRYYEVKVLNKYPFQETDATRYG |
| B570J29032_1089212161 | 3300002408 | Freshwater | MKVKWSHSGLKDFEGCARRYHEVKVLKNYPFTDTVHTLYGKQVHEAAEH |
| Ga0007811_10250811 | 3300003787 | Freshwater | MTTIKWSHSGLKDYEGCARRFHEVKVLKNYPFTDTVHTIYGKQV |
| Ga0007872_10130091 | 3300003826 | Freshwater | MTPIKWSHSGLKDYEGCARRYHEIKVLKNYPFTDTVHTIYG |
| Ga0065166_101781921 | 3300004112 | Freshwater Lake | MTVKWSHSALKDYEGCPRRYNEVKVLKNYPFTDTQATLYG |
| Ga0069718_101058955 | 3300004481 | Sediment | MTVKWSHSALKDYEGCPRRYHEVKVLKNYPFTDTDATLYGKALHE |
| Ga0065168_10115011 | 3300004684 | Freshwater | MTNVVWSHSSLKDYEGCPRRYHEVKVLKKFPFVENEHTRY |
| Ga0007797_10628513 | 3300004771 | Freshwater | MKVTWSHSSLKDYEGCAKRYQEVKVLKNFPFVENDATRYGT |
| Ga0007800_100904963 | 3300004776 | Freshwater | MTTIKWSHSGLKDYEGCARRFHEVKVLKNYPFTDTVHTIYGKQVHEAAEVYVKDGTP |
| Ga0007827_100994053 | 3300004777 | Freshwater | MTPIKWSHSGLKDYEGCARRYHEIKVLKNYPFTDTVHTIYGKQ |
| Ga0049080_101606383 | 3300005582 | Freshwater Lentic | MTKVVWSHSSLKDFEGCARRYHEVKVLKNYKFQETN |
| Ga0073900_101313273 | 3300005659 | Activated Sludge | MAEHKIKWSHSSLKDYEGCARRYHEVKVLRKYPFQETDATRYGTEVHA |
| Ga0076948_11214624 | 3300005739 | Lake Water | MTDTQVTRSHSALKDFEGCAKRYHEVKVLKRYPFTHTKHTIYR |
| Ga0075465_100535411 | 3300006037 | Aqueous | MKKVSWSHSSLKDFEGCNRRYHEVKILKNYPFVETEATR |
| Ga0007876_11352193 | 3300006071 | Freshwater | MTTIKWSHSGLKNYEGCARRYHEVNVLKNYPFTDTVHTIYGKQVHE |
| Ga0007867_10052807 | 3300006120 | Freshwater | MKVTWSHSSLKEYEGCPRRYHEVKVLKRFPFKDTE |
| Ga0075467_103649941 | 3300006803 | Aqueous | VTPKKVAWSHSSLKDYEGCARRYHEVKILKKYTFVETDA |
| Ga0075475_100968601 | 3300006874 | Aqueous | MTEHKIKWSHSSLKDYEGCARRYHEVKVLNNYPFQET |
| Ga0070748_12297673 | 3300006920 | Aqueous | MTKVVWSHSSLKDFEGCARRYHEIKVLKNYKFQETDA |
| Ga0102976_10831538 | 3300007169 | Freshwater Lake | MSEQVTWSHSGLKDFEGCARRYHEVKVLKNYPFQETTHTIYGKDVHKAIEDY |
| Ga0099851_12841781 | 3300007538 | Aqueous | MKAWSHSALKDFEGCARRYHEVRVLKKYTQKETEQIRYGKELHKA |
| Ga0099847_10180083 | 3300007540 | Aqueous | MEQKIRWSHSSLKDYEGCARRHYEVKVLKNYPFIETKQVIYGKEFH |
| Ga0099847_11565673 | 3300007540 | Aqueous | MTEHKIKWSHSSLKDYEGCARRYHEVKVLNNYPFQETEQTRYGK |
| Ga0070751_13429053 | 3300007640 | Aqueous | MTVHKIKWSHSSLKDYEGCARRYHEVKVLNNYPFQETE |
| Ga0105746_13395292 | 3300007973 | Estuary Water | MKQPAWSHSSLKDYEGCQRRYQEVKVLKNYPFTETEATRYGNQV |
| Ga0114346_11496314 | 3300008113 | Freshwater, Plankton | MTETNITWSHSGLKDFEGCARRYHEVKVLKNYPFQETTHTIY |
| Ga0114841_11423873 | 3300008259 | Freshwater, Plankton | MSETNITWSHSGLKDFEGCARRYHEVKVLKNYPFQETTHTIYGKDVHKAI |
| Ga0114880_11251651 | 3300008450 | Freshwater Lake | MKKPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEATR |
| Ga0105090_103087891 | 3300009075 | Freshwater Sediment | MGKPVTWSHSALKDFEGCAKRYHAVKVLKRYPFTDTKH |
| Ga0105098_106811351 | 3300009081 | Freshwater Sediment | MTKKVTWSHSSLKDYEGCARRYHEVKILKNYPFVETEATRYGTV |
| Ga0105099_105168601 | 3300009082 | Freshwater Sediment | MPKIKWSHSGFKDYEGCARRFYEVKVLKNYPFTETTHTIYGKQV |
| Ga0115026_111371091 | 3300009111 | Wetland | MTDKQVTWSHSALKDFEGCAKRYHEVKVLKRFPFTDTKHTIYGK |
| Ga0114962_106118262 | 3300009151 | Freshwater Lake | MKVISWSHSALKDYEGCPKRYQEVKILKNYPFTETEAT |
| Ga0114963_105389353 | 3300009154 | Freshwater Lake | MKTVTWSHSALKDYEGCARRYHEVKVLKNYTFQDTQAT |
| Ga0114978_104890273 | 3300009159 | Freshwater Lake | MKPIKWSHSGLKDFEGCARRFHEVKVLKNYPFTENKHTI |
| Ga0114981_100852811 | 3300009160 | Freshwater Lake | VTKVVWSHSSLKDYEGCARRYHEVKILKKYPFKETQAVIYGKELHK |
| Ga0114975_106302352 | 3300009164 | Freshwater Lake | MKVVSWSHSALKDYEGCPKRYQEIKVLKNYPFTETEAT |
| Ga0105102_101864293 | 3300009165 | Freshwater Sediment | MTKVKWSHSGLKDFEGCARRYHEVKVLKNYPFTDTVHTLYG |
| Ga0114959_104225573 | 3300009182 | Freshwater Lake | MAKVTWSHSALKDYEGCARRYHVVKILKQYPFVETDATRYGNEL |
| Ga0114974_101274173 | 3300009183 | Freshwater Lake | MKQVTWSHSALKDFEGCPRRHHEVKILNNYPFQETEA |
| Ga0114974_105114561 | 3300009183 | Freshwater Lake | MKTVTWSHSALKDFEGCPRRYHEVKVLNNFPFQETEATYYGK |
| Ga0114971_101253853 | 3300009185 | Freshwater Lake | MKVTWSHSSLKDYEGCAKRYQEVKVLKNFPFIENDATRYGT |
| Ga0114958_101365911 | 3300009684 | Freshwater Lake | MKKPVWSHSSLKDFEGCQRRYQEVKVLKIYPFTETEATQYGN |
| Ga0114964_105672592 | 3300010157 | Freshwater Lake | MKKLAWSHSSLKDFEGCQRRYQEVKVLKNYPFTETEAT |
| Ga0136655_10208401 | 3300010316 | Freshwater To Marine Saline Gradient | MTEHKIKWSHSSLKDYEGCARRYHEVKVLNNYPFQETEQIRYGKE |
| Ga0129333_113165803 | 3300010354 | Freshwater To Marine Saline Gradient | LKLKWSHSGLKDFENCPRRYHEVKVLKKYPMPDTEQIRYGKEL |
| Ga0129333_116735483 | 3300010354 | Freshwater To Marine Saline Gradient | MKAVTWSHSALKDFEGCPRRYHEIKVLNNFPFQETEATYYGKEFHTA |
| Ga0129336_100670901 | 3300010370 | Freshwater To Marine Saline Gradient | MSERIIRWSHSALKDYEGCARRYYEVKVLGKYPFQETDATRYGVE |
| Ga0133913_119146401 | 3300010885 | Freshwater Lake | VIKWSHSGLKDYEGCARRFYEVKVLKNYPFQDTVHTRYGKQVHEAAE |
| Ga0133913_125438903 | 3300010885 | Freshwater Lake | MKTVTWSHSALKDFEGCPRRYHEVKVLNNFPFQETEATYYG |
| Ga0139557_10395603 | 3300011010 | Freshwater | MTKVVWSHSSLKDYEGCARRYHEVKILKKYPFKESQAVIYGKDDAWGQDDADG |
| Ga0153799_10426313 | 3300012012 | Freshwater | MKAWSHSALKDFEGCARRYHEVRVLKNYVQKPTEQIRY |
| Ga0153801_10272913 | 3300012017 | Freshwater | MKQPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEATR |
| Ga0164292_105785413 | 3300013005 | Freshwater | MKAVTWSHSALKDFEGCPRRYHEIKVLNNFPFQETEATYYG |
| Ga0177922_111182683 | 3300013372 | Freshwater | MNQVTWSHSALKDFEGCARRHYEVKVLNNYPFQETEATRYGT |
| Ga0181338_10016856 | 3300015050 | Freshwater Lake | MIPVKVKWSHSSLKDFEGCARRYHEVKVLKKFPFQDTVQTRYGKELHKA |
| Ga0181338_10591473 | 3300015050 | Freshwater Lake | MKTVTWSHSALKDFEGCPRRYHEVKVLNKYPFQETEATYYG |
| Ga0181350_10731794 | 3300017716 | Freshwater Lake | MTKPVTWSHSSLKDYEGCARRYHEVKILKKYPFVETEAT |
| Ga0181350_11358901 | 3300017716 | Freshwater Lake | MKQPAWSHSSLKDYEGCQRRYQEIKVLKNYPFTETEATRYGNQ |
| Ga0181347_11322451 | 3300017722 | Freshwater Lake | MTKPITWSHSSLKDYEGCARRYHEVKVLKNYKFQETEATRY |
| Ga0181352_10718344 | 3300017747 | Freshwater Lake | MKIKWSHSGLKDFEGCARRYHEVKVLKNYPFTDTVHTIYGKQVHEAAELYI |
| Ga0181352_11265091 | 3300017747 | Freshwater Lake | MKKPAWSHSSLKDFEGCQRRYHEVKVLKNYPFQETEATRY |
| Ga0181352_11603793 | 3300017747 | Freshwater Lake | MKTPAWSHSSLKDFEGCQRRYHEVKVLKNYPFTQTE |
| Ga0181352_11948263 | 3300017747 | Freshwater Lake | MKTPAWSHSSLKDFEGCQRRYHEVKVLKNYPFTQTEATIYG |
| Ga0181344_10009761 | 3300017754 | Freshwater Lake | MTIKWSHSALKDYEGCPRRYHEVKVLKNYPFTDTQATLYG |
| Ga0181343_10529023 | 3300017766 | Freshwater Lake | MTVKWSHSGLKDFEGCARRYHEVKVLKKHPFPDTEQIRYGKQL |
| Ga0181358_12283791 | 3300017774 | Freshwater Lake | MTKPVTWSHSSLNYSEGCARRYHEVKILKKYPFVETETTRYG |
| Ga0181357_11291963 | 3300017777 | Freshwater Lake | MKNIAWSHSALKDFEGCQRRYYEIKVLKNYPFTETEAT |
| Ga0181357_12231283 | 3300017777 | Freshwater Lake | MKAVTWSHSALKDFEGCPRRYHEVKVLNNFPFQETEA |
| Ga0181357_12727421 | 3300017777 | Freshwater Lake | MKKPSWSHSSLKDFEGCQRRYHEVKVLKNYPFVETE |
| Ga0181357_13335713 | 3300017777 | Freshwater Lake | VTAKPVTWSHSSLKDYEGCARRYHEVKILKKYPFVETEATRYG |
| Ga0181349_12244713 | 3300017778 | Freshwater Lake | MKAVTWSHSALKDFEGCPRRYHEVKVLNNFPFQET |
| Ga0181349_12615871 | 3300017778 | Freshwater Lake | MKVVSWSHSALKDYEGCPKRYQEIKVLKNYPFTETE |
| Ga0181349_13137381 | 3300017778 | Freshwater Lake | VTAKPVTWSHSSLKDYEGCARRYHEVKILKKYPFVET |
| Ga0181346_10407643 | 3300017780 | Freshwater Lake | MTKIKWSHSGLKDFEGCARRYHEIKVLKNYPFTDTVHTIYGKQVH |
| Ga0181348_11825911 | 3300017784 | Freshwater Lake | MKAVTWSHSALKDFEGCPRRYHEVKVLNNFPFQETEATDYGKEFPTPAELYIRH |
| Ga0181348_12546843 | 3300017784 | Freshwater Lake | MKQPAWSHSALKDFEGCQRRYQEVKVLKNYPFTETEATRYGNQVHK |
| Ga0181348_13107183 | 3300017784 | Freshwater Lake | VTAKPVTWSHSSLKDYEGCARRYHEVKILKKYPFVETEA |
| Ga0181355_10354041 | 3300017785 | Freshwater Lake | MKVVSWSHSALKDYEGCPKRYQEIKVLKNYPFTETEATRYGNQVHEA |
| Ga0181355_11187821 | 3300017785 | Freshwater Lake | MTKTVTWSHSSLKDYEGCPRRYHEVKVLKKYKFEDTQAT |
| Ga0181355_11664321 | 3300017785 | Freshwater Lake | SSLKDFEGCQRRYHEVKVLKKYPFQETEATRYGNQVHE |
| Ga0181355_11935721 | 3300017785 | Freshwater Lake | MKKQAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEAT |
| Ga0181355_12544253 | 3300017785 | Freshwater Lake | MKNPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQET |
| Ga0181355_12866683 | 3300017785 | Freshwater Lake | MKPVTWSHSALKNFEGCPRRYNEVTVLKNYPFQETEA |
| Ga0181355_13098151 | 3300017785 | Freshwater Lake | VTIKWSHSGLKDYEGCARRFYEVKVLKNYPFQETEHTLS |
| Ga0181355_13202273 | 3300017785 | Freshwater Lake | MKTVTWSHSALKDFEGCPRRYHEVKVLNKYPFQETEAT |
| Ga0181553_101319043 | 3300018416 | Salt Marsh | MKVVSWSHSALKDYEGCPKRYQEVKVLKNYPFTETEATRYG |
| Ga0188839_10314181 | 3300019122 | Freshwater Lake | MQKITWSHSSLKDFEGCARRYHEVKVLKNYPFQETEQIRY |
| Ga0181361_1181821 | 3300019783 | Freshwater Lake | MSEQQVRWSHSALKDFEGCARRYHEVKVLKKYPFQETDATRYGVQVHEAIV |
| Ga0194127_105332403 | 3300020221 | Freshwater Lake | MTTHKVTWSHSSLKDFEGCARRYHEVKVLKKHPFPDTEQIRYGKELHT |
| Ga0194125_101702181 | 3300020222 | Freshwater Lake | MTTHKVTWSHSSLKDFEGCARRYHEVKVLKKHPFPDTEQ |
| Ga0194042_11932952 | 3300020229 | Anoxic Zone Freshwater | MKVVSWSHSALKDYEGCPKRYQEIKVLKNYPFTETEATRYG |
| Ga0208854_10118583 | 3300020517 | Freshwater | MKPVTWSHSALKNFEGCPRRYHEVTVLNNFPFQETEATR |
| Ga0214237_10132571 | 3300020711 | Freshwater | MTTIKWSHSGLKDYEGCARRFHEVKVLKNYPFTDTVH |
| Ga0194123_100061807 | 3300021093 | Freshwater Lake | MTTHKVTWSHSSLKDFEGCARRYHEVKVLKKHPFPDTEQIRYGKELHTAV |
| Ga0214247_10057691 | 3300021135 | Freshwater | MTTIKWSHSGLKDYEGCARRFHEVKVLKNYPFTDTVHTIYGKQVHEAAEVYVKDG |
| Ga0210301_12733004 | 3300021325 | Estuarine | MSEKIIRWSHSALKDYEGCARRYHEVKVLGKYPFQET |
| Ga0194048_102046881 | 3300021519 | Anoxic Zone Freshwater | MIEKKVTWSHSSLKDFEGCARRYHEVKVLKNYPFT |
| Ga0222713_107427581 | 3300021962 | Estuarine Water | MKAWSHSALKDFEGCARRYHEVRVLKNYEQKPTEQIR |
| Ga0212021_10976731 | 3300022068 | Aqueous | MTEHKIKWSHSSLKDYEGCARRYHEVKVLNNYPFQ |
| Ga0181353_10401611 | 3300022179 | Freshwater Lake | MKKPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEAT |
| Ga0181353_10759771 | 3300022179 | Freshwater Lake | MTVKWSHSGLKDFEGCARRYHEVKVLKKHPFPDTEQ |
| Ga0181354_11557493 | 3300022190 | Freshwater Lake | MKQPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEATRYGNQV |
| Ga0196905_11266711 | 3300022198 | Aqueous | MEHKVVWSHSALKDYEGCARRYHETRILKAYPFEKTEQIIYGEELHKAA |
| Ga0196901_11059723 | 3300022200 | Aqueous | MQKVTWSHSSLKDFEGCARRYHEVKVLKNYPFQETEQTR |
| Ga0181351_10138217 | 3300022407 | Freshwater Lake | MKTVTWSHSALKDFEGCPRRYHEVKVLNKYPFQETEATYYGK |
| Ga0181351_12115261 | 3300022407 | Freshwater Lake | MKKPAWSHSSLKDYEGCARRYHEVKVLKKYPFQETEATR |
| Ga0181351_12561431 | 3300022407 | Freshwater Lake | MKVVSWSHSALKDYEGCPKRYQEIKVLKNYPFTETEATR |
| Ga0256345_10705541 | 3300024552 | Freshwater | MTIKWSHSALKDYEGCARRYYEVKVLKNYPFTDTQAT |
| Ga0208505_10175891 | 3300025366 | Freshwater | MTPIKWSHSGLKDYEGCARRYHEIKVLKNYPFTDTVHTIYGKQVHE |
| Ga0208257_10132204 | 3300025389 | Freshwater | MKKPAWSHSSLKDFEGCQRRYHEIKVLKNYPFVETDATRYG |
| Ga0208740_10185381 | 3300025391 | Freshwater | MTPIKWSHSGLKDYEGCARRYHEIKVLKNYPFTDTVHTIYGKQVHESAEFY |
| Ga0208380_10403461 | 3300025392 | Freshwater | MTTIKWSHSGLKDYEGCARRFHEVKVLKNYPFTDTVHTIYGKQ |
| Ga0208251_10013351 | 3300025398 | Freshwater | MTPIKWSHSGLKDYEGCARRYHEIKVLKNYPFTDTVHTIYGKQVHESAEFYIRDG |
| Ga0208379_11249213 | 3300025598 | Freshwater | MKTWSYSSLKEYINCPRQYNEVKVLKRFTKPYTKE |
| Ga0208898_11438901 | 3300025671 | Aqueous | MKKPAWSHSSLKDYEGCARRYHEVKVLKKYPFQETEATRYGNQV |
| Ga0208019_12059571 | 3300025687 | Aqueous | MQKVTWSHSSLKDFEGCARRYHEVKVLKNYPFQET |
| Ga0208917_11661581 | 3300025840 | Aqueous | MTEHKIKWSHSSLKDYEGCARRYHEVKVLNNYPFQETE |
| Ga0208005_11848533 | 3300025848 | Aqueous | MKKPAWSHSSLKDYEGCARRYHEVKVLKKYPFQET |
| Ga0255138_10473971 | 3300027333 | Freshwater | MKKPAWSHSSLKDFEGCARRYHEVKVLKKYPFQETEATRYGN |
| Ga0255094_10875603 | 3300027494 | Freshwater | MKPVTWSHSSLKDYEGCPRRYHEVKVLKNYPFTDT |
| Ga0208951_10718641 | 3300027621 | Freshwater Lentic | MQPVTWSHSALKNFEGCPRRYNEVTVLKNYPFQETE |
| Ga0209442_12045231 | 3300027732 | Freshwater Lake | MKKPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETDAT |
| Ga0209355_11409901 | 3300027744 | Freshwater Lake | MTKVVWSHSSLKDYEGCARRYHEVKILKKYPFKETQAVIYGKELH |
| Ga0209597_10882821 | 3300027746 | Freshwater Lake | MKKPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEATRYGNQ |
| Ga0209134_101575043 | 3300027764 | Freshwater Lake | MKQPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEA |
| Ga0209768_100885443 | 3300027772 | Freshwater Lake | MKAVTWSHSALKDFEGCPRRYHEVKVLNNFPFQETEATYYGKGFH |
| Ga0209829_101290583 | 3300027777 | Freshwater Lake | MSKITWSHSALKDYEGCARRYHEVKVLKNYTFQDTQ |
| Ga0209500_100928153 | 3300027782 | Freshwater Lake | MKKPAWSHSSLKDFEGCQRRYQEIKVLKNYPFTETEA |
| Ga0209107_103588341 | 3300027797 | Freshwater And Sediment | MKKPAWSHSSLKDFEGCARRYHEVKVLKKYPFQETEAT |
| Ga0209229_100616141 | 3300027805 | Freshwater And Sediment | MIPVKVKWSHSALKDFEGCARRYHEVKVLKKFPFQDSVQTRNLET |
| Ga0209777_102186381 | 3300027896 | Freshwater Lake Sediment | MKPVSWSHSALKDYEGCPKRYQEVSVLKNYPFQETE |
| Ga0209777_107821181 | 3300027896 | Freshwater Lake Sediment | MKVTWSHSSLKDYEGCPRRYQEVKVLKNFPFVENDATR |
| Ga0209777_110993771 | 3300027896 | Freshwater Lake Sediment | MAKIKWSHSGLKDYEGCARRYHEVKVLKKYPFTDTKHTIY |
| Ga0209702_103638801 | 3300027976 | Freshwater | MKAPAWSHSSLKDFEGCARRYHEVKVLKKYPFTSTDATRYGL |
| Ga0255174_10320041 | 3300028275 | Freshwater | MTIKWSHSALKDYEGCARRYYEVKVLKNYPFTDTQATLYG |
| Ga0304730_13063632 | 3300028394 | Freshwater Lake | MIPVKVKWSHSSLKDFEGCARRYHEVKVLKKFPFQDT |
| Ga0315293_107920711 | 3300031746 | Sediment | MKPIKWSHSGLKDFEGCARRFHEVKVLKNYPFTENKHTIYGKQVHDSAEQYIKD |
| Ga0315907_112515412 | 3300031758 | Freshwater | MKNPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEATRYGNQ |
| Ga0315907_113027421 | 3300031758 | Freshwater | MGKPVTWSHSGLKKFEQCARQYHEVTVLKRFPFTDTKHTIYG |
| Ga0315899_115284861 | 3300031784 | Freshwater | MKKQIAWSHSSLKDFEGCARRYHEVKVLKNYPFTENEATRY |
| Ga0315904_108187443 | 3300031951 | Freshwater | MTKVTWSHSSLKDYEGCARRYHEVKILKKYPFQETEAT |
| Ga0315904_109136761 | 3300031951 | Freshwater | MGKPVTWSHSGLKKFEQCARQYHEVTVLKRFPFVDNKHTIYGKDVHKAIEDYGR |
| Ga0315274_121158982 | 3300031999 | Sediment | MQPVTWSHSALKNFEGCPRRYNEVTVLKNYPFQETEATR |
| Ga0315284_113162684 | 3300032053 | Sediment | VKEVKWSHSGLKNYETCPRQFHELKVLKNYPRVETEATI |
| Ga0315902_102308341 | 3300032093 | Freshwater | MKKPAWSHSSLKDFEGCQRRYHEVKVLKNYPFQET |
| Ga0315903_105827961 | 3300032116 | Freshwater | MKNPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEA |
| Ga0315903_109012683 | 3300032116 | Freshwater | MTKVTWSHSSLKDFEGCARRYHEVKVLKNYPFQET |
| Ga0315283_123495571 | 3300032164 | Sediment | MANETTTVQWSHSGLKQFETCARQYHEVKVLKKYPRQ |
| Ga0316617_1026434842 | 3300033557 | Soil | MNTVVWSHSSLKDYEGCPRRYHEVKVLKNYAFQET |
| Ga0334981_0069981_3_113 | 3300033980 | Freshwater | MKAWSHSALKDFEGCARRYHEVRVLKNYVQKPTEQIR |
| Ga0334986_0236559_3_110 | 3300034012 | Freshwater | MKTVTWSHSSLKDYEGCPRRYHEVKVLKNYPFKDTD |
| Ga0334995_0425432_3_113 | 3300034062 | Freshwater | MEIKPITWSHSALKKYEQCPRQYHEAIVLKKYPFKDT |
| Ga0335019_0614205_507_635 | 3300034066 | Freshwater | MKKQAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEATRYGNQ |
| Ga0335010_0600548_438_557 | 3300034092 | Freshwater | MKKPAWSHSSLKDFEGCQRRYHEVKVLKKYPFQETEATRY |
| Ga0335012_0204037_900_1046 | 3300034093 | Freshwater | MSEHQIKWSHSSLKDYEGCARRYHEVKVGKKYPFQETDATRYGVQVHEA |
| Ga0335027_0834267_410_529 | 3300034101 | Freshwater | MSETNITWSHSGLKDFEGCARRYHEVKVLKNYPFQETTHT |
| Ga0335031_0235595_2_166 | 3300034104 | Freshwater | MPKIKWSHSGLKDFEGCARRFHEVKVLKNYPFTETTHTIYGKQVHESAELYIKDG |
| Ga0335066_0722491_1_135 | 3300034112 | Freshwater | MNLRWSHSALKDFEGCARRYHEVKVLKKYPFPDTEQTRYGKDFHT |
| Ga0335033_0566839_421_531 | 3300034117 | Freshwater | MKKPAWSHSLLKDYEGCSRRYHEVKVLKKYPFTETEA |
| Ga0335053_0559865_1_105 | 3300034118 | Freshwater | MKQPAWSHSALKDFEGCQRRYQEVKVLKNYPFTET |
| ⦗Top⦘ |