Metagenome Family F038059

Overview

Basic Information

• Family ID: F038059
• Family Type: Metagenome
• Number of Sequences: 166
• Average Sequence Length: 40 residues
• Representative Sequence: MAFLLPSEFRAPTDQEVYSDFDESEYEEIVAKLTVIQ
• Number of Associated Samples: 70
• Number of Associated Scaffolds: 165

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 1.84 %
• % of genes near scaffold ends (potentially truncated): 63.86 %
• % of genes from short scaffolds (< 2000 bps): 98.19 %
• Associated GOLD sequencing projects: 70
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (50.000 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.181 % of family members)
• Environment Ontology (ENVO): Unclassified (95.783 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (95.783 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 36.92%
  β-sheet: 0.00%
  Coil/Unstructured: 63.08%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 165 Family Scaffolds
PF13650	Asp_protease_2	9.09

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.00 %
Unclassified	root	N/A	50.00 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	50.00 %
Unclassified	root	N/A	50.00 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	50.00 %
Unclassified	root	N/A	50.00 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	50.00 %
Unclassified	root	N/A	50.00 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	50.00 %
Unclassified	root	N/A	50.00 %

Level 6

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	50.00 %
Unclassified	root	N/A	50.00 %

Level 7

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	50.00 %
Unclassified	root	N/A	50.00 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	48.80 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	48.80 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	48.80 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	48.80 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	48.80 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	39.16 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	9.64 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	39.16 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	9.64 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	39.16 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	9.64 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	39.16 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	9.64 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	39.16 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	9.64 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	39.16 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	4.82 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.20 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	39.16 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4.22 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	1.20 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.60 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	39.16 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	4.22 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	1.20 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.60 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	39.16 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	4.22 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	1.20 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.60 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.16 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	3.61 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1.20 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.60 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.16 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3.61 %
Oryza officinalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza officinalis	0.60 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.60 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.16 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	2.41 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.60 %
Oryza officinalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza officinalis	0.60 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.60 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.16 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2.41 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.60 %
Oryza officinalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza officinalis	0.60 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.60 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300009148|Ga0105243_11626154	Not Available	673
3300009148|Ga0105243_12495426	Not Available	556
3300013297|Ga0157378_11767356	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	666
3300013297|Ga0157378_11925699	Not Available	640
3300013297|Ga0157378_13076975	Not Available	518
3300014969|Ga0157376_11656720	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	674
3300015267|Ga0182122_1038546	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	600
3300015267|Ga0182122_1044580	Not Available	577
3300015267|Ga0182122_1062403	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	524
3300015268|Ga0182154_1066093	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	519
3300015274|Ga0182188_1023062	Not Available	652
3300015274|Ga0182188_1024163	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	644
3300015274|Ga0182188_1024212	Not Available	644
3300015276|Ga0182170_1017533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	763
3300015277|Ga0182128_1041032	Not Available	609
3300015277|Ga0182128_1067165	Not Available	529
3300015281|Ga0182160_1012411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	855
3300015281|Ga0182160_1025057	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	708
3300015281|Ga0182160_1033182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	655
3300015283|Ga0182156_1069978	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	539
3300015285|Ga0182186_1026330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	701
3300015285|Ga0182186_1028652	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	685
3300015285|Ga0182186_1058884	Not Available	558
3300015285|Ga0182186_1065580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	540
3300015285|Ga0182186_1065580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	540
3300015286|Ga0182176_1065760	Not Available	548
3300015286|Ga0182176_1071339	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	533
3300015287|Ga0182171_1063481	Not Available	556
3300015288|Ga0182173_1058707	Not Available	565
3300015289|Ga0182138_1009856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	931
3300015289|Ga0182138_1012231	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	878
3300015291|Ga0182125_1024748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	742
3300015292|Ga0182141_1032698	Not Available	685
3300015292|Ga0182141_1039008	Not Available	652
3300015292|Ga0182141_1045124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	625
3300015292|Ga0182141_1063063	Not Available	568
3300015292|Ga0182141_1069348	Not Available	552
3300015292|Ga0182141_1077814	Not Available	533
3300015294|Ga0182126_1066642	Not Available	562
3300015294|Ga0182126_1072953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	547
3300015294|Ga0182126_1095450	Not Available	503
3300015295|Ga0182175_1033249	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	693
3300015295|Ga0182175_1057408	Not Available	593
3300015295|Ga0182175_1063192	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	576
3300015295|Ga0182175_1086693	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	523
3300015295|Ga0182175_1089632	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	518
3300015296|Ga0182157_1015034	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	879
3300015296|Ga0182157_1082119	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	540
3300015296|Ga0182157_1088088	Not Available	528
3300015298|Ga0182106_1059657	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	595
3300015298|Ga0182106_1067176	Not Available	574
3300015298|Ga0182106_1072360	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	561
3300015298|Ga0182106_1100705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	505
3300015299|Ga0182107_1040212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	671
3300015300|Ga0182108_1068795	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	577
3300015302|Ga0182143_1047272	Not Available	639
3300015302|Ga0182143_1058820	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	600
3300015303|Ga0182123_1031435	Not Available	698
3300015303|Ga0182123_1045605	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	630
3300015303|Ga0182123_1051395	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	609
3300015303|Ga0182123_1068058	Not Available	562
3300015304|Ga0182112_1014935	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	886
3300015304|Ga0182112_1026714	Not Available	754
3300015304|Ga0182112_1070212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	571
3300015305|Ga0182158_1031823	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	714
3300015305|Ga0182158_1085966	Not Available	534
3300015305|Ga0182158_1087570	Not Available	531
3300015307|Ga0182144_1005685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1166
3300015307|Ga0182144_1063060	Not Available	595
3300015307|Ga0182144_1074361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	566
3300015308|Ga0182142_1073447	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	579
3300015308|Ga0182142_1080515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	563
3300015314|Ga0182140_1051911	Not Available	644
3300015322|Ga0182110_1046306	Not Available	682
3300015322|Ga0182110_1057023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	642
3300015322|Ga0182110_1058121	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	638
3300015322|Ga0182110_1093141	Not Available	552
3300015322|Ga0182110_1094130	Not Available	550
3300015322|Ga0182110_1104218	Not Available	532
3300015323|Ga0182129_1062682	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	606
3300015323|Ga0182129_1075169	Not Available	575
3300015323|Ga0182129_1078887	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	566
3300015323|Ga0182129_1088205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	547
3300015323|Ga0182129_1088310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	547
3300015323|Ga0182129_1112830	Not Available	507
3300015341|Ga0182187_1147750	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	562
3300015342|Ga0182109_1160686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	571
3300015342|Ga0182109_1189473	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	535
3300015342|Ga0182109_1190439	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	534
3300015343|Ga0182155_1031105	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1002
3300015343|Ga0182155_1086916	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	710
3300015343|Ga0182155_1119010	Not Available	636
3300015343|Ga0182155_1123131	Not Available	629
3300015344|Ga0182189_1230038	Not Available	500
3300015345|Ga0182111_1100691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	706
3300015345|Ga0182111_1108456	Not Available	687
3300015345|Ga0182111_1150811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	607
3300015345|Ga0182111_1162745	Not Available	590
3300015345|Ga0182111_1229589	Not Available	515
3300015346|Ga0182139_1186617	Not Available	560
3300015346|Ga0182139_1194022	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	551
3300015346|Ga0182139_1238729	Not Available	507
3300015347|Ga0182177_1093160	Not Available	730
3300015351|Ga0182161_1026622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1194
3300015355|Ga0182159_1243867	Not Available	590
3300015355|Ga0182159_1292206	Not Available	545
3300015355|Ga0182159_1328856	Not Available	517
3300015361|Ga0182145_1039561	Not Available	849
3300015361|Ga0182145_1174002	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	522
3300017404|Ga0182203_1075631	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	647
3300017404|Ga0182203_1113942	Not Available	568
3300017404|Ga0182203_1124987	Not Available	550
3300017404|Ga0182203_1143424	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	525
3300017407|Ga0182220_1048811	Not Available	630
3300017407|Ga0182220_1055163	Not Available	609
3300017409|Ga0182204_1082966	Not Available	564
3300017410|Ga0182207_1116372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	580
3300017410|Ga0182207_1173402	Not Available	505
3300017411|Ga0182208_1040207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	719
3300017411|Ga0182208_1057927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza officinalis	646
3300017411|Ga0182208_1062756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	631
3300017411|Ga0182208_1103185	Not Available	540
3300017411|Ga0182208_1104146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	539
3300017413|Ga0182222_1051582	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	611
3300017415|Ga0182202_1076183	Not Available	611
3300017417|Ga0182230_1044046	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	782
3300017417|Ga0182230_1049059	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	741
3300017417|Ga0182230_1114544	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	506
3300017420|Ga0182228_1113408	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	527
3300017424|Ga0182219_1033274	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	786
3300017424|Ga0182219_1060926	Not Available	651
3300017424|Ga0182219_1074149	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	613
3300017424|Ga0182219_1083087	Not Available	593
3300017424|Ga0182219_1093581	Not Available	571
3300017425|Ga0182224_1165422	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	502
3300017427|Ga0182190_1046861	Not Available	770
3300017427|Ga0182190_1112307	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	574
3300017427|Ga0182190_1112929	Not Available	573
3300017430|Ga0182192_1059729	Not Available	726
3300017430|Ga0182192_1141585	Not Available	540
3300017430|Ga0182192_1148175	Not Available	531
3300017433|Ga0182206_1067467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	661
3300017436|Ga0182209_1149343	Not Available	528
3300017436|Ga0182209_1150243	Not Available	527
3300017436|Ga0182209_1155729	Not Available	521
3300017438|Ga0182191_1087138	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	645
3300017442|Ga0182221_1129113	Not Available	549
3300017443|Ga0182193_1071939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	709
3300017443|Ga0182193_1102276	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	631
3300017443|Ga0182193_1184511	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	514
3300017680|Ga0182233_1102155	Not Available	531
3300017681|Ga0182226_1048126	Not Available	770
3300017682|Ga0182229_1084580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	554
3300017683|Ga0182218_1144557	Not Available	512
3300017684|Ga0182225_1060564	Not Available	658
3300017684|Ga0182225_1128091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	522
3300017685|Ga0182227_1071503	Not Available	641
3300017686|Ga0182205_1144001	Not Available	533
3300017690|Ga0182223_1043270	Not Available	672
3300017690|Ga0182223_1099543	Not Available	535
3300017690|Ga0182223_1109261	Not Available	521
3300021060|Ga0182232_1064028	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	603
3300025940|Ga0207691_11715535	Not Available	508

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.22%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.60%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.60%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	95.18%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.41%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.60%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.60%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105243_116261542	3300009148	Miscanthus Rhizosphere	MVFLLPSKFKAPADQEVYSNFDELEYEEMATQLTLIHQAIFDKPVK
Ga0105243_124954261	3300009148	Miscanthus Rhizosphere	NIQMAFLLPSEVRALADQEVYSDFDESEYEEIVAKLIVIQ*
Ga0157378_117673563	3300013297	Miscanthus Rhizosphere	MAFLLPSEFRAPVDQEVYSDFDESKYEEIVAKLTVIQQAIFDKL
Ga0157378_119256991	3300013297	Miscanthus Rhizosphere	PSANIQMDFLLPSKFKAPADQEVYSNFDESEYEKMAAQLTLI*
Ga0157378_130769751	3300013297	Miscanthus Rhizosphere	MGFLLPSEFRALADQEVYSDFNESEYEDMVAKLTVIQQVIFDK
Ga0157376_116567201	3300014969	Miscanthus Rhizosphere	MAFLLPFEFKAPADQEVYSDFDESEYEEIAAQLTLIQQATF
Ga0182122_10385461	3300015267	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESKYEEIVAKLTVI*
Ga0182122_10445803	3300015267	Miscanthus Phyllosphere	MAFLLPSEFRALVDQEVYSDFDESEYEEIVAKLMV
Ga0182122_10624031	3300015267	Miscanthus Phyllosphere	MAFLLLSEFRAPTDQEVYSDFDESEYEEIVAKLIV
Ga0182154_10660932	3300015268	Miscanthus Phyllosphere	MTFLFLSEFRALADQEVYSDVDESEYEEMVTKLIVIQQAIFDKAIKHRY
Ga0182188_10230623	3300015274	Miscanthus Phyllosphere	MAFLLPYEFKALADQEVYSDFDESEYEEMVAQLTLI
Ga0182188_10241633	3300015274	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYLDFDELEYEEMAAQLTMI*
Ga0182188_10242123	3300015274	Miscanthus Phyllosphere	MAFLLQSEFRAPADQEVYSDFDESEYEEIVAKLTMVQQA
Ga0182170_10175333	3300015276	Miscanthus Phyllosphere	MAFLLPLEFRALADQEVYLDFNESECEEIVAKLIVIRQVIFDKPVK
Ga0182170_10702801	3300015276	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYLDFDESEYEGMAAQLTLI*
Ga0182128_10410321	3300015277	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYLDFDELKYEEIVAKLMV
Ga0182128_10671651	3300015277	Miscanthus Phyllosphere	PLANIQMAFLLPSEFRAPADQGVYSDFDELEYEEIVAKLTVV*
Ga0182160_10124111	3300015281	Miscanthus Phyllosphere	VAFLLPSEFRAPVDQEVYSDFDESEYEEIVAKLIV
Ga0182160_10250572	3300015281	Miscanthus Phyllosphere	MAFLFPSEFRAPADQEVYSDFDESEYEEIIDKLTVV*
Ga0182160_10331822	3300015281	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYEEMVAKLTVIQQAICNTLGV*
Ga0182156_10699781	3300015283	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDESEYEEIVAKLMVIQQAIFDKPV
Ga0182186_10263302	3300015285	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDESEYEKIVAKLTVI*
Ga0182186_10286521	3300015285	Miscanthus Phyllosphere	MAFRLPSEFKAPADKEVYSDFDELEYEQIVAKLTVIQQAI
Ga0182186_10588842	3300015285	Miscanthus Phyllosphere	MAFLLPLEFRALIDQEVYLNFDESEYEEIVAKLTVVQQAIFD
Ga0182186_10655801	3300015285	Miscanthus Phyllosphere	CLLPSEFRAPTDQEVYLDFDESEYEEIVVKLTVI*
Ga0182186_10655802	3300015285	Miscanthus Phyllosphere	MAFLLPLEFRALADQEAYLDFDESEYEEMVAKLTVIQQSIFDKSV
Ga0182176_10657601	3300015286	Miscanthus Phyllosphere	MAFLLPLEFRAPVDQEIYLDFEESEYEEIVAKLAVIQQAIF
Ga0182176_10713391	3300015286	Miscanthus Phyllosphere	MTFLLPSEFRALVDQEVYLDFDESDYEEIVAKLTVI*
Ga0182171_10634811	3300015287	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSNYDESEYEEMVAKLIVVQ*
Ga0182173_10587072	3300015288	Miscanthus Phyllosphere	MAFLLPSEFKAPVDQEVCLDFDQSEYEEMAARLTLI*
Ga0182138_10098562	3300015289	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVAKLTVI*
Ga0182138_10122311	3300015289	Miscanthus Phyllosphere	MAFLLPSEFRALADQEVYSDFDESEYEMVAKLTVAQ
Ga0182125_10247483	3300015291	Miscanthus Phyllosphere	MAFLLPLEFRSTADQEVYLDFDESEYEEIVAKLMVVQQAIFDKS
Ga0182141_10326981	3300015292	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDELDYEEIVAKLMVI*
Ga0182141_10390082	3300015292	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDELEYEEIVAKLTVIQ*
Ga0182141_10451243	3300015292	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYGEIVAKLTVIQRAI
Ga0182141_10630632	3300015292	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSNFDESKYEEIVAKLVVIQ*
Ga0182141_10693481	3300015292	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYLDFDESECEEMVAKLTVTQQAIFDK
Ga0182141_10778142	3300015292	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYEEIVTKLTVIQQAIFDKPVKH*
Ga0182126_10666422	3300015294	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYSDFDESEYEEVVAKLTVV*
Ga0182126_10729531	3300015294	Miscanthus Phyllosphere	MAFLLLSEFRAPADQEVYSDFDESEYEEMVAKLIVIQQAIFDK
Ga0182126_10954502	3300015294	Miscanthus Phyllosphere	MAFLLPSEFRASVDQEVYSDFDESECEEMVAKLMVTHQAIFDKPVKHQHLK
Ga0182175_10332491	3300015295	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVVKLTMIQ*
Ga0182175_10574081	3300015295	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYSDFDEPEYEEIVAKLTVI*
Ga0182175_10631922	3300015295	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYLDFDESEYEEMVAKLMVVQ*
Ga0182175_10866932	3300015295	Miscanthus Phyllosphere	MSFLLPSEFKALVDQEVYSDFDESEYEEIVTKLTVVHQAIFDKPVKH
Ga0182175_10896321	3300015295	Miscanthus Phyllosphere	MAFLLPSEFRTPANQEVYSDFDESEYEEIIAKLIVVHQAKFDNPIK
Ga0182157_10150341	3300015296	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYSDFDESEYEEMVAKLTLI*
Ga0182157_10821192	3300015296	Miscanthus Phyllosphere	MAFLLASEFRAPADQEVYSDFDESEYEEIVAKLTVVQ
Ga0182157_10880883	3300015296	Miscanthus Phyllosphere	MAFLLPSKFRALVDQEVYSDFDESEYEEIVAKLTVI
Ga0182106_10596572	3300015298	Miscanthus Phyllosphere	MAFLLPSEFRASIDQKVYLDFDESKYQEIVAKLTVIHQAIFDKPVK
Ga0182106_10671761	3300015298	Miscanthus Phyllosphere	ANIQMDFLLPSEFRALADQEVYSYFDESEYEKIVAKLMVMQ*
Ga0182106_10723602	3300015298	Miscanthus Phyllosphere	MAFLLPLEFRAPVDQEVYSYFDESEYEEIVAKLTVIQQAIFD
Ga0182106_11007051	3300015298	Miscanthus Phyllosphere	MAFLLLSEFKSLADQEVYSYFDESEYEEIVAKLTVIQQAIF
Ga0182107_10402122	3300015299	Miscanthus Phyllosphere	MAFLLPSEFKALADQEVYSDFDESEYEEMATQLIL
Ga0182108_10687952	3300015300	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYSDFDESEYEEIVAKLTVV*
Ga0182143_10472722	3300015302	Miscanthus Phyllosphere	MAFLLPSEFRALADQEVYSDFDESEYEEMVAKLTVI*
Ga0182143_10588201	3300015302	Miscanthus Phyllosphere	MAFLLPSEFRALADQEVYSDFDESEYEEMVAKLTVVPQAIFDKPVKH
Ga0182123_10314352	3300015303	Miscanthus Phyllosphere	MAFLLPSKFKAPADQEVYLDFDESEYEEMVAKLIVIQ*
Ga0182123_10456051	3300015303	Miscanthus Phyllosphere	MVFLLTSEVRALADQEVYSDFDESKYEEIVAKLTVVQQAIFD
Ga0182123_10513952	3300015303	Miscanthus Phyllosphere	MAFLLSSEFRAPADQEIYLDFDESEYEEIVAKLTVVHEA
Ga0182123_10680582	3300015303	Miscanthus Phyllosphere	QMAFLLLSEFRAPTDPEVYSDFDESEYEDIVAKLTVIQQAIFDKLVKH*
Ga0182112_10149351	3300015304	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEAYLDFDELEYEEIVAKLTVIQHAI
Ga0182112_10267142	3300015304	Miscanthus Phyllosphere	IQMAFLLPSEFRAPADQEVYSDFDESEYEEIVAKLTVI*
Ga0182112_10702122	3300015304	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEVYSDFDELEYEEIVAKLTVI*
Ga0182158_10318231	3300015305	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDESEYEEIVAKLMAVQQAIFDKPIKHRHLKALY
Ga0182158_10859661	3300015305	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEVYSDFEELEYEEIVAKLIVI*
Ga0182158_10875702	3300015305	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYVEIVAKLIVIQQTIFDKPMKLGT*
Ga0182144_10056853	3300015307	Miscanthus Phyllosphere	AFLLLSEFRAPVDQEVYLDFDELEYEEIVAKLTVV*
Ga0182144_10630601	3300015307	Miscanthus Phyllosphere	TFLLPYEFKAPADQEVYSDFDESEYEEMAAQLTFI*
Ga0182144_10743613	3300015307	Miscanthus Phyllosphere	MAFLLPSEFRALTDQEVYLDFDESEYEEIVAKLTVVHQAI
Ga0182142_10734472	3300015308	Miscanthus Phyllosphere	MAFLLLLEFRALADQEVYLDFDESEYEKIVAKLAIIQ*
Ga0182142_10805151	3300015308	Miscanthus Phyllosphere	MAFLLPLEFRAPVDQQVYLDFDELEYEEIVAKLMVI*
Ga0182140_10519112	3300015314	Miscanthus Phyllosphere	MAFLLLLEFRAPTDQEVYLDFDESEYEKIVANLIVIQQAIFDKP
Ga0182110_10463062	3300015322	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEIYSDFDESEYKEIVAKLTVI*
Ga0182110_10570231	3300015322	Miscanthus Phyllosphere	IQIAFLLPSEFTALVDQEVYSDFDESEYEEIIAKLTVV*
Ga0182110_10581213	3300015322	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDESKYEEIVAMLTVIQ
Ga0182110_10931411	3300015322	Miscanthus Phyllosphere	MAFLLPSEFRALATQEVYSDFDESEYEEIVAKLMIVQQAIFHKPVKH
Ga0182110_10941302	3300015322	Miscanthus Phyllosphere	MAFLLLSEFRAPIDQEVYSDFDESKYEEIVAKLTVI*
Ga0182110_10943782	3300015322	Miscanthus Phyllosphere	MIFLLPSEFKAPADQEVYLDFDESEYEEMAAQLTLI
Ga0182110_11042181	3300015322	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYLDFDELEYEEIVAKLTVI*
Ga0182129_10626822	3300015323	Miscanthus Phyllosphere	MAFLLPFEFKALAYQEVYLDFDELEYEEMAAQLTLIQ*
Ga0182129_10751693	3300015323	Miscanthus Phyllosphere	QSSVNIQMAFLLPLEFRASADQEVYSYFDESEYEEMIAKLTVI*
Ga0182129_10788873	3300015323	Miscanthus Phyllosphere	MAFLLPSEFGAPEDQEVYSYFDESEYEEMAAKLTVVQQAIFDK
Ga0182129_10882053	3300015323	Miscanthus Phyllosphere	MVFLLPLEFRVPADQEVYSDFDESKYEEIVAKLTVIQQ
Ga0182129_10883101	3300015323	Miscanthus Phyllosphere	MTFLLPLEFRAPADQEVYSEFDELEYEEMVAKLTAIQQAI
Ga0182129_11128302	3300015323	Miscanthus Phyllosphere	MAFLLSLEFRAAADQEVYSDFDESEYEEMVAKLTMI*
Ga0182187_11477503	3300015341	Miscanthus Phyllosphere	MVFLLPSEFRALVDQEVYSNFDESEYEEIVAKLMVIQQAIFDK
Ga0182109_11606862	3300015342	Miscanthus Phyllosphere	MAFLLPSEFRALANQEVYSDFDESEYEEMVAKLMVV*
Ga0182109_11894731	3300015342	Miscanthus Phyllosphere	MAFLLLSEFRAPADQEVYSDFDKSEYEEIVAKLTVIQQAIF
Ga0182109_11904392	3300015342	Miscanthus Phyllosphere	LLPSEFRAPTYQEVYSDFDKSKYEEIVAKLIVIQ*
Ga0182155_10311052	3300015343	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDELEYEEIVAKLAVIQQAIFDKPVK
Ga0182155_10869162	3300015343	Miscanthus Phyllosphere	MAFLLPSEFRASVDQEVYSDFDESEYEEIVAKLTIVQQAIF
Ga0182155_11190102	3300015343	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEIYLDFDESEYEEIVAKLIVIHQAIFDKPV
Ga0182155_11231312	3300015343	Miscanthus Phyllosphere	IQMAFLLPSKFKAPADQQVYSDFDESKYEEMVAQLTLI*
Ga0182189_12300381	3300015344	Miscanthus Phyllosphere	MAFLLPSEFKALADQEVYSDFNESEYEEMVAQLTLIQQAIFD
Ga0182111_11006913	3300015345	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVAKLTVIQ
Ga0182111_11084563	3300015345	Miscanthus Phyllosphere	MAFLLPSEFRVLADQEVYLDFDESEYEEIVSKLTIIQQ
Ga0182111_11508111	3300015345	Miscanthus Phyllosphere	MAFLLPLEFRALADQEVYSDFDESEYEEIVAKLMVIQ*
Ga0182111_11627452	3300015345	Miscanthus Phyllosphere	MAFLVPSQFRAPADQEVYLDFDELEYEEIVAKLIVI*
Ga0182111_12295891	3300015345	Miscanthus Phyllosphere	MDFLLPSEFRAPADQEVYSDFDESEYEEIVAKLMVIQQAIFDKPV
Ga0182139_11866171	3300015346	Miscanthus Phyllosphere	MAFLLPSKFRAPAVQEVYSDFDESEFEEIFAKLTVIQQAIF
Ga0182139_11940221	3300015346	Miscanthus Phyllosphere	MAFLLPLEFRALADQEVYSDFDESEYEEMVAKLTVIQ*
Ga0182139_12387291	3300015346	Miscanthus Phyllosphere	QMTFLLPSEFRAPADQEVYLDFDDSEYEEIVAKLMVIQ*
Ga0182177_10931602	3300015347	Miscanthus Phyllosphere	MTFLLPSEFRAPVDRDVYLDFGESEYEEMVAKLTVI
Ga0182161_10266221	3300015351	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVAKLTVIQ*
Ga0182159_12438673	3300015355	Miscanthus Phyllosphere	LLSEFRAPTDQEVYLDFDESEYEEIVAKLTVIQQAIFDKPVK
Ga0182159_12922061	3300015355	Miscanthus Phyllosphere	MAFLLPSEFRALADQEVYSDFDEPEYEEIVAKLTVIQQ
Ga0182159_13288561	3300015355	Miscanthus Phyllosphere	QPSANIQMTFLLPSEFKAPADKEVYSDFNESEYEEIVAKLTVIQHAIFD*
Ga0182145_10395611	3300015361	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYSDFDESEYEEIVAKLTVIQ*
Ga0182145_11740022	3300015361	Miscanthus Phyllosphere	MVFLLPSEFRAPAYQEVYLDFDESEYDEIVAKLIVIQ
Ga0182203_10756312	3300017404	Miscanthus Phyllosphere	MAFLLPSEFRALADQEIYSDFDELEYEEIIAKLTVVQQAIFD
Ga0182203_11139421	3300017404	Miscanthus Phyllosphere	MAFLLLSEFRTPADKEVYSDFDESEYEEIVAKLIVIQ
Ga0182203_11249872	3300017404	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEDYLDFDESEYEEMVAKLIVI
Ga0182203_11434242	3300017404	Miscanthus Phyllosphere	MAFLLPLEFRAPTGQEVYSDFDELEYEEIVAKLTVVQQAIFDK
Ga0182220_10488112	3300017407	Miscanthus Phyllosphere	MAFLLPSKFRAPADQEVYLDFDESEYEEIVAKLMVV
Ga0182220_10551633	3300017407	Miscanthus Phyllosphere	LANIQMAFLLPSEFRAPADQEVYLDFDESEYEEIVAKLT
Ga0182204_10829661	3300017409	Miscanthus Phyllosphere	MTFLLPSEFRAPADQEVYSYFDESEYEEIIAKLIVI
Ga0182207_11163722	3300017410	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYSDFDESEYEDMVAKLIVI
Ga0182207_11734021	3300017410	Miscanthus Phyllosphere	MVFLLLLEFRAPADQGVYSDFDELEYEEIVAKLTVIQ
Ga0182208_10402072	3300017411	Miscanthus Phyllosphere	MSFLLSSEFRASIDQEVYSDFDESKYVEIVAKLTVIQQAIFDKPVKHRH
Ga0182208_10579272	3300017411	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEVYLDFDESEYEEMATQLTLI
Ga0182208_10627561	3300017411	Miscanthus Phyllosphere	QMTFLLPSEFRAPTDQEIYSNFDASEYEEIVAKLTVI
Ga0182208_11031853	3300017411	Miscanthus Phyllosphere	QMAFLLPSEFRTPADQEVYSDFDESEYEEIVAKLTVIQ
Ga0182208_11041461	3300017411	Miscanthus Phyllosphere	MTFLLPSKFRAPTDQEVYSYFDESEYEEIIAKLSVIQQAIFNKPVKHRH
Ga0182222_10515822	3300017413	Miscanthus Phyllosphere	MTFLLPLEFRAPADQEVYSNFDESEYEEIIAKLTVI
Ga0182202_10761831	3300017415	Miscanthus Phyllosphere	MVFLLPSEFKAPADQEVYLDFDESEYEEMVAKLTLIQQAIFD
Ga0182230_10440463	3300017417	Miscanthus Phyllosphere	MTFLLLSEFRAPADQEVYSDFDESEYEEMVAKLIVIQQ
Ga0182230_10490592	3300017417	Miscanthus Phyllosphere	MVFLLPYEFKAPVDHEVYLDFDELEYEEMAAQLTLIQ
Ga0182230_11145441	3300017417	Miscanthus Phyllosphere	MTFLLPSEFRAPADQEVYSDFDESKYEEMVAKLAVIQQAIFD
Ga0182228_10401943	3300017420	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYLDFDESKYEKMVAELTLI
Ga0182228_11134081	3300017420	Miscanthus Phyllosphere	MAFLLPSEFRALVDQDVYSDFDVSEYEEMVAKLTVIQQTIFNKPD
Ga0182219_10332743	3300017424	Miscanthus Phyllosphere	MAFLLPSKFRALADQEVYSDFDESGYEEIVAKLTVIQQAIFDK
Ga0182219_10609261	3300017424	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYSDFDESEYEEMAAQLTL
Ga0182219_10741492	3300017424	Miscanthus Phyllosphere	MAFLLLSEFRALVDQEVYSDFDESEYEEIVAKLTVI
Ga0182219_10830872	3300017424	Miscanthus Phyllosphere	MVFMLPSEFRALANQEVYSDFDESEYREIVAKLTVVQ
Ga0182219_10935812	3300017424	Miscanthus Phyllosphere	MVFVLPSELRAPTDQEVYSDFDESEYEEIVAKLIVI
Ga0182224_11654222	3300017425	Miscanthus Phyllosphere	MAFLLPSKFRAPVDQEVYSDFDESKYKEIVAKMMVIQQAIFDKPV
Ga0182190_10468612	3300017427	Miscanthus Phyllosphere	MDFLLPSEFRAPADQEVFSDFDESEYEEIVDKLTVI
Ga0182190_11123072	3300017427	Miscanthus Phyllosphere	MAFLLPYEFKALADQEVYLDFDESEYEEMATQLTLI
Ga0182190_11129291	3300017427	Miscanthus Phyllosphere	MAFLLPSEFKALADHEVYLDFNESEYEEMATQLIL
Ga0182192_10597292	3300017430	Miscanthus Phyllosphere	MAFLLPSEFRAPVNQEVYLDFDELEYEEIVAKLTVVHQAIFD
Ga0182192_11415852	3300017430	Miscanthus Phyllosphere	MAFLLPSKFRALVDQEVYYDFDESEYEEIVAKLTVVHQTIFNKPVK
Ga0182192_11481752	3300017430	Miscanthus Phyllosphere	MAFLLPLEFRALADQEVYSDFDESEHEEIVAKLTVIQQAIDR
Ga0182206_10674672	3300017433	Miscanthus Phyllosphere	MAFILPYEFKAPADQEVYLNFDESEYEEMAAQLTLI
Ga0182209_11493433	3300017436	Miscanthus Phyllosphere	MAFVLLLEFRAPTDQEIYSDFDESEYEEIVTKLIVIHQAIFN
Ga0182209_11502431	3300017436	Miscanthus Phyllosphere	PSEFRAPADQEIYSDFDESEYEGIVAKLTVVQQAIFDKPVKH
Ga0182209_11557291	3300017436	Miscanthus Phyllosphere	QPSANIQLAFLLPSEFKAPVDQEVYSDFDESEYEEIVAK
Ga0182191_10871382	3300017438	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYLDFDESEYEEIVAKLIVVHQDIFDKPVK
Ga0182221_11291132	3300017442	Miscanthus Phyllosphere	MTFLLPSEFRAPVDQEVYSDFDESECEEIVAKLTVVQQ
Ga0182193_10719391	3300017443	Miscanthus Phyllosphere	MAFLLLLEFRAPADQEVYSDFDESKYEEIVVKLTVTQQAIFDKPVNHQ
Ga0182193_11022761	3300017443	Miscanthus Phyllosphere	IQMAFLLPSEFRAPADQEVYLDFDESEYEEIVAKLTVIQQAIFD
Ga0182193_11845111	3300017443	Miscanthus Phyllosphere	MAFPYPSEFRAPADQEVYSDFDESEYEEIVAKLMVVQQA
Ga0182233_11021551	3300017680	Miscanthus Phyllosphere	MAFLLLSEFRAPAYQEVYSDFDESEYEEIVAKLTVI
Ga0182226_10481262	3300017681	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYKEIVAKLAVVQQAIFE
Ga0182229_10845801	3300017682	Miscanthus Phyllosphere	MAFLLPLEFRPPADQEIYSNFDESEYEEIVAKLTVIQQAIFDK
Ga0182218_11445571	3300017683	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEVYSDFDELEYEEIVAKLTVI
Ga0182225_10605641	3300017684	Miscanthus Phyllosphere	MAFLLPLEFRALADQKVYSDFDELEYEKIVAKLIVIQQDIFDKSVMH
Ga0182225_11280911	3300017684	Miscanthus Phyllosphere	MVFLLPSEFRALANQKVYSDFDESKYEEMVAKLTV
Ga0182227_10715031	3300017685	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYLDFDESEYEEIVAKLIVIQ
Ga0182205_11440013	3300017686	Miscanthus Phyllosphere	MAFLLPLEFRAPTDQEVYSDFDESEYEEIVAKLIVIQ
Ga0182223_10432701	3300017690	Miscanthus Phyllosphere	MTFLLPSEFRASVDQEIYSDFDESEYKEIAAKLTVIQ
Ga0182223_10995432	3300017690	Miscanthus Phyllosphere	MTFLLPSEFRALADQEIYSDSDELEYEEIVSKLTVVQQAIFDKPVKHRH
Ga0182223_11092611	3300017690	Miscanthus Phyllosphere	QPSANIQMAFLLPSEFRAPADQEVYSDFDESEYEEIVAKLTVI
Ga0182232_10640281	3300021060	Phyllosphere	MALLLPSEFRALADQEVYSDFDELGYEEIVAKLIVI
Ga0207691_117155352	3300025940	Miscanthus Rhizosphere	MAFLLPSEFRASTDQEVYLDFDESEYEEIVAKLMV