| Basic Information | |
|---|---|
| Family ID | F037948 |
| Family Type | Metagenome |
| Number of Sequences | 167 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VLTRRILLAQPEPWFNMHLAVAALVNAIVAVFLFLLLDRLRKRS |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.21 % |
| % of genes near scaffold ends (potentially truncated) | 96.41 % |
| % of genes from short scaffolds (< 2000 bps) | 88.02 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.856 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.156 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.503 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.78% β-sheet: 0.00% Coil/Unstructured: 47.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF00291 | PALP | 22.75 |
| PF14821 | Thr_synth_N | 12.57 |
| PF03683 | UPF0175 | 1.80 |
| PF01850 | PIN | 1.80 |
| PF03717 | PBP_dimer | 1.20 |
| PF07883 | Cupin_2 | 1.20 |
| PF04085 | MreC | 1.20 |
| PF13450 | NAD_binding_8 | 1.20 |
| PF00079 | Serpin | 1.20 |
| PF04093 | MreD | 1.20 |
| PF04116 | FA_hydroxylase | 0.60 |
| PF00266 | Aminotran_5 | 0.60 |
| PF00890 | FAD_binding_2 | 0.60 |
| PF16925 | TetR_C_13 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 1.80 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 1.20 |
| COG1792 | Cell shape-determining protein MreC | Cell cycle control, cell division, chromosome partitioning [D] | 1.20 |
| COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 1.20 |
| COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 1.20 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.86 % |
| Unclassified | root | N/A | 28.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1035038 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300002906|JGI25614J43888_10177897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 574 | Open in IMG/M |
| 3300003372|JGI26336J50218_1005980 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300004080|Ga0062385_10997313 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300004082|Ga0062384_100073966 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300004091|Ga0062387_100839551 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300004092|Ga0062389_102598986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300004152|Ga0062386_100047412 | All Organisms → cellular organisms → Bacteria | 3228 | Open in IMG/M |
| 3300004152|Ga0062386_100551857 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300005167|Ga0066672_10189125 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300005174|Ga0066680_10043441 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
| 3300005293|Ga0065715_10733317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300005451|Ga0066681_10329517 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300005468|Ga0070707_101454457 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005536|Ga0070697_101057280 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005541|Ga0070733_10229167 | Not Available | 1219 | Open in IMG/M |
| 3300005545|Ga0070695_100388048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1055 | Open in IMG/M |
| 3300005553|Ga0066695_10721142 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005569|Ga0066705_10350551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300005921|Ga0070766_10260126 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300006052|Ga0075029_100297935 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300006102|Ga0075015_100517358 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300006163|Ga0070715_11093367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300006903|Ga0075426_11228296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300006954|Ga0079219_11176337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300007258|Ga0099793_10608643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300007258|Ga0099793_10669169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009038|Ga0099829_11114543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300009088|Ga0099830_10448556 | Not Available | 1048 | Open in IMG/M |
| 3300009792|Ga0126374_10055773 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300009839|Ga0116223_10276400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
| 3300010043|Ga0126380_12020702 | Not Available | 528 | Open in IMG/M |
| 3300010046|Ga0126384_12440677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300010047|Ga0126382_11136574 | Not Available | 695 | Open in IMG/M |
| 3300010048|Ga0126373_11763302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300010358|Ga0126370_12528092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010359|Ga0126376_11397966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300010361|Ga0126378_10238297 | Not Available | 1909 | Open in IMG/M |
| 3300010373|Ga0134128_10750414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300010376|Ga0126381_102620243 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010379|Ga0136449_103122281 | Not Available | 642 | Open in IMG/M |
| 3300011269|Ga0137392_10850428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300011271|Ga0137393_10935908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300012199|Ga0137383_11041904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300012202|Ga0137363_11694314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012202|Ga0137363_11801613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300012203|Ga0137399_10633134 | Not Available | 900 | Open in IMG/M |
| 3300012205|Ga0137362_11263794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300012207|Ga0137381_10105820 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300012209|Ga0137379_11076219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012349|Ga0137387_10651325 | Not Available | 763 | Open in IMG/M |
| 3300012361|Ga0137360_10022620 | All Organisms → cellular organisms → Bacteria | 4226 | Open in IMG/M |
| 3300012363|Ga0137390_11451539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300012922|Ga0137394_10965158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012922|Ga0137394_11175367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300012922|Ga0137394_11351217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300012925|Ga0137419_10598417 | Not Available | 885 | Open in IMG/M |
| 3300012927|Ga0137416_10109713 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300012929|Ga0137404_10509937 | Not Available | 1074 | Open in IMG/M |
| 3300012929|Ga0137404_12171991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 519 | Open in IMG/M |
| 3300012930|Ga0137407_10673266 | Not Available | 974 | Open in IMG/M |
| 3300012971|Ga0126369_11825216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300012975|Ga0134110_10036999 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300013832|Ga0120132_1055518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300014154|Ga0134075_10044910 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300015242|Ga0137412_10870277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300015245|Ga0137409_10220773 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300017822|Ga0187802_10022097 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300017823|Ga0187818_10135970 | Not Available | 1067 | Open in IMG/M |
| 3300017933|Ga0187801_10264370 | Not Available | 694 | Open in IMG/M |
| 3300017934|Ga0187803_10320545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300017940|Ga0187853_10142998 | Not Available | 1150 | Open in IMG/M |
| 3300017941|Ga0187850_10527981 | Not Available | 509 | Open in IMG/M |
| 3300017994|Ga0187822_10275544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300017995|Ga0187816_10033466 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300018012|Ga0187810_10158263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300018012|Ga0187810_10353475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300018085|Ga0187772_10752697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300018085|Ga0187772_11161381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300019788|Ga0182028_1256630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2316 | Open in IMG/M |
| 3300019789|Ga0137408_1219055 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300020199|Ga0179592_10054334 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300020579|Ga0210407_10763500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis | 747 | Open in IMG/M |
| 3300020580|Ga0210403_10486188 | Not Available | 1004 | Open in IMG/M |
| 3300020583|Ga0210401_11575763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300021046|Ga0215015_10757785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300021168|Ga0210406_10012157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8350 | Open in IMG/M |
| 3300021170|Ga0210400_10815187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300021178|Ga0210408_10666706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300021181|Ga0210388_10617195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300021402|Ga0210385_10385532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300021403|Ga0210397_10905096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300021403|Ga0210397_11343180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300021405|Ga0210387_10171880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1867 | Open in IMG/M |
| 3300021405|Ga0210387_11186744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300021405|Ga0210387_11671068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300021433|Ga0210391_11393846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300021474|Ga0210390_11651841 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300021476|Ga0187846_10305499 | Not Available | 658 | Open in IMG/M |
| 3300021478|Ga0210402_11842097 | Not Available | 531 | Open in IMG/M |
| 3300021479|Ga0210410_10654686 | Not Available | 930 | Open in IMG/M |
| 3300021559|Ga0210409_11413122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300024283|Ga0247670_1034412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300024288|Ga0179589_10383032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300024290|Ga0247667_1000233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 16158 | Open in IMG/M |
| 3300024290|Ga0247667_1041291 | Not Available | 868 | Open in IMG/M |
| 3300025464|Ga0208076_1094271 | Not Available | 515 | Open in IMG/M |
| 3300026304|Ga0209240_1197886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300026304|Ga0209240_1241485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300026328|Ga0209802_1265076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300026334|Ga0209377_1005683 | All Organisms → cellular organisms → Bacteria | 7657 | Open in IMG/M |
| 3300026475|Ga0257147_1011993 | Not Available | 1157 | Open in IMG/M |
| 3300026550|Ga0209474_10489410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300026555|Ga0179593_1143857 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300027000|Ga0207803_1012503 | Not Available | 1180 | Open in IMG/M |
| 3300027109|Ga0208603_1045732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300027521|Ga0209524_1109108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300027562|Ga0209735_1082158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300027567|Ga0209115_1044103 | Not Available | 1014 | Open in IMG/M |
| 3300027635|Ga0209625_1048858 | Not Available | 944 | Open in IMG/M |
| 3300027643|Ga0209076_1024079 | Not Available | 1670 | Open in IMG/M |
| 3300027655|Ga0209388_1048275 | Not Available | 1230 | Open in IMG/M |
| 3300027660|Ga0209736_1070336 | Not Available | 972 | Open in IMG/M |
| 3300027671|Ga0209588_1144062 | Not Available | 757 | Open in IMG/M |
| 3300027671|Ga0209588_1195740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300027812|Ga0209656_10385495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300027857|Ga0209166_10052770 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300027862|Ga0209701_10525346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300027882|Ga0209590_10990260 | Not Available | 525 | Open in IMG/M |
| 3300028536|Ga0137415_10049495 | All Organisms → cellular organisms → Bacteria | 4081 | Open in IMG/M |
| 3300028879|Ga0302229_10226861 | Not Available | 850 | Open in IMG/M |
| 3300028906|Ga0308309_11684650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300028906|Ga0308309_11857906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300030659|Ga0316363_10154279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300030906|Ga0302314_10372819 | Not Available | 1600 | Open in IMG/M |
| 3300031474|Ga0170818_115007526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1673 | Open in IMG/M |
| 3300031474|Ga0170818_115061409 | Not Available | 1464 | Open in IMG/M |
| 3300031668|Ga0318542_10560990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300031718|Ga0307474_10158237 | Not Available | 1712 | Open in IMG/M |
| 3300031754|Ga0307475_10101505 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
| 3300031754|Ga0307475_10129336 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300031754|Ga0307475_10503841 | Not Available | 972 | Open in IMG/M |
| 3300031754|Ga0307475_10858376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300031820|Ga0307473_10171298 | Not Available | 1259 | Open in IMG/M |
| 3300031910|Ga0306923_12300486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300032042|Ga0318545_10167139 | Not Available | 784 | Open in IMG/M |
| 3300032180|Ga0307471_100913197 | Not Available | 1045 | Open in IMG/M |
| 3300032180|Ga0307471_102201254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300032180|Ga0307471_103954491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300032205|Ga0307472_101694342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300032205|Ga0307472_102461996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300032770|Ga0335085_10140212 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300032783|Ga0335079_10893106 | Not Available | 913 | Open in IMG/M |
| 3300032828|Ga0335080_10395115 | Not Available | 1484 | Open in IMG/M |
| 3300032829|Ga0335070_10123177 | All Organisms → cellular organisms → Bacteria | 2676 | Open in IMG/M |
| 3300032898|Ga0335072_11703645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 526 | Open in IMG/M |
| 3300032954|Ga0335083_10111329 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
| 3300032955|Ga0335076_10274350 | Not Available | 1578 | Open in IMG/M |
| 3300032955|Ga0335076_10398023 | Not Available | 1262 | Open in IMG/M |
| 3300033134|Ga0335073_11352425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300033158|Ga0335077_12222163 | Not Available | 503 | Open in IMG/M |
| 3300033289|Ga0310914_10724197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300033405|Ga0326727_10292887 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300033486|Ga0316624_10525605 | Not Available | 1016 | Open in IMG/M |
| 3300033755|Ga0371489_0303707 | Not Available | 769 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.20% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.20% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.20% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.60% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10350382 | 3300001154 | Forest Soil | TRRILLAQPEQWFNVHLFLAALVNALVAVFLFLLLDRLRRN* |
| JGI25614J43888_101778971 | 3300002906 | Grasslands Soil | SILTIVRRLLLNEPEAWFNMHLAVAALVNAVLGVVLFVGLDRLRRSS* |
| JGI26336J50218_10059801 | 3300003372 | Bog Forest Soil | GVIALTRRLLLSQPEPWFTMHLLVAALINAVVAVFLFMLLDRLRKPS* |
| Ga0062385_109973131 | 3300004080 | Bog Forest Soil | HQGILVVERRILLAQPEVWFTVQLAIAALVNAVVGVFLFTVLDRLRKPS* |
| Ga0062384_1000739664 | 3300004082 | Bog Forest Soil | HQGLIALTRRLLLSQPEPWFTVHLGIAALVNAVVAVFLFMLLDRLRKAS* |
| Ga0062387_1008395511 | 3300004091 | Bog Forest Soil | VLERRILLAQPEVWFTIQLGIAALINALVGVLLFTLLDRLRKPS* |
| Ga0062389_1025989861 | 3300004092 | Bog Forest Soil | QAVIVLIRRVLLAQPEPWVNWALVIAAAVNAVVGVFLFLLFDRLRRSS* |
| Ga0062386_1000474121 | 3300004152 | Bog Forest Soil | TRRLLLAQPEPWFNMHLAMAAGVNAVVGVPLFLLLDRLRRSS* |
| Ga0062386_1005518572 | 3300004152 | Bog Forest Soil | RRVLLAQPEPWFNMHLALAALVNAVLGVALFALLDRFRRSS* |
| Ga0066672_101891252 | 3300005167 | Soil | FFVAHQGLIDLTRRILLAQPEPWFNMHLVVAALVNALVAVFLFLVLDRLRKN* |
| Ga0066680_100434411 | 3300005174 | Soil | IWLIRRLLLGQPEMWFNLRLGAAALINGGVAVFLFLLLDRLRARS* |
| Ga0065715_107333172 | 3300005293 | Miscanthus Rhizosphere | RRILLAQPDTLFTLHLAIGAGVNAIVGVFLFMALDKLRKN* |
| Ga0066681_103295171 | 3300005451 | Soil | LTRRILLAQPEPWLTLHLFGAALLNALVAVFLFIVLDRLRRPS* |
| Ga0070707_1014544571 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HQGVTVLIKRLLLAQPEVWFTVRLGIAAGVNAIVAVFLFLLLDHLRKPS* |
| Ga0070697_1010572801 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TQRLLLSQPERWFTMHLGAAALINAVVAVFLFLLLDRFRKSS* |
| Ga0070733_102291672 | 3300005541 | Surface Soil | RRILLAQPEPWFNMHLAIAGLVNSVVAVFLFLFLDRLRRPS* |
| Ga0070695_1003880481 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VALTQRLLLSQPGPWFTMHLATSALVNALVAVFLFMLLDRLRKSS* |
| Ga0066695_107211421 | 3300005553 | Soil | VLTRRILLSQPEPWFSMHLVGAALANALVAVFLFLLLDRLRKN* |
| Ga0066705_103505511 | 3300005569 | Soil | AQPDTLFTLHLAIGAGVNAVVGVFLFMALDNLRKS* |
| Ga0070766_102601262 | 3300005921 | Soil | TRRLLLSQPEPWFTMHLGIAALVNAVVAVFLFMLLDRLRKPS* |
| Ga0075029_1002979352 | 3300006052 | Watersheds | LVLVRRVLLAQPEPWFNMHLAIAALVNAVLGVALFAILDRLRRSS* |
| Ga0075015_1005173582 | 3300006102 | Watersheds | PEPWFNMHLAIAAAVNAVLGTFLYIGLDRLRRNQ* |
| Ga0070715_110933672 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VLMAQPEPWFNMHLAIAAAVNAVLGTFLYIALDRLRRNQ* |
| Ga0075426_112282962 | 3300006903 | Populus Rhizosphere | TRRVLMAQPEPWFNMHLAIAAAVNAVLGTFLYIALDRLRRNQ* |
| Ga0079219_111763372 | 3300006954 | Agricultural Soil | SVVALTRRILLAQPEAWFNLHLFGAALLNALVAVFLFVLLDRLRRSS* |
| Ga0099793_106086431 | 3300007258 | Vadose Zone Soil | NEPEGWFNMHLAIASLVNAVLGVVLFTFLDRLRR* |
| Ga0099793_106691691 | 3300007258 | Vadose Zone Soil | LSQPEPWFNMHLVGAALANALVAVFLFLLLDRLRKN* |
| Ga0099829_111145432 | 3300009038 | Vadose Zone Soil | AQPEPWFNMHLIVAALVNGLVAVFLFVLLDRLRKN* |
| Ga0099830_104485562 | 3300009088 | Vadose Zone Soil | FIVHQGLIVLTRRILLAQPEPWFNMHLIVAALVNGLVAVFLFVLLDRLRKN* |
| Ga0126374_100557733 | 3300009792 | Tropical Forest Soil | TRRILLAQPEPWFNWHLLLAALINAIVAVFLFVLLDRLRRPS* |
| Ga0116223_102764001 | 3300009839 | Peatlands Soil | RRLLLAQPGPWFNMHLAMAAGVNAVLGVPLFLLLDRLRRTS* |
| Ga0126380_120207022 | 3300010043 | Tropical Forest Soil | HILLAQPEPWFNWHLFLAALINAIVAVFLFVLLDRLRRPS* |
| Ga0126384_124406771 | 3300010046 | Tropical Forest Soil | RRLLLAQPEPWFTVRLLVAAAVNAVVAVFLFMLLDRLRRQ* |
| Ga0126382_111365741 | 3300010047 | Tropical Forest Soil | MTRRILLAQPEPWLTLHLFGAALLNALIAVFLFVLLDRLRRQS* |
| Ga0126373_117633022 | 3300010048 | Tropical Forest Soil | VVALTRRILLAQPEPWFTLHILGAALLNALVAVFLFLLLDRLRRPS* |
| Ga0074044_102929651 | 3300010343 | Bog Forest Soil | GVHQGLIALTRRLLLSQPEPWFTLHLGVAALVNAVVAVFLFMLLDRLRKPS* |
| Ga0126370_125280921 | 3300010358 | Tropical Forest Soil | LAQPEAWFTMRLAIAAAVNSVIAVFLFMVLDRLRKQ* |
| Ga0126376_113979661 | 3300010359 | Tropical Forest Soil | HQSLITLTRRILLVQPQVWFNLRLGIAAAVNAIIAVFLFMLLDRLRKN* |
| Ga0126378_102382973 | 3300010361 | Tropical Forest Soil | PEPWFNVHLAIAALVNAVLGVALFVALDRLRRSS* |
| Ga0134128_107504143 | 3300010373 | Terrestrial Soil | GVVALTQRLLLSQPGPWFTMHLATSALVNALVAVFLFMLLDRLRKSS* |
| Ga0126381_1026202432 | 3300010376 | Tropical Forest Soil | AEAEPWFNLHLAIAALVNAVLGVFLFVLFDRLRKGS* |
| Ga0136449_1031222812 | 3300010379 | Peatlands Soil | LTRRVLMAQPEPWFNMHLAIAAAVNAVLGTFLYIALDRLRRNQ* |
| Ga0137392_108504281 | 3300011269 | Vadose Zone Soil | AQPEPWFNMHLIVAALVNGLVAVFLFVLLDRLRRN* |
| Ga0137393_109359082 | 3300011271 | Vadose Zone Soil | HQGLIALTRRILLAQPEPWFNTPLAIAALVNGIVAVFLFLLLDRLRKN* |
| Ga0137383_110419041 | 3300012199 | Vadose Zone Soil | QGLISLTRRVLLAQPESWFNMRLFIAALVNAIVAVFLFLLLDRLRKRS* |
| Ga0137363_116943142 | 3300012202 | Vadose Zone Soil | TIVRRLLLNEPEGWFNMHLAIASLVNAILGVVLFTFLDRLRR* |
| Ga0137363_118016132 | 3300012202 | Vadose Zone Soil | AILTVVRRLLLNEPEGWFNMHLAIASLVNAVLGVVLFTFLDRLRR* |
| Ga0137399_106331342 | 3300012203 | Vadose Zone Soil | ILLAQPEPWFNMHLLAGALVNALVAVFLFLLLDRLRKR* |
| Ga0137362_112637942 | 3300012205 | Vadose Zone Soil | VAHQGLIVLTRRILLAQPEPWFNMHLFVGALVNGLLAVFLFLLLDRLRKN* |
| Ga0137381_101058204 | 3300012207 | Vadose Zone Soil | VHQGLIVLTRRILLAQPEPWFNMHLIVAALVNGLVAVFLFLLLDRLRKN* |
| Ga0137379_110762192 | 3300012209 | Vadose Zone Soil | GQPEMWFNLRLGAAALINGGVAVFLFLLLDRLRARS* |
| Ga0137387_106513251 | 3300012349 | Vadose Zone Soil | ILLSQQEPWFNMHLVGAALANALVAVFLFLLLDRLRKN* |
| Ga0137360_100226204 | 3300012361 | Vadose Zone Soil | FFIVHQGLIVLTRRILLAQPEPWFNMHLIVAALVNGLVAVFLFLLLDRLRKN* |
| Ga0137390_114515391 | 3300012363 | Vadose Zone Soil | GLIVLTRRILLAQPEPWFNMHLFVGALVNGLLAVFLFLLLDRLRKN* |
| Ga0137394_109651582 | 3300012922 | Vadose Zone Soil | VAHQGLIALTRRILLAQPEPWFNMRLFVAALVNALVAVFLFLLLDRLRKR* |
| Ga0137394_111753671 | 3300012922 | Vadose Zone Soil | QPEAWFNMRLFIAALVNALVAVFLFLLLDRLRKR* |
| Ga0137394_113512172 | 3300012922 | Vadose Zone Soil | AHQGLIALTRRILLAQPEPWFNMRLFVAALVNALVAVFLFLLLDRLRKR* |
| Ga0137419_105984171 | 3300012925 | Vadose Zone Soil | LIALTRRILLAQPETWFNMRLFIAAIVNALVAVFLFLLLDRLRKR* |
| Ga0137416_101097131 | 3300012927 | Vadose Zone Soil | AHQGLVSLTRRILLAQPEPWFNMHLLAGALVNALVAVFLFLLLDRLRKR* |
| Ga0137404_105099372 | 3300012929 | Vadose Zone Soil | LTVVRRLLLNEPEGWFNMHLAIASLVNAILGVVLFTFLDRLRR* |
| Ga0137404_121719912 | 3300012929 | Vadose Zone Soil | LLAQPEAWLNLHLAIGAAVNAIIGIPLFMLLDSLRKN* |
| Ga0137407_106732662 | 3300012930 | Vadose Zone Soil | QGLIVLTRRILLAQPEPWFNMHLFLAALVNALVAVFVFLLLDRLRKN* |
| Ga0126369_118252162 | 3300012971 | Tropical Forest Soil | RRLLLAEAEPWFNLHLAVAALVNAVLGVFVFLLFDRLRRN* |
| Ga0134110_100369991 | 3300012975 | Grasslands Soil | HQGLIVLTRRILLSQPEPWFSMHLVGAALANALVAVFLFLLLDRLRKN* |
| Ga0120132_10555181 | 3300013832 | Permafrost | ILLAQSSVWFTMHLAVAAVVNAIVAVFLFALLDHLRKS* |
| Ga0134075_100449103 | 3300014154 | Grasslands Soil | VFFIAHQGLISLTRRILLAQPESWFNMRLFIAALVNAIVAVFLFLLLDRLRKRS* |
| Ga0137412_108702773 | 3300015242 | Vadose Zone Soil | VTHQGLLVLTRRILLAQPEPWFTMHLFVAALVNALVAVFLFLLLDRLRKN* |
| Ga0137409_102207733 | 3300015245 | Vadose Zone Soil | LNQPEGWFNMHLAMAALVNAFLGVLLFVGMDRLRRSS* |
| Ga0187802_100220971 | 3300017822 | Freshwater Sediment | TRRILLAQPEPWFNTHLAVAALVNAFVAVFLFVLLDRLRKRS |
| Ga0187818_101359701 | 3300017823 | Freshwater Sediment | RLLLAQPEPWFNTHLVIAAALNAVISVPLFLLLDRLRRSS |
| Ga0187801_102643702 | 3300017933 | Freshwater Sediment | RILLAQPEPWFNAHLAIAALANAIVAILLFPLLDRLRKR |
| Ga0187803_103205452 | 3300017934 | Freshwater Sediment | VIVLIKRLLLAEPEAWFTTRLGIAAGLNALVAVFLFLLLDHLRKPS |
| Ga0187853_101429983 | 3300017940 | Peatland | RLLLAQPEPWFNVHLVIAAAVNAVVGMPLFLLLDRLRRSS |
| Ga0187850_105279812 | 3300017941 | Peatland | VLHQAVIVLTRRLLLAQPEPWFNVHLVIAAAMNAVLGVPLFLLLDRLRRSS |
| Ga0187822_102755442 | 3300017994 | Freshwater Sediment | LLLSQPEPWLTMHLGAAALVNALVAVFLFMLLDHLRKPS |
| Ga0187816_100334661 | 3300017995 | Freshwater Sediment | QGLIVLTRRILLAQPEPWFNAHLAIAALANAIVAILLFPLLDRLRKR |
| Ga0187810_101582633 | 3300018012 | Freshwater Sediment | RLLLAQPEAWFNVHLAIAAAVNALFGTVLFLALDRLRRSS |
| Ga0187810_103534752 | 3300018012 | Freshwater Sediment | VLIKRLLLAQPEAWFTTRLGIAAGLNALVAVFLFLLLDRLRKPS |
| Ga0187772_107526971 | 3300018085 | Tropical Peatland | VLVLTRRLLLAQPEPWFNLHLAIAAGVNAVLGVPLFLLLDRLRRSS |
| Ga0187772_111613812 | 3300018085 | Tropical Peatland | FVVHQGVIVLTRRILLGQPEPWFNLHLAAGALVNAIVAVFLFLLLDRLRKLS |
| Ga0182028_12566304 | 3300019788 | Fen | MVLTRRLLLAQPEPWFNMHLVVAAAANAVLGVPLFLLLDRLRRSS |
| Ga0137408_12190551 | 3300019789 | Vadose Zone Soil | RRILLAQPEAWFNMRLFIAALVNALVAVFLFLLLDRLRKR |
| Ga0179592_100543343 | 3300020199 | Vadose Zone Soil | LAQPEPWFNMHLIVAALVNALVAVFLFLLLDRLRKN |
| Ga0210407_107635001 | 3300020579 | Soil | IVNLTRRILLGQPEPWFNMHLLTGALVNAFVAVFLFMLLDRLRKP |
| Ga0210403_104861882 | 3300020580 | Soil | RRLLLAQPEQWFTVHLAVIAAVNSVVAVFLFMLLDRLRRHS |
| Ga0210401_115757632 | 3300020583 | Soil | SQPEPWFTMHLGIAALVNAVVAVFLFMLLDRLRKPS |
| Ga0215015_107577851 | 3300021046 | Soil | GLIAITRRILLAQPEPWFNMHLFIAALFNALVSVFVFLLLDRLRKN |
| Ga0210406_100121577 | 3300021168 | Soil | LLLNEPEAWFNMHLAVAALVNAVLGVIIFVGLDRLRRSS |
| Ga0210400_108151872 | 3300021170 | Soil | FVAHQGLMVLTRRILLAQQESWFNVHLFVAALVNAFVAVFLFLLLDRLRRN |
| Ga0210408_106667061 | 3300021178 | Soil | RRLLLAQPEPWFTMHLGIGAAVNAVVGVFLFMLLDRLRKN |
| Ga0210388_106171951 | 3300021181 | Soil | GIVILTRRLLLAQPEPWFTMHLAIGAAVNAIVGTFLFMLLDRLRKN |
| Ga0210385_103855321 | 3300021402 | Soil | LTRRLLLAQPEPWFTMHLAIGAAVNAIVGVFLFMLLDRLRKN |
| Ga0210397_109050961 | 3300021403 | Soil | LTRRVLMAQPEPWFNMHLAIAAAVNAVLGTFLYIALDRLRRNQ |
| Ga0210397_113431802 | 3300021403 | Soil | LNEPEAWFNMHLAVAALVNAVLGVIIFVGLDRLRRSS |
| Ga0210387_101718804 | 3300021405 | Soil | LAQPEPWVNWALVIAAAVNAVVGVFLFVVFDRLRRNS |
| Ga0210387_111867441 | 3300021405 | Soil | ILLAQPEPWFNVHLAIAAGINAIVAVFLFLLLDRLRKPS |
| Ga0210387_116710681 | 3300021405 | Soil | TVVRRLLLNEPEAWFNMHLAIAALVNAVLGVIIFVGLDRLRRSS |
| Ga0210391_113938461 | 3300021433 | Soil | RRILLAQSSVWFTMHLAAAAVVNAIVAVFLFALLDHLRKS |
| Ga0210390_116518411 | 3300021474 | Soil | LLLAQPEGWFTMHLAIGAAVNAIVGIPLFMLLDRLRKN |
| Ga0187846_103054991 | 3300021476 | Biofilm | TRRILLAQPEPWFNLQLLTAAFLNAVLAVLLFLLLDRLRKPS |
| Ga0210402_118420971 | 3300021478 | Soil | ILLGQPEPWFNMHLLIGALVNAFVAVFLFMLLDKLRKPS |
| Ga0210410_106546861 | 3300021479 | Soil | ILTVVRRLLLNEPQAWFNMHLAIAALVNAVLGVVLFTGLDRLRRSS |
| Ga0210409_114131221 | 3300021559 | Soil | LLLSQPEPWFTMHLGVAALVNAVVAVFLFMLLDRLRKPS |
| Ga0247670_10344121 | 3300024283 | Soil | VRRLLLNQPEGWFNMHLAVAALVNAFLGVLLFVGMDRLRRSS |
| Ga0179589_103830321 | 3300024288 | Vadose Zone Soil | ILTVVRRLLLNEPEGWFNMHLAIASLVNAVLGVVLFTFLDRLRR |
| Ga0247667_100023314 | 3300024290 | Soil | LLLSQPGPWFTMHLATSALVNALVAVFLFMLLDRLRKVS |
| Ga0247667_10412911 | 3300024290 | Soil | LLSQSGPWFTWHLGTAALVNALVAVFLFMLLDRLRKTA |
| Ga0208076_10942711 | 3300025464 | Arctic Peat Soil | ILLAQSSTWFTMHLAIAALVNAVVAVFLFMLLDRLRKT |
| Ga0209240_11978861 | 3300026304 | Grasslands Soil | VLTRRILLAQPEPWFNMHLVAAALVNGLVAVFLFLLLDRLRRN |
| Ga0209240_12414852 | 3300026304 | Grasslands Soil | LLAQPEPWFNMHLIVAALVNALVAVFLFLLLDRLRKN |
| Ga0209802_10387191 | 3300026328 | Soil | TFAFFIVHQGLIVLTRRILLAQPEPWFNMHLIVAALVNGLVAVFLFLLLDRLRKN |
| Ga0209802_12650762 | 3300026328 | Soil | LIRRLLLGQPEMWFNLRLGAAALVNGGVAVFLFLLLDRLRARS |
| Ga0209377_10056838 | 3300026334 | Soil | MAHQGLIALTRRILLAQPEAWFNMRLFIAALVNALVAVFLFLLLDRLRKR |
| Ga0257147_10119931 | 3300026475 | Soil | SILTIVRRLLLNEPEPWFNMHLAVAALVNAVLGVILFVGLDRLRRSS |
| Ga0209474_104894101 | 3300026550 | Soil | RRILLAQPEPWLTLHLFGAALLNALVAVFLFIVLDRLRRPS |
| Ga0179593_11438572 | 3300026555 | Vadose Zone Soil | LTVVRRLLLNEPEGWFNMHLAVASLVNAVLGVVLFTFLDRLRR |
| Ga0207803_10125032 | 3300027000 | Tropical Forest Soil | EPEPWFNMHLAIAALVNAVLGVALFVALDRLRRSS |
| Ga0208603_10457322 | 3300027109 | Forest Soil | AAHQGIVNLTRRILLGQPEPWFNMHLLLGALVNAFVAVFLFMLLDKFRKPS |
| Ga0209524_11091082 | 3300027521 | Forest Soil | ILLAQSSVWFTMHLAAAAVVNAIVAVFLFALLDHLRKS |
| Ga0209735_10821581 | 3300027562 | Forest Soil | GLHQGIVLLTRRILLAQSSVWFTMHLAAAAVVNAIVAVFLFALLDHLRKS |
| Ga0209115_10441032 | 3300027567 | Forest Soil | LLLSQPEPWFTMHLGIAALVNAVVAVFLFMLLDRLRKPS |
| Ga0209625_10488581 | 3300027635 | Forest Soil | LHQGSVTLTRRLLLAQPEAWFTMRMAVAAGVNAVVAVFLFMLLDRLRRT |
| Ga0209076_10240793 | 3300027643 | Vadose Zone Soil | TRRILLAQPESWLNVHLFIAALVNAFVAVFLFLLLDRLRRN |
| Ga0209388_10482751 | 3300027655 | Vadose Zone Soil | FVAHQGLIALTRRILLAQPEPWFNMRLFVAALVNALVAVFLFLLLDRLRKR |
| Ga0209736_10703361 | 3300027660 | Forest Soil | IRRLLLAQPEAWFNLHLAIAALVNAILGVFLFALLDRLRRNS |
| Ga0209588_11440622 | 3300027671 | Vadose Zone Soil | RILLAQPEAWFNMRLFIAALVNALVAVFLFLLLDRLRKR |
| Ga0209588_11957401 | 3300027671 | Vadose Zone Soil | GLIVLTRRILLAQPEPWFNMHLIVAALVNALVAVFLFLLLDRLRKN |
| Ga0209656_103854952 | 3300027812 | Bog Forest Soil | RILLAQPEVWFTVRLGIAGLVNAVVGVLLFTLLDRLRKPS |
| Ga0209166_100527701 | 3300027857 | Surface Soil | ALTQRLLLSQPERWFTMHLGAAALINALVAVFLFMLLDRFRRSS |
| Ga0209701_105253462 | 3300027862 | Vadose Zone Soil | VLTRRILLAQPEPWFNMHLIVAALVNGLVAVFLFVLLDRLRKN |
| Ga0209590_109902602 | 3300027882 | Vadose Zone Soil | AQPEPWFNMHLIVAALVNGLVAVFLFVLLDRLRKN |
| Ga0137415_100494954 | 3300028536 | Vadose Zone Soil | HQGLIALTRRILLAQPEAWFNMRLFIAALVNALVAVFLFLLLDRLRKR |
| Ga0302229_102268611 | 3300028879 | Palsa | ILLAQPEAWFTMHLGIAALINAVVGAALFTLLDRLRKPS |
| Ga0308309_116846501 | 3300028906 | Soil | ILTRRLLLAQPEPWFTMHLAIGAAVNAVVGVFLFMLLDKLRKN |
| Ga0308309_118579061 | 3300028906 | Soil | QGILALERRILLAQPEAWFTLQLGIAALINAAVGMFLFALLDRLRKPS |
| Ga0316363_101542792 | 3300030659 | Peatlands Soil | RRLLLAQPGPWFNMHLAMAAGVNAVLGVPLFLLLDRLRRTS |
| Ga0302314_103728191 | 3300030906 | Palsa | ERRILLAQPEAWFTMHLGIAALINAVVGAALFTLLDRLRKPS |
| Ga0170818_1150075263 | 3300031474 | Forest Soil | ALHQGIVLLTRRILLAQSSTWFNMHLAVAALVNGIVAVFLFMLLDRLRKS |
| Ga0170818_1150614092 | 3300031474 | Forest Soil | RLLLNEPEGWFNMHLAIASLVNAVLGVILFGGLDRLRRSS |
| Ga0318542_105609901 | 3300031668 | Soil | VLVLTRRLLLAQPEPWFNVHLAIGAAVNAVAGTLLFLLLDRLRRSS |
| Ga0307474_101582371 | 3300031718 | Hardwood Forest Soil | VLTRRILLAQPEPWFNMHLAVAALVNAIVAVFLFLLLDRLRKRS |
| Ga0307475_101015051 | 3300031754 | Hardwood Forest Soil | FVAHQGLIVVTRRILLAQPEPWFNMHLIVAALVNAVVAVFLFLLLDRLRKN |
| Ga0307475_101293361 | 3300031754 | Hardwood Forest Soil | TRRILLAQPEPWFNMHLVAAAVVNALVAVFLFLLLDRLRKN |
| Ga0307475_105038411 | 3300031754 | Hardwood Forest Soil | RILLAQPEPWFNMHLIVAALVNALVAVFLFLLLDRFRKN |
| Ga0307475_108583761 | 3300031754 | Hardwood Forest Soil | LIALTSRMLLSQSEPWFTWHLGTAALVNAVVAVFLFMILDRLRKPS |
| Ga0307473_101712982 | 3300031820 | Hardwood Forest Soil | MVLTRRILLAQQESWFNVHLFVAALVNAFVAVFLFLLLDRLRRN |
| Ga0306923_123004861 | 3300031910 | Soil | FLLAEPEPWLNLHLLIAALVNAVLGVALFVGLDRLRRNS |
| Ga0318545_101671391 | 3300032042 | Soil | QPEPWFNVHLAIGAAVNAVAGTLLFLLLDRLRRSS |
| Ga0307471_1009131972 | 3300032180 | Hardwood Forest Soil | TIVRRLLLNEPETWFNMHLAIAALVNAVLGVVLFVGLDRLRRSS |
| Ga0307471_1022012541 | 3300032180 | Hardwood Forest Soil | TRRILLAQPEMWFNMRLFIAALVNALVAVFLFLLLDRLRKR |
| Ga0307471_1039544912 | 3300032180 | Hardwood Forest Soil | QGLLTLTRRILLAQPESWLNMHLVVAALVNALVGVFLFLLLDRLRRN |
| Ga0307472_1016943421 | 3300032205 | Hardwood Forest Soil | AHQGLIVLTRRILLSQPEPWFNMHLVGAALANALVAVFLFLLLDRLRKN |
| Ga0307472_1024619962 | 3300032205 | Hardwood Forest Soil | GLIALTRRILLGQPEPWFNMHLLMGALVNALVGMFLFLLLDRLRKR |
| Ga0335085_101402124 | 3300032770 | Soil | AVLVLVRRVLLAEPEPWFNVHLAIAALVNAVLGVALFVALDRLRRSS |
| Ga0335079_108931062 | 3300032783 | Soil | AKPGTWFNMHLAIAAGVNGVVGMFLFILLDRLRKS |
| Ga0335080_103951151 | 3300032828 | Soil | LLLAQPEAWFNMHLAIAAGVNALVGTALFMALDRLRRRS |
| Ga0335070_101231771 | 3300032829 | Soil | ILVMIRRLLLAQPEPWFNLHLAIAAGVNAVVGTVLFLGLDRLRRSA |
| Ga0335072_117036451 | 3300032898 | Soil | QGVVILTRLLLLAQPEPWFTMHLAIGAAVNAVVGVFLFMLLDKLRKN |
| Ga0335083_101113293 | 3300032954 | Soil | QPEPWFNVHLAIAAGVNAVVGTVLFVGLDRLRRSS |
| Ga0335076_102743502 | 3300032955 | Soil | VLVLVRRVLLAEPEPWFNVHLAIAALVNAVLGVALFVALDRLRRSS |
| Ga0335076_103980231 | 3300032955 | Soil | RRLLLAQPEPWFNVHLAIAAGVNAVVGTVLFVGLDRLRRSS |
| Ga0335073_113524251 | 3300033134 | Soil | VRRLLLAQPEQWFTGHLALAAAVNAVLGTALFVALDRLRR |
| Ga0335077_122221631 | 3300033158 | Soil | LLAEPEPWFNVHLAIAALVNAVLGVALFVALDRLRRSS |
| Ga0310914_107241972 | 3300033289 | Soil | LLLAQPEAWMNVHLAIAAAVNALVGTLLFLALDRLRRRS |
| Ga0326727_102928874 | 3300033405 | Peat Soil | VLTRRLLLAQPEPWFNTHLAIAAAMNAVLSVPLFLLLDRLRRSS |
| Ga0316624_105256052 | 3300033486 | Soil | SQPERWFTMHLGAAALINAVVAVFLFMLLDRLRKSS |
| Ga0371489_0303707_3_122 | 3300033755 | Peat Soil | LLLAQPETWFNLHLAIAAAVNALFGTVLFVALDRLRRSS |
| ⦗Top⦘ |