| Basic Information | |
|---|---|
| Family ID | F037846 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MQSLPRRLGVAVVVAVIVVFLSIKLNAFRDYQIAEIAVEVTA |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 68.86 % |
| % of genes near scaffold ends (potentially truncated) | 97.01 % |
| % of genes from short scaffolds (< 2000 bps) | 94.01 % |
| Associated GOLD sequencing projects | 146 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.665 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.563 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.964 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.904 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF02653 | BPD_transp_2 | 89.22 |
| PF12399 | BCA_ABC_TP_C | 2.99 |
| PF00005 | ABC_tran | 2.99 |
| PF01548 | DEDD_Tnp_IS110 | 0.60 |
| PF03169 | OPT | 0.60 |
| PF01433 | Peptidase_M1 | 0.60 |
| PF16884 | ADH_N_2 | 0.60 |
| PF04185 | Phosphoesterase | 0.60 |
| PF11838 | ERAP1_C | 0.60 |
| PF00146 | NADHdh | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.60 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.60 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.60 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.60 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.66 % |
| All Organisms | root | All Organisms | 32.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M101BJQ1B | Not Available | 501 | Open in IMG/M |
| 2189573002|GZIGXIF02HTVSH | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300004092|Ga0062389_102071347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300005172|Ga0066683_10624311 | Not Available | 650 | Open in IMG/M |
| 3300005180|Ga0066685_10549108 | Not Available | 797 | Open in IMG/M |
| 3300005344|Ga0070661_101660519 | Not Available | 541 | Open in IMG/M |
| 3300005406|Ga0070703_10435249 | Not Available | 578 | Open in IMG/M |
| 3300005439|Ga0070711_100723333 | Not Available | 839 | Open in IMG/M |
| 3300005471|Ga0070698_100652478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 993 | Open in IMG/M |
| 3300005602|Ga0070762_10133935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1468 | Open in IMG/M |
| 3300005602|Ga0070762_10879578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300005614|Ga0068856_101137626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 798 | Open in IMG/M |
| 3300006028|Ga0070717_10250688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1564 | Open in IMG/M |
| 3300006086|Ga0075019_10562953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300006086|Ga0075019_11166209 | Not Available | 502 | Open in IMG/M |
| 3300006162|Ga0075030_100848928 | Not Available | 721 | Open in IMG/M |
| 3300006175|Ga0070712_101711079 | Not Available | 550 | Open in IMG/M |
| 3300006176|Ga0070765_100824365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
| 3300006176|Ga0070765_102213490 | Not Available | 513 | Open in IMG/M |
| 3300006881|Ga0068865_100074656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2415 | Open in IMG/M |
| 3300006903|Ga0075426_10627371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 803 | Open in IMG/M |
| 3300007076|Ga0075435_100486992 | Not Available | 1066 | Open in IMG/M |
| 3300009525|Ga0116220_10062043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1563 | Open in IMG/M |
| 3300009623|Ga0116133_1095485 | Not Available | 753 | Open in IMG/M |
| 3300009700|Ga0116217_10361744 | Not Available | 925 | Open in IMG/M |
| 3300009839|Ga0116223_10338386 | Not Available | 893 | Open in IMG/M |
| 3300010046|Ga0126384_10512038 | Not Available | 1036 | Open in IMG/M |
| 3300010360|Ga0126372_11310656 | Not Available | 753 | Open in IMG/M |
| 3300010361|Ga0126378_11602455 | Not Available | 739 | Open in IMG/M |
| 3300010371|Ga0134125_12601704 | Not Available | 550 | Open in IMG/M |
| 3300010373|Ga0134128_10593865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
| 3300010379|Ga0136449_102645748 | Not Available | 714 | Open in IMG/M |
| 3300010869|Ga0126359_1269060 | Not Available | 917 | Open in IMG/M |
| 3300010869|Ga0126359_1687200 | Not Available | 965 | Open in IMG/M |
| 3300010876|Ga0126361_10636101 | Not Available | 642 | Open in IMG/M |
| 3300010877|Ga0126356_10105839 | Not Available | 1030 | Open in IMG/M |
| 3300010880|Ga0126350_10898420 | Not Available | 868 | Open in IMG/M |
| 3300012189|Ga0137388_11459209 | Not Available | 622 | Open in IMG/M |
| 3300012361|Ga0137360_10274509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1392 | Open in IMG/M |
| 3300012927|Ga0137416_11491170 | Not Available | 614 | Open in IMG/M |
| 3300013104|Ga0157370_10263180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1594 | Open in IMG/M |
| 3300013105|Ga0157369_10865164 | Not Available | 928 | Open in IMG/M |
| 3300013307|Ga0157372_10913538 | Not Available | 1018 | Open in IMG/M |
| 3300014165|Ga0181523_10263416 | Not Available | 981 | Open in IMG/M |
| 3300014501|Ga0182024_10752165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1195 | Open in IMG/M |
| 3300014838|Ga0182030_10025644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10718 | Open in IMG/M |
| 3300014838|Ga0182030_10524030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300015241|Ga0137418_10679990 | Not Available | 793 | Open in IMG/M |
| 3300015264|Ga0137403_10784586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 809 | Open in IMG/M |
| 3300016341|Ga0182035_10485359 | Not Available | 1053 | Open in IMG/M |
| 3300016357|Ga0182032_10544910 | Not Available | 959 | Open in IMG/M |
| 3300017821|Ga0187812_1203760 | Not Available | 632 | Open in IMG/M |
| 3300017821|Ga0187812_1237790 | Not Available | 580 | Open in IMG/M |
| 3300017821|Ga0187812_1278048 | Not Available | 533 | Open in IMG/M |
| 3300017822|Ga0187802_10174204 | Not Available | 825 | Open in IMG/M |
| 3300017932|Ga0187814_10349321 | Not Available | 571 | Open in IMG/M |
| 3300017933|Ga0187801_10509992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300017942|Ga0187808_10362131 | Not Available | 659 | Open in IMG/M |
| 3300017972|Ga0187781_10222933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1332 | Open in IMG/M |
| 3300017972|Ga0187781_10588089 | Not Available | 802 | Open in IMG/M |
| 3300017973|Ga0187780_11249547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300017973|Ga0187780_11326047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300017974|Ga0187777_11399834 | Not Available | 516 | Open in IMG/M |
| 3300017975|Ga0187782_10267543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1286 | Open in IMG/M |
| 3300018001|Ga0187815_10359354 | Not Available | 619 | Open in IMG/M |
| 3300018060|Ga0187765_11371881 | Not Available | 504 | Open in IMG/M |
| 3300018085|Ga0187772_11485253 | Not Available | 504 | Open in IMG/M |
| 3300018088|Ga0187771_10467741 | Not Available | 1066 | Open in IMG/M |
| 3300018431|Ga0066655_10726213 | Not Available | 673 | Open in IMG/M |
| 3300018482|Ga0066669_11925244 | Not Available | 551 | Open in IMG/M |
| 3300021171|Ga0210405_10600410 | Not Available | 857 | Open in IMG/M |
| 3300021402|Ga0210385_10905833 | Not Available | 677 | Open in IMG/M |
| 3300021403|Ga0210397_10971805 | Not Available | 658 | Open in IMG/M |
| 3300021404|Ga0210389_11002200 | Not Available | 648 | Open in IMG/M |
| 3300021407|Ga0210383_10022155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5345 | Open in IMG/M |
| 3300021407|Ga0210383_10471008 | Not Available | 1084 | Open in IMG/M |
| 3300021407|Ga0210383_10798219 | Not Available | 808 | Open in IMG/M |
| 3300021559|Ga0210409_11425397 | Not Available | 568 | Open in IMG/M |
| 3300022467|Ga0224712_10358393 | Not Available | 690 | Open in IMG/M |
| 3300022522|Ga0242659_1034505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300022718|Ga0242675_1098987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300023056|Ga0233357_1042983 | Not Available | 578 | Open in IMG/M |
| 3300024227|Ga0228598_1076432 | Not Available | 671 | Open in IMG/M |
| 3300025634|Ga0208589_1023680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1723 | Open in IMG/M |
| 3300025898|Ga0207692_10102628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1573 | Open in IMG/M |
| 3300025905|Ga0207685_10275822 | Not Available | 823 | Open in IMG/M |
| 3300025906|Ga0207699_10145698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1561 | Open in IMG/M |
| 3300025915|Ga0207693_11269811 | Not Available | 552 | Open in IMG/M |
| 3300025945|Ga0207679_11479509 | Not Available | 623 | Open in IMG/M |
| 3300026295|Ga0209234_1173752 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300026551|Ga0209648_10004884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11407 | Open in IMG/M |
| 3300027080|Ga0208237_1007570 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300027652|Ga0209007_1056530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 994 | Open in IMG/M |
| 3300027684|Ga0209626_1069880 | Not Available | 891 | Open in IMG/M |
| 3300027684|Ga0209626_1082398 | Not Available | 825 | Open in IMG/M |
| 3300027826|Ga0209060_10151104 | Not Available | 1077 | Open in IMG/M |
| 3300027842|Ga0209580_10532710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300027853|Ga0209274_10669260 | Not Available | 536 | Open in IMG/M |
| 3300027862|Ga0209701_10582045 | Not Available | 597 | Open in IMG/M |
| 3300027889|Ga0209380_10840031 | Not Available | 518 | Open in IMG/M |
| 3300027905|Ga0209415_10460997 | Not Available | 996 | Open in IMG/M |
| 3300028742|Ga0302220_10282915 | Not Available | 605 | Open in IMG/M |
| 3300028808|Ga0302228_10455556 | Not Available | 565 | Open in IMG/M |
| 3300028881|Ga0307277_10010245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3608 | Open in IMG/M |
| 3300029910|Ga0311369_10926180 | Not Available | 694 | Open in IMG/M |
| 3300029944|Ga0311352_10051576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3752 | Open in IMG/M |
| 3300030399|Ga0311353_11583639 | Not Available | 529 | Open in IMG/M |
| 3300030494|Ga0310037_10482242 | Not Available | 504 | Open in IMG/M |
| 3300030509|Ga0302183_10245520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300030524|Ga0311357_10410965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
| 3300030580|Ga0311355_10107767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3083 | Open in IMG/M |
| 3300030677|Ga0302317_10349061 | Not Available | 657 | Open in IMG/M |
| 3300030706|Ga0310039_10208992 | Not Available | 766 | Open in IMG/M |
| 3300030737|Ga0302310_10710893 | Not Available | 522 | Open in IMG/M |
| 3300030739|Ga0302311_10135434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1940 | Open in IMG/M |
| 3300030743|Ga0265461_11647910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
| 3300031027|Ga0302308_10240015 | Not Available | 1143 | Open in IMG/M |
| 3300031027|Ga0302308_10478337 | Not Available | 735 | Open in IMG/M |
| 3300031234|Ga0302325_10123454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 4746 | Open in IMG/M |
| 3300031549|Ga0318571_10119600 | Not Available | 882 | Open in IMG/M |
| 3300031572|Ga0318515_10632280 | Not Available | 568 | Open in IMG/M |
| 3300031616|Ga0307508_10618340 | Not Available | 686 | Open in IMG/M |
| 3300031640|Ga0318555_10711759 | Not Available | 542 | Open in IMG/M |
| 3300031668|Ga0318542_10577813 | Not Available | 586 | Open in IMG/M |
| 3300031708|Ga0310686_115056403 | Not Available | 760 | Open in IMG/M |
| 3300031715|Ga0307476_10659279 | Not Available | 775 | Open in IMG/M |
| 3300031715|Ga0307476_10887607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300031718|Ga0307474_11491110 | Not Available | 532 | Open in IMG/M |
| 3300031748|Ga0318492_10217650 | Not Available | 981 | Open in IMG/M |
| 3300031753|Ga0307477_10911120 | Not Available | 580 | Open in IMG/M |
| 3300031754|Ga0307475_10479884 | Not Available | 999 | Open in IMG/M |
| 3300031765|Ga0318554_10440895 | Not Available | 738 | Open in IMG/M |
| 3300031778|Ga0318498_10251971 | Not Available | 796 | Open in IMG/M |
| 3300031796|Ga0318576_10617733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300031797|Ga0318550_10567782 | Not Available | 546 | Open in IMG/M |
| 3300031799|Ga0318565_10453833 | Not Available | 620 | Open in IMG/M |
| 3300031799|Ga0318565_10567756 | Not Available | 546 | Open in IMG/M |
| 3300031823|Ga0307478_11189211 | Not Available | 635 | Open in IMG/M |
| 3300031859|Ga0318527_10455275 | Not Available | 546 | Open in IMG/M |
| 3300031879|Ga0306919_10236428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1370 | Open in IMG/M |
| 3300031890|Ga0306925_11287164 | Not Available | 727 | Open in IMG/M |
| 3300031894|Ga0318522_10427561 | Not Available | 502 | Open in IMG/M |
| 3300031939|Ga0308174_11446095 | Not Available | 589 | Open in IMG/M |
| 3300031942|Ga0310916_10200411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1670 | Open in IMG/M |
| 3300031962|Ga0307479_10949592 | Not Available | 831 | Open in IMG/M |
| 3300031996|Ga0308176_10917144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex | 921 | Open in IMG/M |
| 3300031996|Ga0308176_12333795 | Not Available | 571 | Open in IMG/M |
| 3300032042|Ga0318545_10381607 | Not Available | 508 | Open in IMG/M |
| 3300032043|Ga0318556_10380966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300032044|Ga0318558_10199752 | Not Available | 975 | Open in IMG/M |
| 3300032076|Ga0306924_11169206 | Not Available | 834 | Open in IMG/M |
| 3300032089|Ga0318525_10393816 | Not Available | 710 | Open in IMG/M |
| 3300032094|Ga0318540_10200705 | Not Available | 961 | Open in IMG/M |
| 3300032160|Ga0311301_10249980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2927 | Open in IMG/M |
| 3300032180|Ga0307471_103347106 | Not Available | 568 | Open in IMG/M |
| 3300032261|Ga0306920_102871253 | Not Available | 654 | Open in IMG/M |
| 3300032261|Ga0306920_102958452 | Not Available | 642 | Open in IMG/M |
| 3300032770|Ga0335085_10974216 | Not Available | 918 | Open in IMG/M |
| 3300032783|Ga0335079_10724962 | Not Available | 1036 | Open in IMG/M |
| 3300032805|Ga0335078_10724597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1227 | Open in IMG/M |
| 3300032829|Ga0335070_11322084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300032893|Ga0335069_11365553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
| 3300032896|Ga0335075_10214322 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300032896|Ga0335075_10639406 | Not Available | 1040 | Open in IMG/M |
| 3300032898|Ga0335072_11160604 | Not Available | 690 | Open in IMG/M |
| 3300033158|Ga0335077_10923185 | Not Available | 877 | Open in IMG/M |
| 3300034199|Ga0370514_179526 | Not Available | 549 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.39% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.40% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.20% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.20% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.20% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.20% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.20% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.60% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_07452080 | 2189573001 | Grass Soil | MQTLPRRLGVAVVTAAIVWFLSVKLSTFRDFQIAEVAIEV |
| FE1_02053730 | 2189573002 | Grass Soil | MQTLPRRLGVAVVTAAIVWFLSVKLSTFRDFQIAEVAIEVTAVPGSPC |
| Ga0062389_1020713472 | 3300004092 | Bog Forest Soil | MTARSTPRVLGVALAMAVVIVVLSIKLNSFRDYQIAQIAVEVTAVAGLTVLTG |
| Ga0066683_106243112 | 3300005172 | Soil | MTMQTLPRRLGVAVVTAVIVWFLSVRLTTFRDFQIAEVAIEVTA |
| Ga0066685_105491082 | 3300005180 | Soil | MTMQTLPRRLGVAVVTAVIVWFLSVKLTTFRDFQIAEVAIEVT |
| Ga0070661_1016605191 | 3300005344 | Corn Rhizosphere | MHTFPRRLGAVVLAAVVVWFLSVRLGTFRDYQIAEVAVEVTAVAG |
| Ga0070703_104352491 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTLPRRLGVAVVTAVIVWFLSVRLTTFRDFQIAEVAIEV |
| Ga0070711_1007233332 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMQTLPRRLGVAVVTAVIVWFLSVRLTTFRDFQIAEVAI |
| Ga0070698_1006524781 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTLPRRLGVAVVTAVIVWLLSVRLGTFRDFQIAEVAIEV |
| Ga0070762_101339351 | 3300005602 | Soil | MRMRSTPRILGAALATAVVVAILSIKLNAFRDYQIAEI |
| Ga0070762_108795782 | 3300005602 | Soil | MSMQTLPRRLGVAVIVAVVVVFLSIKLDTFRDYQIAEIAVEVTA |
| Ga0068856_1011376261 | 3300005614 | Corn Rhizosphere | MHTFPRRLGAVVLAAVVVWFLSVRLGTFRDYQIAEVAVEVTAVAGLSVLT |
| Ga0070717_102506883 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRVLASIVIVAAVVVLLSIKLNAFRDYQIAEIATYT |
| Ga0075019_105629531 | 3300006086 | Watersheds | VTMQTLPRRLGVAVVTAVIVWFLSVKLDTFRDYQIAEVAIEFTAVAG |
| Ga0075019_111662092 | 3300006086 | Watersheds | VSMRTLPRRLGIAVVMAVLVGFLSVKLDTFRDYQIAEVA |
| Ga0075030_1008489282 | 3300006162 | Watersheds | VTMQTLPRRLGVAVVTAVIVWFLSVKLNTFRDYQIAEVAIE |
| Ga0070712_1017110792 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTLPRRLGVAVVTAAIVWFLSVKLTTFRDFQIAEVAIEVTAV |
| Ga0070765_1008243651 | 3300006176 | Soil | MTARPLPRILGAALAGAVLVAVLSIKLNAFRDYQIAEIAIYVTAVAGLTV |
| Ga0070765_1022134902 | 3300006176 | Soil | MNTQSTPRVLGAALATAVVIAFLSVKLNTFRDYQIA |
| Ga0068865_1000746561 | 3300006881 | Miscanthus Rhizosphere | MSMQTLPRRLGIAIVTAMIVWFLSVRLSTFRDFQIAEVAV |
| Ga0075426_106273712 | 3300006903 | Populus Rhizosphere | MSMQTLPRRLGVAVVTAVIVWLLSVRLSTFRDFQIAEVAVEVTAVAGLTV |
| Ga0075435_1004869922 | 3300007076 | Populus Rhizosphere | MHTFPRRLGAAVVAAAVVWFLSVRLGTFRDYQIAEVAVEV |
| Ga0116220_100620431 | 3300009525 | Peatlands Soil | MTMQALPRRLGAAVVTAVIVWFLSVKLDTFRDYQI |
| Ga0116133_10954851 | 3300009623 | Peatland | MSAQSTPRVLGAAVAAAVIVALLSIRLNAFRDYQIAEIAIE |
| Ga0116217_103617441 | 3300009700 | Peatlands Soil | MTMQTLPRRLGLAVVMALIVWFLSVKLNTFRDYQIA |
| Ga0116223_103383861 | 3300009839 | Peatlands Soil | MTMRTLPRRLGLAVVVGVIVAVLSIRLNAFRDYQIAEIAMYVAAVAG |
| Ga0126384_105120381 | 3300010046 | Tropical Forest Soil | MNMRTLPRRLGAAVVTAVIVWFLSVRLSTFRDFQIAEVAVEVTAVAG |
| Ga0126372_113106561 | 3300010360 | Tropical Forest Soil | MTMRSQPKIIGAALIAAAIVVILSIRLNTFRDYQIA |
| Ga0126378_116024551 | 3300010361 | Tropical Forest Soil | MSTRSLPRILGAAVATAVLVVILSIKLNAFRDFQIAEIAIYVT |
| Ga0134125_126017041 | 3300010371 | Terrestrial Soil | MSAAGVRTQSTPRILGAALVTAVVVVFLSVTLGTFRDYQIAEIAIEATAVAGLTVLTG |
| Ga0134128_105938653 | 3300010373 | Terrestrial Soil | MNMQTTPRVLGAALATAVLIAILSIKLNTFRDYQIAEIAIYVTAVAGL |
| Ga0136449_1026457481 | 3300010379 | Peatlands Soil | MSMRSLPRILGAALVTAAIVAILSIKLNAFRDYQIAEI |
| Ga0126359_12690602 | 3300010869 | Boreal Forest Soil | MSTQSTPRVLGAALAAAVVIAILSIKLSAFRDYQIAEIA |
| Ga0126359_16872002 | 3300010869 | Boreal Forest Soil | MTTKSTPRVLGAALAAAAVIAILSIKLNAFRDYQIAEIAIEVTAVAGL |
| Ga0126361_106361012 | 3300010876 | Boreal Forest Soil | MQTLPRRLGVAVIAAVIVAFLSIKLNTFRDYQIAEIA |
| Ga0126356_101058391 | 3300010877 | Boreal Forest Soil | MTMQTLPRRLGAAVVVAVIVGFLSIKLDTFRDYQIAEIAVEVTAVAGLTL |
| Ga0126350_108984201 | 3300010880 | Boreal Forest Soil | MTTRSTPRVLAAALAMAVLIAILSIKLNSFRDYQIAEIAIEVTAVAGLTIL |
| Ga0137388_114592092 | 3300012189 | Vadose Zone Soil | MTMQTLPRRLGVAILTAVIVWFLSVKLDKFRDYQIAEVGVYVT |
| Ga0137360_102745091 | 3300012361 | Vadose Zone Soil | MTMQTLPRRLGVAVVTAVIVWFLSVRLTTFRDFQIAEVAIEVTAVAGLTV |
| Ga0137416_114911702 | 3300012927 | Vadose Zone Soil | MSMQTLPRRLGVAVVTAVIVWLLSVRLSTFRDFQIAEVAIEVTAVAGL |
| Ga0157370_102631803 | 3300013104 | Corn Rhizosphere | VLGAALAAAVVVAVLSIKLSTFRDYQIAEIAIEVTA |
| Ga0157369_108651641 | 3300013105 | Corn Rhizosphere | MTMQTLPRRLGVAVVTAVIVWFLSVQLISFRDFQIAEV |
| Ga0157372_109135382 | 3300013307 | Corn Rhizosphere | MSMQTLPRRLGVAVVTAVIVWLLSVRLSTFRDFQIAEVAV |
| Ga0181523_102634161 | 3300014165 | Bog | MQTLPRRLGVAVLVALIVGFLSIKLNAFRDYQIAEVAYEVTAVA |
| Ga0182024_107521653 | 3300014501 | Permafrost | MSTRSTPRALGAALATAVVVAVLSIKLNAFRDYQIAEIAI |
| Ga0182030_100256441 | 3300014838 | Bog | MQTLPRRLGVAVIVAVIVVLASIKLDAFRDYQIAEIAVE |
| Ga0182030_105240303 | 3300014838 | Bog | MQSLPRRLGVAVVVAVIVVFLSIKLNAFRDYQIAEIAVEVTA |
| Ga0137418_106799902 | 3300015241 | Vadose Zone Soil | MTMQTLPRRLGVAVVTAVIVWFLSVRLTTFRDFQIAEVAIEVTAVA |
| Ga0137403_107845863 | 3300015264 | Vadose Zone Soil | MQTLPRRLGVAVVTAVIVWFLSVRLSTFRDFQIAEVAVEVTAVA |
| Ga0182035_104853591 | 3300016341 | Soil | MTMQTLPRRLGAAVVTAVIVWFLSVRLDTFRDFQIAQVAVYVTA |
| Ga0182032_105449101 | 3300016357 | Soil | VTMRTLPRRLGVAIVVAAIVVFLSIRLNAFRDYQIAEIAVYVTAVAG |
| Ga0187812_12037601 | 3300017821 | Freshwater Sediment | MPTLPRRLGVAIVLAAVVVFLSIKLNAFRDYQIAEIAVYV |
| Ga0187812_12377901 | 3300017821 | Freshwater Sediment | VTMRTLPRRLGVAIIVAAIVAFLSIKLNAFRDYQIAEIAVEVTAVAGLTVLT |
| Ga0187812_12780481 | 3300017821 | Freshwater Sediment | VTMRTLPGRLGVAIIVAAIVAFLSIKLNAFRDFQIAEIAVE |
| Ga0187802_101742041 | 3300017822 | Freshwater Sediment | MTMPTLPRRLGVAIVLAAVVVFLSIKLNAFRDYQIAE |
| Ga0187814_103493212 | 3300017932 | Freshwater Sediment | MGTLPRRLGLAIIVAALIAILSIKLNQFRDYEIAEIAL |
| Ga0187801_105099922 | 3300017933 | Freshwater Sediment | VTMWTLPRRLGVLIVLAAIVVFLTIKLNAFRDYQIAEIAVYVTAIAGLTV |
| Ga0187808_103621311 | 3300017942 | Freshwater Sediment | MSTRPLLRILGAALVGAAVVVILSIKLDAFRDYQIAQVA |
| Ga0187781_102229331 | 3300017972 | Tropical Peatland | MRTLPRRLGVAIVVAAIVAFLSIKLNAFRDYQIAEVAVEVTAVAGLTVLT |
| Ga0187781_105880891 | 3300017972 | Tropical Peatland | MTMRTLPRRLGLAVVVGVIVAVLSIKLNEFRDYQIAEIA |
| Ga0187780_112495471 | 3300017973 | Tropical Peatland | VTMWTLPRRLGVLIVLAAIVVFLSVKLNAFRDYQIAEIAVYVTAIAGLTVL |
| Ga0187780_113260471 | 3300017973 | Tropical Peatland | MTMRTLPRRLGVAVVVAAIVVFLSIRLNTFRDYQIAEIAYEVT |
| Ga0187777_113998342 | 3300017974 | Tropical Peatland | MSMRSPLLRILGAALLGAVIVVILSIKLNAFRDYQIAEIA |
| Ga0187782_102675431 | 3300017975 | Tropical Peatland | MTMRTLPRRIGVAIIVAAIVAFLSIKLNAFRDYQIAEIAVY |
| Ga0187815_103593541 | 3300018001 | Freshwater Sediment | VTMRTLPGRLGVAIIVAAIVAFLSIKLNAFRDFQIAEIAVEVTAV |
| Ga0187765_113718812 | 3300018060 | Tropical Peatland | VTMRTLPRRLAVAIIVAAIVAILSIKLNTFRDYQIAEIAVYVTAVA |
| Ga0187772_114852532 | 3300018085 | Tropical Peatland | MTMRTLPRRLGVAIIVAAIVAILSIKLNAFRDYQIAEIAVYVTAVAGL |
| Ga0187771_104677411 | 3300018088 | Tropical Peatland | VTMRTLPRRLGVAIVLAAVVVFLSVKLNAFRDYQIAEVAVYVTAI |
| Ga0066655_107262131 | 3300018431 | Grasslands Soil | MQTLPRRLGAAVVTAVIVWFLSIRLSTFRDFQIAEVAIEVQAV |
| Ga0066669_119252441 | 3300018482 | Grasslands Soil | VTMQTLPRRLGVAVVTAVIVWFLSVRLTTFRDFQIA |
| Ga0210405_106004101 | 3300021171 | Soil | VTMRTLPRRLAVAIIVAAIVAFLSIKLNAFRDFQIAEIATEVTAVAG |
| Ga0210385_109058332 | 3300021402 | Soil | VTMRTLPRRLAVAIIVAAIVVFLSIKLNAFRDFQIAEIATEVTAVAGLTV |
| Ga0210397_109718051 | 3300021403 | Soil | MRTLPRRLGIAVVVAVIVGFLSIKLDTFRDYQIAEVAVEVTAVAG |
| Ga0210389_110022001 | 3300021404 | Soil | MSLQSTARILGAALVVAVVVAVLSIELSPFRDYQIAE |
| Ga0210383_100221555 | 3300021407 | Soil | MRTLPRRLAVAIIVAAIVAFLSIKLNAFRDFQIAEIAVEVTAVAGLT |
| Ga0210383_104710081 | 3300021407 | Soil | MRTLPRRLAVAIIVAAIVAFLSIKLNAFRDFQIAE |
| Ga0210383_107982191 | 3300021407 | Soil | MTMRPLLRILGAALVGAAIVAVLSMKLNAFRDYQIAEI |
| Ga0210409_114253971 | 3300021559 | Soil | MRTLPRRLAVAIIVAAIVVFLSIKLNAFRDYQIAEI |
| Ga0224712_103583931 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMRSLPRVLAAALAVAVVVAILSIKLNTFQDYQIAEIA |
| Ga0242659_10345051 | 3300022522 | Soil | MRTLPRRLAVAIIVAAIVVFLSVKLNAFRDYQIAEIAVDVTAVAGLTV |
| Ga0242675_10989872 | 3300022718 | Soil | MRTQPTLRVLGTALVVAVIVVILSIKLNSFRDYQIAEIAI |
| Ga0233357_10429832 | 3300023056 | Soil | MSMRSTPRILGAALATAVVVAILSIKLNAFRDYQIAE |
| Ga0228598_10764321 | 3300024227 | Rhizosphere | MTMRTLPRRLGLAVIAGVIVALLSIRLNAFRDYQIA |
| Ga0208589_10236803 | 3300025634 | Arctic Peat Soil | VHSLPRRLGLAVIVAAIVAFLSIRLDTFRDYQIAEVAVEVTAVAGL |
| Ga0207692_101026283 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMRAPLLRILGAAVAAAVIVVILSIKLNAFRDYQIAEIAVYVTAIAG |
| Ga0207685_102758221 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMHTFPRRLGAAVLAAAVVWFLSVRLGTFRDYQIAEVAV |
| Ga0207699_101456983 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTLPRRLGVAVVTAVIVWFLSVRLTAFRDFQIAEVAIEVT |
| Ga0207693_112698111 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLPRRLGVAIVVAVIVAFLSIRLNAFRDFQIAEIATEV |
| Ga0207679_114795092 | 3300025945 | Corn Rhizosphere | MSATGVRTQSTPRILGAALVTAVVVVFLSVKLGTFRDYQIAEIAIEV |
| Ga0209234_11737522 | 3300026295 | Grasslands Soil | MQTLPRRLAAAVVTAVIVWFLSVRLGTFRDFQIAVV |
| Ga0209648_1000488411 | 3300026551 | Grasslands Soil | MTMQTLPRRLGVAVLTAVIVWFLSVKLDTFRDYQIAEVGVYVTAVAGL |
| Ga0208237_10075702 | 3300027080 | Forest Soil | MTTKSTPRVLGVAVVAAVIVAFLSIKLNSFRDYQIAEIAIEVLGGAATAAS |
| Ga0209007_10565302 | 3300027652 | Forest Soil | MSTHSTPRVLGAALATAVVVAFLSIKLNAFRDYQIAEIAIEVTAVAGLTILTGLS |
| Ga0209626_10698802 | 3300027684 | Forest Soil | MSMRSTPRILGAALATAVVVAILSIKLNAFRDYQIAEIA |
| Ga0209626_10823981 | 3300027684 | Forest Soil | MTTRTTPRVLAAALATAVVVAFLSIKLNAFRDYQIAEI |
| Ga0209060_101511041 | 3300027826 | Surface Soil | MATTLPRRLGVAIVVAVIVAFLSIRLNAFRDFQIAEIAVEVTAVAGLTV |
| Ga0209580_105327101 | 3300027842 | Surface Soil | MTMRTLPRRLALAVIVAIIVAVVSVKLNAFRDYQIAEIAMYVTAVAALTVLTGFSG |
| Ga0209274_106692602 | 3300027853 | Soil | MTMRTLPRRLGLAVVVGVIVAVLSIKLNAFRDYQIAEIAMYVAAVAGLTV |
| Ga0209701_105820452 | 3300027862 | Vadose Zone Soil | MTMQSLSRRLGLAVVMAVIVWFLSIKLDTFRDYQIAEVAIEVTAVAGLSVLTGLSGQ |
| Ga0209380_108400312 | 3300027889 | Soil | MNTQSTPRVLGAALATAVVVAFLSIKLNAFRDYQIAEIAIDVTAVAGLTVLTGL |
| Ga0209415_104609971 | 3300027905 | Peatlands Soil | MTMQTLPRRLGLAIIVGVIVAVLSIKLNQFRDYQI |
| Ga0302220_102829152 | 3300028742 | Palsa | VSMQTLPRRLGVAVVVAVIVVLASIKLNTFRDYQIAEIAIEVTAVAGLTLLT |
| Ga0302228_104555561 | 3300028808 | Palsa | VTMRTLPRRLGVAIAVAAIVVLLSIKLNSFRDYQIA |
| Ga0307277_100102451 | 3300028881 | Soil | MSMQTLPRRLGVAVVTAVIVWFLSVRLSTFRDFQIA |
| Ga0311369_109261802 | 3300029910 | Palsa | MTTRSTPRVLGAALVAAVLIAILSIKLNSFRDYQIAE |
| Ga0311352_100515766 | 3300029944 | Palsa | MQTLPRRLGVAVVVAVIVVLASIKLNTFRDYQIAEIAVEVTAVAGLTLL |
| Ga0311353_115836392 | 3300030399 | Palsa | MTTRSTPRVLAAALATAVLIAILSIKLNSFRDYQIAEIAIEVTAVAGLTIL |
| Ga0310037_104822422 | 3300030494 | Peatlands Soil | MTMQTLPRRLGVAVLVALIVGFLSIKLNAFRDYQIAEVAYE |
| Ga0302183_102455202 | 3300030509 | Palsa | VSMQSLPRRLGVAVVVAVIVVLASIKLNTFRDYQIAEIAIEVTAVAGLTLLTGLS |
| Ga0311357_104109651 | 3300030524 | Palsa | MQTLPRRLGVAVVVAVIVVLASIKLNTFRDYQIAEIAVEVTA |
| Ga0311355_101077671 | 3300030580 | Palsa | MQTLPRRLGVAVVVAVIVVLASIKLNTFRDYQIAEIAV |
| Ga0302317_103490611 | 3300030677 | Palsa | MTTRSTPRVLGAALVAAVLIAILSIKLNSFRDYQIAEIAI |
| Ga0310039_102089922 | 3300030706 | Peatlands Soil | VTMTLLRHLAAAVLAAVVVAILTIQLNAFRDYQIAEIAC |
| Ga0302310_107108932 | 3300030737 | Palsa | MQTLPRRLGVAVVVAVIVVLASIKLNTFRDYQIAEIAVE |
| Ga0302311_101354341 | 3300030739 | Palsa | MQSLPRRLGVAVVVAVIVVLASIKLNTFRDYQIAEIAIEVTAVAGLTLLTGLS |
| Ga0265461_116479102 | 3300030743 | Soil | MTMQTLPRRLAVAVVVAVIVAFLSIKLNTFRDYQIAEVAVEVTAVAGLTLLTGLS |
| Ga0302308_102400152 | 3300031027 | Palsa | MTTQSTPRVLAAALATAVVIALLSIRLNAFRDYQIAEIAIEVTAVAGLTIL |
| Ga0302308_104783371 | 3300031027 | Palsa | VSMQTLPRRLGVAVVVAVIVVLASIKLNTFRDYQI |
| Ga0302325_101234546 | 3300031234 | Palsa | MTVQSTPRILGAALATAVLVVIASIKLNAFRDYQIAEIAIEVTAVAGL |
| Ga0318571_101196001 | 3300031549 | Soil | MTMRSLPRILGAALVTAALVAILSIKLNAFRDYQIAEIAVDVTAVAGL |
| Ga0318515_106322802 | 3300031572 | Soil | MRTLPRRLGVAIIVAAIVAFLSIKLNAFRDFQIAEIAVEVTAVAGLTVLT |
| Ga0307508_106183401 | 3300031616 | Ectomycorrhiza | MSMQTFPRRLGAALVAAAVVWFLSVKLNTFRDYQIAEVAVEVTAVAGLTVLTG |
| Ga0318555_107117592 | 3300031640 | Soil | VTMRTLPRRLGVAIIVAAIVAILSVKLNAFRDYQIAEIAVYVTAVAGLT |
| Ga0318542_105778132 | 3300031668 | Soil | VTMGTLPRRIGAAIIVAAIVALLSIKLNAFRDFQIAEIAVEVTAVA |
| Ga0310686_1150564032 | 3300031708 | Soil | VSMQSLPRRLGVAVVVAVIVVFLSIKLDTFRDYQIAEISVEVTAVAGLT |
| Ga0307476_106592791 | 3300031715 | Hardwood Forest Soil | MRTLPRRLAVAIIVAVIVAFLSIKLNAFRDFQIAEIAVEVTAVAGLTVL |
| Ga0307476_108876072 | 3300031715 | Hardwood Forest Soil | VTMRTLPRRLAVAIIVAAIVAFLSIKLNAFRDFQIAE |
| Ga0307474_114911101 | 3300031718 | Hardwood Forest Soil | MRTLPRRLAVAIIVAVIVAFLSIKLNAFRDFQIAEIAV |
| Ga0318492_102176501 | 3300031748 | Soil | MTMRPLPRVLGAALAGAALVVILSIKLNAFRDYQIAEIAVYVTAVAGLTVL |
| Ga0307477_109111202 | 3300031753 | Hardwood Forest Soil | MRSPLLRILGAALLGAVIVVILSIKLNAFRDYQIAEIAV |
| Ga0307475_104798842 | 3300031754 | Hardwood Forest Soil | MSIRAPLLRILGAALLGAVIVVILSIKLNAFRDYQIAEIAVYVIAI |
| Ga0318554_104408952 | 3300031765 | Soil | MTMRPLPRVLGAALAGAALVVILSIKLNAFRDYQIAEIAVYV |
| Ga0318498_102519711 | 3300031778 | Soil | VTMPTLPRRLGIAIVLAAVVVFLSIKLNAFRDYQIAEVA |
| Ga0318576_106177331 | 3300031796 | Soil | VTMPTLPRRLGIAIVLAAVVVFLSIKLNAFRDYQIAEVAIYF |
| Ga0318550_105677821 | 3300031797 | Soil | MTMRPLPRVLGAALAGAALVVILSIKLNAFRDYQIAEIAVYVTAVAGL |
| Ga0318565_104538332 | 3300031799 | Soil | MTMQTLPRRLGAAVVTAVIVWFLSVRLDTFRDFQIAQVGVYV |
| Ga0318565_105677561 | 3300031799 | Soil | MTMRPLPRVLGAALAGAALVVILSIKLNAFRDYQIAEIAVYVTAVAGLT |
| Ga0307478_111892111 | 3300031823 | Hardwood Forest Soil | MSIRAPLLRILGAALLGAVIVVILSIKLNAFRDYQIAEIAVYVIAIAG |
| Ga0318527_104552751 | 3300031859 | Soil | VTMGTLPRRIGAAIIVAAIVALLSIKLNAFRDFQI |
| Ga0306919_102364281 | 3300031879 | Soil | MSTRSLPRILGAAVATAALVVILSIKLNAFRDYQIAEIAVYVTAVAG |
| Ga0306925_112871642 | 3300031890 | Soil | VTMPTLPRRLGIAIVLAAVVVFLSIKLNAFRDYQIAEV |
| Ga0318522_104275612 | 3300031894 | Soil | MSTRPLLRILGAALAVAALVVILSIKLNAFRDYQIAQIAIEVTAVAGLT |
| Ga0308174_114460951 | 3300031939 | Soil | MTMRSLPRVLGAALATGVVVAILSIKLNAFQDFQIAEVAAEVTAVAGLTVLTG |
| Ga0310916_102004113 | 3300031942 | Soil | MTMQTLPRRLGAAVVTAVIVWFLSVRLDTFRDFQIAQ |
| Ga0307479_109495922 | 3300031962 | Hardwood Forest Soil | MTMQTLPRRIGLAAVVAVIVWFLSIKLGTFRDYQIAEVAIEVTAV |
| Ga0308176_109171441 | 3300031996 | Soil | MQTLPRRLGAAVVTAVIVWFLSVRLGTFRDFQIAEVAVE |
| Ga0308176_123337951 | 3300031996 | Soil | MTMQTLPRRLGVAVVTAVIVWLLSVRLSTFRDFQIAEVAVEVTAVAG |
| Ga0318545_103816071 | 3300032042 | Soil | MTMRSLPRILGAALVTAALVAILSIKLNAFRDYQIAEIAVDVTAVAGLTV |
| Ga0318556_103809661 | 3300032043 | Soil | MRTLPRRLGAVIVLAVIVWYLSRTLNQFRDYQIAEIAVYVTAIAGLTVLT |
| Ga0318558_101997521 | 3300032044 | Soil | MTMRSLPRILGAALVTAAVVVILSIKLNAFRDYQIAEIAVY |
| Ga0306924_111692061 | 3300032076 | Soil | MRTLPRRLGVAIVVAAIVVFLSIKLNAFRDYQIAEIAVYVTAVAGL |
| Ga0318525_103938162 | 3300032089 | Soil | MTVWTLPRRLGAAVVLAAVVVFLSIRLNAFRDYQIAEIAVYLTAVAGLTVL |
| Ga0318540_102007052 | 3300032094 | Soil | MTMRPLPRVLGAALAGAALVMILSIKLNAFRDYQIAEIAVYVTAVAGL |
| Ga0311301_102499805 | 3300032160 | Peatlands Soil | MSIRAPLLRILGAAVAAAVIVVILSIKLNAFRDYQIAEIAV |
| Ga0307471_1033471062 | 3300032180 | Hardwood Forest Soil | MSMRSLPRILAAALVTAALVAILSIKLNAFRDYQIAEIAIDVTAVDG |
| Ga0306920_1028712532 | 3300032261 | Soil | MTMQTLPRRLGAAVLVAVIVWFLSVRLDTFRDYQIAEI |
| Ga0306920_1029584522 | 3300032261 | Soil | VTMGTLPRRIGAAIIAAAIVAFLSYKLNAFRDFQIAEIAVDVSAVAGLT |
| Ga0335085_109742161 | 3300032770 | Soil | MTMQTLPRRLGAAVLVVVIVWFLSVRLDTFRDYQIAEIAVYVPA |
| Ga0335079_107249621 | 3300032783 | Soil | MQTLPRRLGAAVVTAVIVWFLSVRLSTFRDFQIAEVAVEV |
| Ga0335078_107245971 | 3300032805 | Soil | VSMRSPLLRILGVALLGAVIVVLLSIKLNAFRDYQIAEIAVYVIAIA |
| Ga0335070_113220842 | 3300032829 | Soil | MTMHTLPRRLGAAVVTAVIVWFLSVRLDTFRDFQI |
| Ga0335069_113655532 | 3300032893 | Soil | MHTFPRRLGAAVTAAAVVWVLSVRLGTFRDYQIAEVAVEVTAVAGLSC |
| Ga0335075_102143221 | 3300032896 | Soil | MTTRSTPRVLGAALATAVLIAILSIKLNSFRDYQIAEIAIE |
| Ga0335075_106394062 | 3300032896 | Soil | MTMRTLPRRLAVAVIVAAIVAFLSIKLNSFRDYQIAEVA |
| Ga0335072_111606042 | 3300032898 | Soil | MTTRTTPRVLGAALVTAVLIVIVSIKLNSFRDYQIA |
| Ga0335077_109231851 | 3300033158 | Soil | VSMRSPLLRILGAALLGAVIVVILSIKLDAFRDYQIEE |
| Ga0370514_179526_394_549 | 3300034199 | Untreated Peat Soil | MQSLPRRLGVAVVVAVIVVFLSIKLNTFRDYQIAEIAVEVTAVAGLTLLTGL |
| ⦗Top⦘ |