| Basic Information | |
|---|---|
| Family ID | F037801 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 41 residues |
| Representative Sequence | HERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSR |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.61 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.377 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.509 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.677 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF00132 | Hexapep | 2.99 |
| PF04007 | DUF354 | 1.80 |
| PF13243 | SQHop_cyclase_C | 1.80 |
| PF14602 | Hexapep_2 | 1.20 |
| PF01408 | GFO_IDH_MocA | 1.20 |
| PF13727 | CoA_binding_3 | 0.60 |
| PF01638 | HxlR | 0.60 |
| PF06161 | DUF975 | 0.60 |
| PF13249 | SQHop_cyclase_N | 0.60 |
| PF00733 | Asn_synthase | 0.60 |
| PF12680 | SnoaL_2 | 0.60 |
| PF04932 | Wzy_C | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| COG1817 | Predicted glycosyltransferase | General function prediction only [R] | 1.80 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.60 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG5523 | Uncharacterized membrane protein | Function unknown [S] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_104621011 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300002407|C687J29651_10095600 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10023113 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300003322|rootL2_10096338 | All Organisms → cellular organisms → Bacteria | 3749 | Open in IMG/M |
| 3300004643|Ga0062591_100116753 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300005166|Ga0066674_10258249 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005172|Ga0066683_10669970 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005179|Ga0066684_11096226 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005289|Ga0065704_10197193 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005293|Ga0065715_10969027 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005328|Ga0070676_10141062 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300005334|Ga0068869_100447318 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300005340|Ga0070689_100831640 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005340|Ga0070689_102173112 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005343|Ga0070687_100220766 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300005343|Ga0070687_100284003 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300005345|Ga0070692_10289166 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300005440|Ga0070705_100786435 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005451|Ga0066681_10493747 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005454|Ga0066687_10267963 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005457|Ga0070662_101653010 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005544|Ga0070686_100289966 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300005545|Ga0070695_101821215 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005546|Ga0070696_100549396 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005548|Ga0070665_101087530 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005563|Ga0068855_100684195 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005576|Ga0066708_10715471 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005577|Ga0068857_100764689 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300005587|Ga0066654_10800396 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005618|Ga0068864_100695822 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300005719|Ga0068861_101209297 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005841|Ga0068863_102462505 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005842|Ga0068858_101934516 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005843|Ga0068860_100469882 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300005843|Ga0068860_100589722 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300006196|Ga0075422_10048094 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300006755|Ga0079222_11757029 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006755|Ga0079222_12189259 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006796|Ga0066665_10220183 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300006852|Ga0075433_10187172 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300006854|Ga0075425_100832917 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300007004|Ga0079218_13157596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 556 | Open in IMG/M |
| 3300007265|Ga0099794_10191361 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300009012|Ga0066710_104590704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300009088|Ga0099830_11715058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300009090|Ga0099827_11427081 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009094|Ga0111539_11965428 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300009101|Ga0105247_10600781 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300009101|Ga0105247_11013248 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009101|Ga0105247_11037622 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009101|Ga0105247_11401542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300009147|Ga0114129_12613220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300009148|Ga0105243_12889968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300009174|Ga0105241_10493437 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300009174|Ga0105241_12703456 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009177|Ga0105248_10786176 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300010037|Ga0126304_11219063 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010040|Ga0126308_10675762 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010042|Ga0126314_10275212 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300010045|Ga0126311_10007555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 5914 | Open in IMG/M |
| 3300010046|Ga0126384_10265488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
| 3300010046|Ga0126384_10547528 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300010359|Ga0126376_10000048 | All Organisms → cellular organisms → Bacteria | 46022 | Open in IMG/M |
| 3300010359|Ga0126376_10152379 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300010361|Ga0126378_11237612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 843 | Open in IMG/M |
| 3300010398|Ga0126383_11264541 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300010398|Ga0126383_12751486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300010399|Ga0134127_11149927 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300010399|Ga0134127_13002493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300010400|Ga0134122_12286165 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300010401|Ga0134121_12274286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300010401|Ga0134121_12572419 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010403|Ga0134123_11967843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300011119|Ga0105246_11873953 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300011433|Ga0137443_1170806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300012045|Ga0136623_10103687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300012093|Ga0136632_10067102 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300012096|Ga0137389_11481346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300012198|Ga0137364_10401245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300012198|Ga0137364_11033092 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012198|Ga0137364_11166011 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012204|Ga0137374_11045230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 586 | Open in IMG/M |
| 3300012206|Ga0137380_10770607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300012354|Ga0137366_10453263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300012363|Ga0137390_11678282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012671|Ga0137318_1027115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300012885|Ga0157287_1043492 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012905|Ga0157296_10243140 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012922|Ga0137394_11443340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012923|Ga0137359_11578349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300012929|Ga0137404_11086407 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012930|Ga0137407_11555329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300012944|Ga0137410_10097960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2170 | Open in IMG/M |
| 3300012955|Ga0164298_11653106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012960|Ga0164301_10226651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300012989|Ga0164305_11616169 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300013297|Ga0157378_10577445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300013297|Ga0157378_11810074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 659 | Open in IMG/M |
| 3300014326|Ga0157380_12256897 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300014488|Ga0182001_10499213 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300014745|Ga0157377_10029180 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300015371|Ga0132258_10048131 | All Organisms → cellular organisms → Bacteria | 9734 | Open in IMG/M |
| 3300015373|Ga0132257_100180545 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300015373|Ga0132257_100886729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300015373|Ga0132257_103037866 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300015373|Ga0132257_104550549 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300015374|Ga0132255_100861659 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300015374|Ga0132255_102320228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 819 | Open in IMG/M |
| 3300015374|Ga0132255_103616039 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300017789|Ga0136617_10699459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300017947|Ga0187785_10589978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300018056|Ga0184623_10151248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300018075|Ga0184632_10390015 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018429|Ga0190272_10081583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2005 | Open in IMG/M |
| 3300018429|Ga0190272_11515528 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300018482|Ga0066669_10585754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300018920|Ga0190273_11675319 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300021081|Ga0210379_10441795 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300021445|Ga0182009_10434789 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300025907|Ga0207645_10147009 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300025910|Ga0207684_10684866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300025910|Ga0207684_10706323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300025911|Ga0207654_10642031 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300025913|Ga0207695_11422953 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300025918|Ga0207662_10139807 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300025920|Ga0207649_10587053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300025925|Ga0207650_11110070 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300025926|Ga0207659_10648142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300025926|Ga0207659_10649111 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300025930|Ga0207701_10063872 | All Organisms → cellular organisms → Bacteria | 3355 | Open in IMG/M |
| 3300025932|Ga0207690_10637978 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300025935|Ga0207709_11515455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300025936|Ga0207670_10699321 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300025936|Ga0207670_11637190 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300025937|Ga0207669_11864522 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025940|Ga0207691_11186604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300025949|Ga0207667_11285957 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300025960|Ga0207651_10244620 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300025981|Ga0207640_10333454 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300025981|Ga0207640_10691419 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300026075|Ga0207708_10439820 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1084 | Open in IMG/M |
| 3300026075|Ga0207708_10764204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 830 | Open in IMG/M |
| 3300026088|Ga0207641_10215166 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300026089|Ga0207648_10670477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300026089|Ga0207648_10737086 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300026095|Ga0207676_10712829 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300026095|Ga0207676_12223312 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300026095|Ga0207676_12333324 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026118|Ga0207675_100630929 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300026118|Ga0207675_102614920 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300026320|Ga0209131_1074333 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300027765|Ga0209073_10105958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300027875|Ga0209283_10170634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
| 3300027882|Ga0209590_10183614 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300027903|Ga0209488_10626294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300031047|Ga0073995_11408286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300031716|Ga0310813_11369277 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031731|Ga0307405_12020629 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031820|Ga0307473_10995153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300031852|Ga0307410_10825421 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031995|Ga0307409_100235573 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300032004|Ga0307414_10475302 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300032012|Ga0310902_10061711 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300032211|Ga0310896_10136385 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300033988|Ga0334909_026221 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300034376|Ga0334923_059848 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300034820|Ga0373959_0040941 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.59% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.99% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.20% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.60% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012671 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033988 | Soil microbial communities from Mojave Desert, California, United States - 5NOC | Environmental | Open in IMG/M |
| 3300034376 | Biocrust microbial communities from Mojave Desert, California, United States - 19HNC | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1046210112 | 3300000956 | Soil | ERGIANHRKLLWTLLMFELWHESFVETPRRIETSVESR* |
| C687J29651_100956002 | 3300002407 | Soil | QDEHETGVANHRKLLWTLLMFELWHESFIETARRIEDSVGTRQ* |
| JGIcombinedJ43975_100231131 | 3300002899 | Soil | ITRLQDEHERGIANHSKLLWTLLMFELWHESFIETARRIETSVSSGQ* |
| rootL2_100963385 | 3300003322 | Sugarcane Root And Bulk Soil | QDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETLVSSR* |
| Ga0062591_1001167531 | 3300004643 | Soil | EYVAKLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVNA* |
| Ga0066674_102582492 | 3300005166 | Soil | QGEHERGIANHRKLLWTLLSFELWRESFVETPRRIETSVNAR* |
| Ga0066683_106699702 | 3300005172 | Soil | EHERGVANHRKLLWTLLTFELWHESFVETPRLIETSVTSRQ* |
| Ga0066684_110962261 | 3300005179 | Soil | QDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSLTAQ* |
| Ga0065704_101971932 | 3300005289 | Switchgrass Rhizosphere | QERGVANHRKLLWTLLMFELWHESFIETPRRIETSVRAT* |
| Ga0065715_109690272 | 3300005293 | Miscanthus Rhizosphere | AYVTKLQDEHERGIANHRKLLWTLLMFELWHESFIETPRRIETSVTSK* |
| Ga0070676_101410622 | 3300005328 | Miscanthus Rhizosphere | RLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK* |
| Ga0068869_1004473182 | 3300005334 | Miscanthus Rhizosphere | AFVSRLQDEHERGIANHRKLLWTLLMFELWHESFIETPKRIETSVSQ* |
| Ga0070689_1008316401 | 3300005340 | Switchgrass Rhizosphere | ARLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG* |
| Ga0070689_1021731122 | 3300005340 | Switchgrass Rhizosphere | EHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGDRIT* |
| Ga0070687_1002207662 | 3300005343 | Switchgrass Rhizosphere | AKLQDEHERGIANHRKLLWTLLSFELWRESFVETPRRIETSVNA* |
| Ga0070687_1002840031 | 3300005343 | Switchgrass Rhizosphere | ARLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTTI* |
| Ga0070692_102891662 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRLQDEHERGIANHRKLLWTLLMFELWHESFIETPKRIETSVSQ* |
| Ga0070705_1007864352 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSVSSV* |
| Ga0066681_104937471 | 3300005451 | Soil | LQDEHERGVANHRKLLWTLLMFELWHESFIETARRIETSVSSRQ* |
| Ga0066687_102679633 | 3300005454 | Soil | LQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSLSSV* |
| Ga0070662_1016530102 | 3300005457 | Corn Rhizosphere | QDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETLVNSR* |
| Ga0070686_1002899661 | 3300005544 | Switchgrass Rhizosphere | HERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTTI* |
| Ga0070695_1018212151 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | HERGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT* |
| Ga0070696_1005493961 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ERGVANHRKLLWTLLSFELWRESFVETPRRIETSLTAQS* |
| Ga0070665_1010875302 | 3300005548 | Switchgrass Rhizosphere | QDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK* |
| Ga0068855_1006841951 | 3300005563 | Corn Rhizosphere | QDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSIFR* |
| Ga0066708_107154712 | 3300005576 | Soil | RGVANHRKLLWTLLSFELWRESFVETPKRIETSVSA* |
| Ga0068857_1007646892 | 3300005577 | Corn Rhizosphere | LQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSIAT* |
| Ga0066654_108003961 | 3300005587 | Soil | LQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSLTAQ* |
| Ga0068864_1006958223 | 3300005618 | Switchgrass Rhizosphere | HERGIANHRKLLWTLLSFELWRESFVETPRRIETSVNA* |
| Ga0068861_1012092971 | 3300005719 | Switchgrass Rhizosphere | ARLQDEHERGVANHRKLLWTVLMFELWHESFIETPRRIETSVASREG* |
| Ga0068863_1024625051 | 3300005841 | Switchgrass Rhizosphere | LQDEHERGVANHRKLLWTLLMFELWHESFVETPKRIETSVGSR* |
| Ga0068858_1019345162 | 3300005842 | Switchgrass Rhizosphere | HERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG* |
| Ga0068860_1004698822 | 3300005843 | Switchgrass Rhizosphere | ANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT* |
| Ga0068860_1005897221 | 3300005843 | Switchgrass Rhizosphere | QDEHERGVANHRKLLWTLLSFELWRESFIETPRRIETSLTAG* |
| Ga0075422_100480941 | 3300006196 | Populus Rhizosphere | VANHRKLLWTLLMFELWHESFIETPRRIETSVASREG* |
| Ga0079222_117570291 | 3300006755 | Agricultural Soil | NHRKLLWTLLMFELWHESFIETPRRIETSVASREG* |
| Ga0079222_121892592 | 3300006755 | Agricultural Soil | RGVANHRKLLWTLLTFELWRESFVETPRRIETSVSAG* |
| Ga0066665_102201831 | 3300006796 | Soil | ERGLANNRKLLWTLLSFELWRESFVETPRRIETSVSAT* |
| Ga0075433_101871723 | 3300006852 | Populus Rhizosphere | VANHRKLLWTLLSFELWRESFIETPRRIETSLTAQ* |
| Ga0075425_1008329172 | 3300006854 | Populus Rhizosphere | EHERGIANHRKLLWTLLMFELWHESFIETPRRIETSVNS* |
| Ga0079218_131575962 | 3300007004 | Agricultural Soil | VANHRKLLWTLLSFELWRESFVETPRRIETSVSAV* |
| Ga0099794_101913611 | 3300007265 | Vadose Zone Soil | QDEHERGVANHRKLLWTLLMFELWHESFIETARRIETSVGSRQ* |
| Ga0066710_1045907041 | 3300009012 | Grasslands Soil | LDEHESGVANHRKLLWTLLSFELWRESFIETPRRIETSVSAT |
| Ga0099830_117150582 | 3300009088 | Vadose Zone Soil | RLQDEHERGVANHRKLLWTLLTFELWRESFVETPRRIETSVSAT* |
| Ga0099827_114270812 | 3300009090 | Vadose Zone Soil | TKLQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVSSSK* |
| Ga0111539_119654282 | 3300009094 | Populus Rhizosphere | ERGVANHRKLLWTLLMFELWHESFIETPRRIETSVRAT* |
| Ga0105247_106007812 | 3300009101 | Switchgrass Rhizosphere | QDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG* |
| Ga0105247_110132481 | 3300009101 | Switchgrass Rhizosphere | NHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT* |
| Ga0105247_110376221 | 3300009101 | Switchgrass Rhizosphere | VANHRKLLWTLLMFELWHESFVETPRRIETSVGDRMM* |
| Ga0105247_114015422 | 3300009101 | Switchgrass Rhizosphere | QDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVASRR* |
| Ga0114129_126132201 | 3300009147 | Populus Rhizosphere | KLQDEHERGIANHRKLLWTLLSFELWRESFVETPRRIETSLTAQ* |
| Ga0105243_128899681 | 3300009148 | Miscanthus Rhizosphere | RGVANHRKLLWTLLSFELWRESFVETPKRIETSVGSAQ* |
| Ga0105241_104934371 | 3300009174 | Corn Rhizosphere | HERGIANHRKLLWTLLMFELWHESFIETPRRIETSVNS* |
| Ga0105241_127034562 | 3300009174 | Corn Rhizosphere | QDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG* |
| Ga0105248_107861761 | 3300009177 | Switchgrass Rhizosphere | RLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT* |
| Ga0126304_112190632 | 3300010037 | Serpentine Soil | ERGVANHRKLLWTLLMFELWHESFVETPRRIETVESKL* |
| Ga0126308_106757622 | 3300010040 | Serpentine Soil | DEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVVN* |
| Ga0126314_102752122 | 3300010042 | Serpentine Soil | EHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT* |
| Ga0126311_100075557 | 3300010045 | Serpentine Soil | ANHRKLLWTLLMFELCHESFVEAPRRIETSVGSR* |
| Ga0126384_102654883 | 3300010046 | Tropical Forest Soil | EYVAKLQDEHERGIANHRKLLWTLLSFELWRESFVETPRRIEASLSV* |
| Ga0126384_105475281 | 3300010046 | Tropical Forest Soil | LQNEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVSG* |
| Ga0126376_1000004843 | 3300010359 | Tropical Forest Soil | LQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG* |
| Ga0126376_101523793 | 3300010359 | Tropical Forest Soil | QDEHERGIANHRKLLWTLLMSELWHESFIETPKRIETSVNS* |
| Ga0126378_112376121 | 3300010361 | Tropical Forest Soil | AHERGIANHRKLLWTLLSFELWRESFVETPRRIETSMHV* |
| Ga0126383_112645411 | 3300010398 | Tropical Forest Soil | YVSRLQDEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSMTA* |
| Ga0126383_127514861 | 3300010398 | Tropical Forest Soil | VANHRKLLWTLLSFELWHESFVETPKRIETSLTA* |
| Ga0134127_111499271 | 3300010399 | Terrestrial Soil | DEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSILR* |
| Ga0134127_130024931 | 3300010399 | Terrestrial Soil | DEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTTI* |
| Ga0134122_122861651 | 3300010400 | Terrestrial Soil | EHERGVANHRKLLWTLLMFELWHESFVETRRRIETSVGSREG* |
| Ga0134121_122742861 | 3300010401 | Terrestrial Soil | VAKLQDEHERGIANHRKLLWTLLSFELWRESFVATPKRIESSISA* |
| Ga0134121_125724192 | 3300010401 | Terrestrial Soil | GVANHRKLLWTLLMFELWHESFVETPRRIETSVGDRIT* |
| Ga0134123_119678431 | 3300010403 | Terrestrial Soil | HERGVANHRKLLWTLLSFELWRESFVETPRRIETSVSSV* |
| Ga0105246_118739531 | 3300011119 | Miscanthus Rhizosphere | ERGIANHRKLLWTLLMFELWHESFIETPRRIETSVTSK* |
| Ga0137443_11708062 | 3300011433 | Soil | ANHRKLLWTLLSFELWRESFVETPRRIETSVTARQ* |
| Ga0136623_101036871 | 3300012045 | Polar Desert Sand | LQDEHERGVANHRKLLWTLLMFELWHESFIETPRLIQTSVGSRQ* |
| Ga0136632_100671022 | 3300012093 | Polar Desert Sand | QDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVGSSKQ* |
| Ga0137389_114813461 | 3300012096 | Vadose Zone Soil | NHRKLLWTLLSFELWRESFVETPRRIETSVTAGR* |
| Ga0137364_104012452 | 3300012198 | Vadose Zone Soil | DEHERGIANHRKLLWTLLTFELWRESFVETPRRIETSVTAN* |
| Ga0137364_110330921 | 3300012198 | Vadose Zone Soil | HERGVANHRKLLWTLLMFELWHESFIETARRIETSVSSRQ* |
| Ga0137364_111660112 | 3300012198 | Vadose Zone Soil | HERGVANHRKLLWTLLMFELWHESFIETPRRIETSVSSRQ* |
| Ga0137374_110452302 | 3300012204 | Vadose Zone Soil | VAKLQDEHERGIANHRKLLWTLLSFELWRESFVETPRRIETSVSSV* |
| Ga0137380_107706071 | 3300012206 | Vadose Zone Soil | VAKLQDEHERGIANHCKLLWTLLSFELWRESFVETPKRIETSVTAS* |
| Ga0137366_104532632 | 3300012354 | Vadose Zone Soil | VTKLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVGSEQ* |
| Ga0137390_116782822 | 3300012363 | Vadose Zone Soil | RLQDEHERGIANHRKLLWTLLTFELWHESFVETPRRIETSVGATLGSED* |
| Ga0137318_10271151 | 3300012671 | Soil | DEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTAGQ* |
| Ga0157287_10434921 | 3300012885 | Soil | DEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK* |
| Ga0157296_102431401 | 3300012905 | Soil | QDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVSR* |
| Ga0137394_114433402 | 3300012922 | Vadose Zone Soil | FNPEYVARLQDEHERGVANHRTLVWTLLTFELCREGFLETPRRIETSVNAT* |
| Ga0137359_115783491 | 3300012923 | Vadose Zone Soil | NHRKLLWTLLSFELWRESFVETPKRIETSVGASQ* |
| Ga0137404_110864071 | 3300012929 | Vadose Zone Soil | LQDEHERGVANHRKLLWTLLMFELWHESFIETPKRIETSVISSQE* |
| Ga0137407_115553291 | 3300012930 | Vadose Zone Soil | GVANHRKLLWTLLTFELWRESFVETPRRIETSVSSA* |
| Ga0137410_100979603 | 3300012944 | Vadose Zone Soil | YVTRLQDEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSVGASQ* |
| Ga0164298_116531061 | 3300012955 | Soil | VANHRKLLWTLLSFELWRESFVETPRRIETSVGAPH* |
| Ga0164301_102266512 | 3300012960 | Soil | KLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVSSRQ* |
| Ga0164305_116161692 | 3300012989 | Soil | GIANHRKLLWTLLSFELWRESFVETPRKIEASLRV* |
| Ga0157378_105774452 | 3300013297 | Miscanthus Rhizosphere | QEEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSVSTI* |
| Ga0157378_118100741 | 3300013297 | Miscanthus Rhizosphere | LQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETS |
| Ga0157380_122568971 | 3300014326 | Switchgrass Rhizosphere | DEHERGIANHRKLLWTLLMFELWHESFIETPKRIETSVSQ* |
| Ga0182001_104992132 | 3300014488 | Soil | VANHRKLLWTLLMFELWHESFVETPRRIETSVASR* |
| Ga0157377_100291801 | 3300014745 | Miscanthus Rhizosphere | ERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK* |
| Ga0132258_100481311 | 3300015371 | Arabidopsis Rhizosphere | HEHEQGVANHRKLLWTLLMFELWHESFIETPRRIETSVNS* |
| Ga0132257_1001805455 | 3300015373 | Arabidopsis Rhizosphere | ERGVANHRKLLWTLLSFELWRESFVETPRKIEASLTAQ* |
| Ga0132257_1008867292 | 3300015373 | Arabidopsis Rhizosphere | KLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSLTAQ* |
| Ga0132257_1030378661 | 3300015373 | Arabidopsis Rhizosphere | GVANHRKLLWTLLMFELWHESFVETPRRIETSVGST* |
| Ga0132257_1045505492 | 3300015373 | Arabidopsis Rhizosphere | EHERGVANHRKLLWTLLMFELWHESFIETPKRIETSVNS* |
| Ga0132255_1008616592 | 3300015374 | Arabidopsis Rhizosphere | LQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTMT* |
| Ga0132255_1023202281 | 3300015374 | Arabidopsis Rhizosphere | ERGVANHRKLLWTLLSFELWRESFVETPKRIETSVSSV* |
| Ga0132255_1036160392 | 3300015374 | Arabidopsis Rhizosphere | GVANHRKLLWTLLMFELWHESFIETPRRIETSVTK* |
| Ga0136617_106994591 | 3300017789 | Polar Desert Sand | QDEHERGHANHRKLLWTLLVFELWHESFIETPRRIEQSVSSRS |
| Ga0187785_105899781 | 3300017947 | Tropical Peatland | LDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVGAI |
| Ga0184623_101512481 | 3300018056 | Groundwater Sediment | KLQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVSK |
| Ga0184632_103900151 | 3300018075 | Groundwater Sediment | QDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTSKQ |
| Ga0190272_100815831 | 3300018429 | Soil | HERGVANHRKLLWTLLMFELWHESFIETARRIETSVVSGQ |
| Ga0190272_115155281 | 3300018429 | Soil | RLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVSSRQ |
| Ga0066669_105857541 | 3300018482 | Grasslands Soil | QDEHERGVANHRKLLWTLLMFELWHESFIETPKRIETSVGSKQ |
| Ga0190273_116753191 | 3300018920 | Soil | ANHRKLLWTLLMFELWYESFIATPHRIETSVSSSRQ |
| Ga0210379_104417951 | 3300021081 | Groundwater Sediment | VTKLQDEHERGVANHRKLLWTLLMFELWQESFIETPRRIETSVGSRR |
| Ga0182009_104347892 | 3300021445 | Soil | EHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSR |
| Ga0207645_101470091 | 3300025907 | Miscanthus Rhizosphere | RGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK |
| Ga0207684_106848662 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GVANHRKLLWTLLSFELWRESFVETPKRIETSVGAAQ |
| Ga0207684_107063232 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GVANHRKPLWTLLMFELWHESFIETARRIETSVTSKQ |
| Ga0207654_106420311 | 3300025911 | Corn Rhizosphere | DEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG |
| Ga0207695_114229531 | 3300025913 | Corn Rhizosphere | ARLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT |
| Ga0207662_101398071 | 3300025918 | Switchgrass Rhizosphere | RGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSR |
| Ga0207649_105870532 | 3300025920 | Corn Rhizosphere | GVANHRKLLWTLLMFELWHESFVETPRRIETSVSK |
| Ga0207650_111100701 | 3300025925 | Switchgrass Rhizosphere | RLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVASREG |
| Ga0207659_106481422 | 3300025926 | Miscanthus Rhizosphere | AKLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVNA |
| Ga0207659_106491112 | 3300025926 | Miscanthus Rhizosphere | DEHERGIANHRKLLWTLLMFELWHESFVETPRRIETLVNSR |
| Ga0207701_100638721 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK |
| Ga0207690_106379782 | 3300025932 | Corn Rhizosphere | DEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSILR |
| Ga0207709_115154551 | 3300025935 | Miscanthus Rhizosphere | AYVAKLQDEHERGIANHRKLLWTLLSFELWRESFVETPKRIETSISA |
| Ga0207670_106993212 | 3300025936 | Switchgrass Rhizosphere | EHERGVANHRKLLWTLLMFELWHESFVETPKRIETSVGSR |
| Ga0207670_116371902 | 3300025936 | Switchgrass Rhizosphere | RGVANHRKLLWTLLMFELWHESFIETPRRIETSVASREG |
| Ga0207669_118645222 | 3300025937 | Miscanthus Rhizosphere | ARLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG |
| Ga0207691_111866041 | 3300025940 | Miscanthus Rhizosphere | QEEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTAS |
| Ga0207667_112859572 | 3300025949 | Corn Rhizosphere | QDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSIFR |
| Ga0207651_102446201 | 3300025960 | Switchgrass Rhizosphere | LQDEHERGIANHRKLLWTLLMFELWHESFIETPRRIETSVTR |
| Ga0207640_103334542 | 3300025981 | Corn Rhizosphere | FVSRLQDEHERGIANHRKLLWTLLMFELWHESFIETPKRIETSVSQ |
| Ga0207640_106914192 | 3300025981 | Corn Rhizosphere | VSRLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK |
| Ga0207708_104398204 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ERGVANHRKLLWTLLSFELWRERFVETPRRIETSVSSV |
| Ga0207708_107642043 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GVANHRKLLWTLLSFELWRESFVETPKRIETSVSSV |
| Ga0207641_102151663 | 3300026088 | Switchgrass Rhizosphere | HERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREA |
| Ga0207648_106704771 | 3300026089 | Miscanthus Rhizosphere | DEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSVSA |
| Ga0207648_107370861 | 3300026089 | Miscanthus Rhizosphere | VANHRKLLWTLLMFELWHESFIETPRRIETSVASREG |
| Ga0207676_107128291 | 3300026095 | Switchgrass Rhizosphere | LQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVASREG |
| Ga0207676_122233121 | 3300026095 | Switchgrass Rhizosphere | EHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVSSV |
| Ga0207676_123333241 | 3300026095 | Switchgrass Rhizosphere | ANHRKLLWTLLMFELWHESFIETPRRIETSVASREG |
| Ga0207675_1006309292 | 3300026118 | Switchgrass Rhizosphere | DQHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG |
| Ga0207675_1026149201 | 3300026118 | Switchgrass Rhizosphere | RGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT |
| Ga0209131_10743331 | 3300026320 | Grasslands Soil | RLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTAR |
| Ga0209073_101059582 | 3300027765 | Agricultural Soil | ERGVANHRKLLWTLLSFELWRESFVETPRKIEASLTAQ |
| Ga0209283_101706342 | 3300027875 | Vadose Zone Soil | ARLQDEHERGVANHRKLLWTLLTFELWRESFVETPKRIETSVTASQQ |
| Ga0209590_101836141 | 3300027882 | Vadose Zone Soil | DEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVSSSK |
| Ga0209488_106262942 | 3300027903 | Vadose Zone Soil | ARLQDEHERGIANHRKLLWTLLTFELWRESFVETPRRIETSLSAT |
| Ga0073995_114082861 | 3300031047 | Soil | VANHRKLLWTLLSFELWRESFVETPRRIETSVAARQ |
| Ga0310813_113692771 | 3300031716 | Soil | DEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSR |
| Ga0307405_120206292 | 3300031731 | Rhizosphere | ARLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGT |
| Ga0307473_109951531 | 3300031820 | Hardwood Forest Soil | DEHERGAANHRKLLWTLLSFELWRESFVETPRRIETSVTARQ |
| Ga0307410_108254212 | 3300031852 | Rhizosphere | RLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGT |
| Ga0307409_1002355733 | 3300031995 | Rhizosphere | LQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGT |
| Ga0307414_104753022 | 3300032004 | Rhizosphere | HERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSR |
| Ga0310902_100617113 | 3300032012 | Soil | EHERGMANHRKLLWTLLMFELWHESFIETPRRIETSVRVR |
| Ga0310896_101363851 | 3300032211 | Soil | ERGVANHRKLLWTLLMFELWHESFIETPRRIETSVRVN |
| Ga0334909_026221_2_151 | 3300033988 | Soil | AYVARLQDEHERGQANPRKLLWTLLVFELWHESFVETPRRIEHSALSSQ |
| Ga0334923_059848_2_112 | 3300034376 | Hypolithic Biocrust | VANHRKLLWTLLMFELWYESFIATAQRIETSVSSSQ |
| Ga0373959_0040941_851_970 | 3300034820 | Rhizosphere Soil | RGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG |
| ⦗Top⦘ |