NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037801

Metagenome / Metatranscriptome Family F037801

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037801
Family Type Metagenome / Metatranscriptome
Number of Sequences 167
Average Sequence Length 41 residues
Representative Sequence HERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSR
Number of Associated Samples 136
Number of Associated Scaffolds 167

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.61 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.377 % of family members)
Environment Ontology (ENVO) Unclassified
(45.509 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.677 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.22%    β-sheet: 0.00%    Coil/Unstructured: 44.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 167 Family Scaffolds
PF00132Hexapep 2.99
PF04007DUF354 1.80
PF13243SQHop_cyclase_C 1.80
PF14602Hexapep_2 1.20
PF01408GFO_IDH_MocA 1.20
PF13727CoA_binding_3 0.60
PF01638HxlR 0.60
PF06161DUF975 0.60
PF13249SQHop_cyclase_N 0.60
PF00733Asn_synthase 0.60
PF12680SnoaL_2 0.60
PF04932Wzy_C 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 167 Family Scaffolds
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 1.80
COG1817Predicted glycosyltransferaseGeneral function prediction only [R] 1.80
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.60
COG3307O-antigen ligaseCell wall/membrane/envelope biogenesis [M] 0.60
COG5523Uncharacterized membrane proteinFunction unknown [S] 0.60

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_104621011All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300002407|C687J29651_10095600All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300002899|JGIcombinedJ43975_10023113All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300003322|rootL2_10096338All Organisms → cellular organisms → Bacteria3749Open in IMG/M
3300004643|Ga0062591_100116753All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300005166|Ga0066674_10258249All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300005172|Ga0066683_10669970All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005179|Ga0066684_11096226All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005289|Ga0065704_10197193All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300005293|Ga0065715_10969027All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005328|Ga0070676_10141062All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300005334|Ga0068869_100447318All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300005340|Ga0070689_100831640All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300005340|Ga0070689_102173112All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005343|Ga0070687_100220766All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300005343|Ga0070687_100284003All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300005345|Ga0070692_10289166All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005440|Ga0070705_100786435All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005451|Ga0066681_10493747All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005454|Ga0066687_10267963All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300005457|Ga0070662_101653010All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005544|Ga0070686_100289966All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300005545|Ga0070695_101821215All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005546|Ga0070696_100549396All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300005548|Ga0070665_101087530All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300005563|Ga0068855_100684195All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300005576|Ga0066708_10715471All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005577|Ga0068857_100764689All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300005587|Ga0066654_10800396All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005618|Ga0068864_100695822All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300005719|Ga0068861_101209297All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005841|Ga0068863_102462505All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005842|Ga0068858_101934516All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005843|Ga0068860_100469882All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300005843|Ga0068860_100589722All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300006196|Ga0075422_10048094All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300006755|Ga0079222_11757029All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300006755|Ga0079222_12189259All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006796|Ga0066665_10220183All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300006852|Ga0075433_10187172All Organisms → cellular organisms → Bacteria1842Open in IMG/M
3300006854|Ga0075425_100832917All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300007004|Ga0079218_13157596All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium556Open in IMG/M
3300007265|Ga0099794_10191361All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300009012|Ga0066710_104590704All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300009088|Ga0099830_11715058All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300009090|Ga0099827_11427081All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300009094|Ga0111539_11965428All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300009101|Ga0105247_10600781All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300009101|Ga0105247_11013248All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009101|Ga0105247_11037622All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300009101|Ga0105247_11401542All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300009147|Ga0114129_12613220All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300009148|Ga0105243_12889968All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300009174|Ga0105241_10493437All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300009174|Ga0105241_12703456All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009177|Ga0105248_10786176All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300010037|Ga0126304_11219063All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010040|Ga0126308_10675762All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300010042|Ga0126314_10275212All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300010045|Ga0126311_10007555All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes5914Open in IMG/M
3300010046|Ga0126384_10265488All Organisms → cellular organisms → Bacteria → Acidobacteria1395Open in IMG/M
3300010046|Ga0126384_10547528All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300010359|Ga0126376_10000048All Organisms → cellular organisms → Bacteria46022Open in IMG/M
3300010359|Ga0126376_10152379All Organisms → cellular organisms → Bacteria1854Open in IMG/M
3300010361|Ga0126378_11237612All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium843Open in IMG/M
3300010398|Ga0126383_11264541All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300010398|Ga0126383_12751486All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300010399|Ga0134127_11149927All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300010399|Ga0134127_13002493All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300010400|Ga0134122_12286165All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300010401|Ga0134121_12274286All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300010401|Ga0134121_12572419All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300010403|Ga0134123_11967843All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300011119|Ga0105246_11873953All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300011433|Ga0137443_1170806All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300012045|Ga0136623_10103687All Organisms → cellular organisms → Bacteria → Acidobacteria1241Open in IMG/M
3300012093|Ga0136632_10067102All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300012096|Ga0137389_11481346All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300012198|Ga0137364_10401245All Organisms → cellular organisms → Bacteria → Acidobacteria1026Open in IMG/M
3300012198|Ga0137364_11033092All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300012198|Ga0137364_11166011All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012204|Ga0137374_11045230All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium586Open in IMG/M
3300012206|Ga0137380_10770607All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300012354|Ga0137366_10453263All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300012363|Ga0137390_11678282All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300012671|Ga0137318_1027115All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300012885|Ga0157287_1043492All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300012905|Ga0157296_10243140All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012922|Ga0137394_11443340All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300012923|Ga0137359_11578349All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300012929|Ga0137404_11086407All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300012930|Ga0137407_11555329All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300012944|Ga0137410_10097960All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2170Open in IMG/M
3300012955|Ga0164298_11653106All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300012960|Ga0164301_10226651All Organisms → cellular organisms → Bacteria → Acidobacteria1211Open in IMG/M
3300012989|Ga0164305_11616169All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300013297|Ga0157378_10577445All Organisms → cellular organisms → Bacteria → Acidobacteria1133Open in IMG/M
3300013297|Ga0157378_11810074All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium659Open in IMG/M
3300014326|Ga0157380_12256897All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300014488|Ga0182001_10499213All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300014745|Ga0157377_10029180All Organisms → cellular organisms → Bacteria2976Open in IMG/M
3300015371|Ga0132258_10048131All Organisms → cellular organisms → Bacteria9734Open in IMG/M
3300015373|Ga0132257_100180545All Organisms → cellular organisms → Bacteria2490Open in IMG/M
3300015373|Ga0132257_100886729All Organisms → cellular organisms → Bacteria → Acidobacteria1117Open in IMG/M
3300015373|Ga0132257_103037866All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300015373|Ga0132257_104550549All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300015374|Ga0132255_100861659All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300015374|Ga0132255_102320228All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium819Open in IMG/M
3300015374|Ga0132255_103616039All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300017789|Ga0136617_10699459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium787Open in IMG/M
3300017947|Ga0187785_10589978All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300018056|Ga0184623_10151248All Organisms → cellular organisms → Bacteria → Acidobacteria1073Open in IMG/M
3300018075|Ga0184632_10390015All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300018429|Ga0190272_10081583All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2005Open in IMG/M
3300018429|Ga0190272_11515528All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300018482|Ga0066669_10585754All Organisms → cellular organisms → Bacteria → Acidobacteria976Open in IMG/M
3300018920|Ga0190273_11675319All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300021081|Ga0210379_10441795All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300021445|Ga0182009_10434789All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300025907|Ga0207645_10147009All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300025910|Ga0207684_10684866All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300025910|Ga0207684_10706323All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300025911|Ga0207654_10642031All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300025913|Ga0207695_11422953All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300025918|Ga0207662_10139807All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300025920|Ga0207649_10587053All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300025925|Ga0207650_11110070All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300025926|Ga0207659_10648142All Organisms → cellular organisms → Bacteria → Acidobacteria902Open in IMG/M
3300025926|Ga0207659_10649111All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300025930|Ga0207701_10063872All Organisms → cellular organisms → Bacteria3355Open in IMG/M
3300025932|Ga0207690_10637978All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300025935|Ga0207709_11515455All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300025936|Ga0207670_10699321All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300025936|Ga0207670_11637190All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300025937|Ga0207669_11864522All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300025940|Ga0207691_11186604All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300025949|Ga0207667_11285957All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300025960|Ga0207651_10244620All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300025981|Ga0207640_10333454All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300025981|Ga0207640_10691419All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300026075|Ga0207708_10439820All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1084Open in IMG/M
3300026075|Ga0207708_10764204All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium830Open in IMG/M
3300026088|Ga0207641_10215166All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300026089|Ga0207648_10670477All Organisms → cellular organisms → Bacteria → Acidobacteria959Open in IMG/M
3300026089|Ga0207648_10737086All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300026095|Ga0207676_10712829All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300026095|Ga0207676_12223312All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300026095|Ga0207676_12333324All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300026118|Ga0207675_100630929All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300026118|Ga0207675_102614920All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300026320|Ga0209131_1074333All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300027765|Ga0209073_10105958All Organisms → cellular organisms → Bacteria → Acidobacteria998Open in IMG/M
3300027875|Ga0209283_10170634All Organisms → cellular organisms → Bacteria → Acidobacteria1444Open in IMG/M
3300027882|Ga0209590_10183614All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300027903|Ga0209488_10626294All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300031047|Ga0073995_11408286All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300031716|Ga0310813_11369277All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300031731|Ga0307405_12020629All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031820|Ga0307473_10995153All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300031852|Ga0307410_10825421All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300031995|Ga0307409_100235573All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300032004|Ga0307414_10475302All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300032012|Ga0310902_10061711All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300032211|Ga0310896_10136385All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300033988|Ga0334909_026221All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300034376|Ga0334923_059848All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300034820|Ga0373959_0040941All Organisms → cellular organisms → Bacteria972Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.39%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.59%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.40%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.40%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.99%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.99%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.80%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.20%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.20%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.60%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.60%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.60%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.60%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012671Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300031047Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033988Soil microbial communities from Mojave Desert, California, United States - 5NOCEnvironmentalOpen in IMG/M
3300034376Biocrust microbial communities from Mojave Desert, California, United States - 19HNCEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10462101123300000956SoilERGIANHRKLLWTLLMFELWHESFVETPRRIETSVESR*
C687J29651_1009560023300002407SoilQDEHETGVANHRKLLWTLLMFELWHESFIETARRIEDSVGTRQ*
JGIcombinedJ43975_1002311313300002899SoilITRLQDEHERGIANHSKLLWTLLMFELWHESFIETARRIETSVSSGQ*
rootL2_1009633853300003322Sugarcane Root And Bulk SoilQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETLVSSR*
Ga0062591_10011675313300004643SoilEYVAKLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVNA*
Ga0066674_1025824923300005166SoilQGEHERGIANHRKLLWTLLSFELWRESFVETPRRIETSVNAR*
Ga0066683_1066997023300005172SoilEHERGVANHRKLLWTLLTFELWHESFVETPRLIETSVTSRQ*
Ga0066684_1109622613300005179SoilQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSLTAQ*
Ga0065704_1019719323300005289Switchgrass RhizosphereQERGVANHRKLLWTLLMFELWHESFIETPRRIETSVRAT*
Ga0065715_1096902723300005293Miscanthus RhizosphereAYVTKLQDEHERGIANHRKLLWTLLMFELWHESFIETPRRIETSVTSK*
Ga0070676_1014106223300005328Miscanthus RhizosphereRLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK*
Ga0068869_10044731823300005334Miscanthus RhizosphereAFVSRLQDEHERGIANHRKLLWTLLMFELWHESFIETPKRIETSVSQ*
Ga0070689_10083164013300005340Switchgrass RhizosphereARLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG*
Ga0070689_10217311223300005340Switchgrass RhizosphereEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGDRIT*
Ga0070687_10022076623300005343Switchgrass RhizosphereAKLQDEHERGIANHRKLLWTLLSFELWRESFVETPRRIETSVNA*
Ga0070687_10028400313300005343Switchgrass RhizosphereARLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTTI*
Ga0070692_1028916623300005345Corn, Switchgrass And Miscanthus RhizosphereVSRLQDEHERGIANHRKLLWTLLMFELWHESFIETPKRIETSVSQ*
Ga0070705_10078643523300005440Corn, Switchgrass And Miscanthus RhizosphereDEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSVSSV*
Ga0066681_1049374713300005451SoilLQDEHERGVANHRKLLWTLLMFELWHESFIETARRIETSVSSRQ*
Ga0066687_1026796333300005454SoilLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSLSSV*
Ga0070662_10165301023300005457Corn RhizosphereQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETLVNSR*
Ga0070686_10028996613300005544Switchgrass RhizosphereHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTTI*
Ga0070695_10182121513300005545Corn, Switchgrass And Miscanthus RhizosphereHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT*
Ga0070696_10054939613300005546Corn, Switchgrass And Miscanthus RhizosphereERGVANHRKLLWTLLSFELWRESFVETPRRIETSLTAQS*
Ga0070665_10108753023300005548Switchgrass RhizosphereQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK*
Ga0068855_10068419513300005563Corn RhizosphereQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSIFR*
Ga0066708_1071547123300005576SoilRGVANHRKLLWTLLSFELWRESFVETPKRIETSVSA*
Ga0068857_10076468923300005577Corn RhizosphereLQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSIAT*
Ga0066654_1080039613300005587SoilLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSLTAQ*
Ga0068864_10069582233300005618Switchgrass RhizosphereHERGIANHRKLLWTLLSFELWRESFVETPRRIETSVNA*
Ga0068861_10120929713300005719Switchgrass RhizosphereARLQDEHERGVANHRKLLWTVLMFELWHESFIETPRRIETSVASREG*
Ga0068863_10246250513300005841Switchgrass RhizosphereLQDEHERGVANHRKLLWTLLMFELWHESFVETPKRIETSVGSR*
Ga0068858_10193451623300005842Switchgrass RhizosphereHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG*
Ga0068860_10046988223300005843Switchgrass RhizosphereANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT*
Ga0068860_10058972213300005843Switchgrass RhizosphereQDEHERGVANHRKLLWTLLSFELWRESFIETPRRIETSLTAG*
Ga0075422_1004809413300006196Populus RhizosphereVANHRKLLWTLLMFELWHESFIETPRRIETSVASREG*
Ga0079222_1175702913300006755Agricultural SoilNHRKLLWTLLMFELWHESFIETPRRIETSVASREG*
Ga0079222_1218925923300006755Agricultural SoilRGVANHRKLLWTLLTFELWRESFVETPRRIETSVSAG*
Ga0066665_1022018313300006796SoilERGLANNRKLLWTLLSFELWRESFVETPRRIETSVSAT*
Ga0075433_1018717233300006852Populus RhizosphereVANHRKLLWTLLSFELWRESFIETPRRIETSLTAQ*
Ga0075425_10083291723300006854Populus RhizosphereEHERGIANHRKLLWTLLMFELWHESFIETPRRIETSVNS*
Ga0079218_1315759623300007004Agricultural SoilVANHRKLLWTLLSFELWRESFVETPRRIETSVSAV*
Ga0099794_1019136113300007265Vadose Zone SoilQDEHERGVANHRKLLWTLLMFELWHESFIETARRIETSVGSRQ*
Ga0066710_10459070413300009012Grasslands SoilLDEHESGVANHRKLLWTLLSFELWRESFIETPRRIETSVSAT
Ga0099830_1171505823300009088Vadose Zone SoilRLQDEHERGVANHRKLLWTLLTFELWRESFVETPRRIETSVSAT*
Ga0099827_1142708123300009090Vadose Zone SoilTKLQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVSSSK*
Ga0111539_1196542823300009094Populus RhizosphereERGVANHRKLLWTLLMFELWHESFIETPRRIETSVRAT*
Ga0105247_1060078123300009101Switchgrass RhizosphereQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG*
Ga0105247_1101324813300009101Switchgrass RhizosphereNHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT*
Ga0105247_1103762213300009101Switchgrass RhizosphereVANHRKLLWTLLMFELWHESFVETPRRIETSVGDRMM*
Ga0105247_1140154223300009101Switchgrass RhizosphereQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVASRR*
Ga0114129_1261322013300009147Populus RhizosphereKLQDEHERGIANHRKLLWTLLSFELWRESFVETPRRIETSLTAQ*
Ga0105243_1288996813300009148Miscanthus RhizosphereRGVANHRKLLWTLLSFELWRESFVETPKRIETSVGSAQ*
Ga0105241_1049343713300009174Corn RhizosphereHERGIANHRKLLWTLLMFELWHESFIETPRRIETSVNS*
Ga0105241_1270345623300009174Corn RhizosphereQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG*
Ga0105248_1078617613300009177Switchgrass RhizosphereRLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT*
Ga0126304_1121906323300010037Serpentine SoilERGVANHRKLLWTLLMFELWHESFVETPRRIETVESKL*
Ga0126308_1067576223300010040Serpentine SoilDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVVN*
Ga0126314_1027521223300010042Serpentine SoilEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT*
Ga0126311_1000755573300010045Serpentine SoilANHRKLLWTLLMFELCHESFVEAPRRIETSVGSR*
Ga0126384_1026548833300010046Tropical Forest SoilEYVAKLQDEHERGIANHRKLLWTLLSFELWRESFVETPRRIEASLSV*
Ga0126384_1054752813300010046Tropical Forest SoilLQNEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVSG*
Ga0126376_10000048433300010359Tropical Forest SoilLQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG*
Ga0126376_1015237933300010359Tropical Forest SoilQDEHERGIANHRKLLWTLLMSELWHESFIETPKRIETSVNS*
Ga0126378_1123761213300010361Tropical Forest SoilAHERGIANHRKLLWTLLSFELWRESFVETPRRIETSMHV*
Ga0126383_1126454113300010398Tropical Forest SoilYVSRLQDEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSMTA*
Ga0126383_1275148613300010398Tropical Forest SoilVANHRKLLWTLLSFELWHESFVETPKRIETSLTA*
Ga0134127_1114992713300010399Terrestrial SoilDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSILR*
Ga0134127_1300249313300010399Terrestrial SoilDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTTI*
Ga0134122_1228616513300010400Terrestrial SoilEHERGVANHRKLLWTLLMFELWHESFVETRRRIETSVGSREG*
Ga0134121_1227428613300010401Terrestrial SoilVAKLQDEHERGIANHRKLLWTLLSFELWRESFVATPKRIESSISA*
Ga0134121_1257241923300010401Terrestrial SoilGVANHRKLLWTLLMFELWHESFVETPRRIETSVGDRIT*
Ga0134123_1196784313300010403Terrestrial SoilHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVSSV*
Ga0105246_1187395313300011119Miscanthus RhizosphereERGIANHRKLLWTLLMFELWHESFIETPRRIETSVTSK*
Ga0137443_117080623300011433SoilANHRKLLWTLLSFELWRESFVETPRRIETSVTARQ*
Ga0136623_1010368713300012045Polar Desert SandLQDEHERGVANHRKLLWTLLMFELWHESFIETPRLIQTSVGSRQ*
Ga0136632_1006710223300012093Polar Desert SandQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVGSSKQ*
Ga0137389_1148134613300012096Vadose Zone SoilNHRKLLWTLLSFELWRESFVETPRRIETSVTAGR*
Ga0137364_1040124523300012198Vadose Zone SoilDEHERGIANHRKLLWTLLTFELWRESFVETPRRIETSVTAN*
Ga0137364_1103309213300012198Vadose Zone SoilHERGVANHRKLLWTLLMFELWHESFIETARRIETSVSSRQ*
Ga0137364_1116601123300012198Vadose Zone SoilHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVSSRQ*
Ga0137374_1104523023300012204Vadose Zone SoilVAKLQDEHERGIANHRKLLWTLLSFELWRESFVETPRRIETSVSSV*
Ga0137380_1077060713300012206Vadose Zone SoilVAKLQDEHERGIANHCKLLWTLLSFELWRESFVETPKRIETSVTAS*
Ga0137366_1045326323300012354Vadose Zone SoilVTKLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVGSEQ*
Ga0137390_1167828223300012363Vadose Zone SoilRLQDEHERGIANHRKLLWTLLTFELWHESFVETPRRIETSVGATLGSED*
Ga0137318_102711513300012671SoilDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTAGQ*
Ga0157287_104349213300012885SoilDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK*
Ga0157296_1024314013300012905SoilQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVSR*
Ga0137394_1144334023300012922Vadose Zone SoilFNPEYVARLQDEHERGVANHRTLVWTLLTFELCREGFLETPRRIETSVNAT*
Ga0137359_1157834913300012923Vadose Zone SoilNHRKLLWTLLSFELWRESFVETPKRIETSVGASQ*
Ga0137404_1108640713300012929Vadose Zone SoilLQDEHERGVANHRKLLWTLLMFELWHESFIETPKRIETSVISSQE*
Ga0137407_1155532913300012930Vadose Zone SoilGVANHRKLLWTLLTFELWRESFVETPRRIETSVSSA*
Ga0137410_1009796033300012944Vadose Zone SoilYVTRLQDEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSVGASQ*
Ga0164298_1165310613300012955SoilVANHRKLLWTLLSFELWRESFVETPRRIETSVGAPH*
Ga0164301_1022665123300012960SoilKLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVSSRQ*
Ga0164305_1161616923300012989SoilGIANHRKLLWTLLSFELWRESFVETPRKIEASLRV*
Ga0157378_1057744523300013297Miscanthus RhizosphereQEEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSVSTI*
Ga0157378_1181007413300013297Miscanthus RhizosphereLQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETS
Ga0157380_1225689713300014326Switchgrass RhizosphereDEHERGIANHRKLLWTLLMFELWHESFIETPKRIETSVSQ*
Ga0182001_1049921323300014488SoilVANHRKLLWTLLMFELWHESFVETPRRIETSVASR*
Ga0157377_1002918013300014745Miscanthus RhizosphereERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK*
Ga0132258_1004813113300015371Arabidopsis RhizosphereHEHEQGVANHRKLLWTLLMFELWHESFIETPRRIETSVNS*
Ga0132257_10018054553300015373Arabidopsis RhizosphereERGVANHRKLLWTLLSFELWRESFVETPRKIEASLTAQ*
Ga0132257_10088672923300015373Arabidopsis RhizosphereKLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSLTAQ*
Ga0132257_10303786613300015373Arabidopsis RhizosphereGVANHRKLLWTLLMFELWHESFVETPRRIETSVGST*
Ga0132257_10455054923300015373Arabidopsis RhizosphereEHERGVANHRKLLWTLLMFELWHESFIETPKRIETSVNS*
Ga0132255_10086165923300015374Arabidopsis RhizosphereLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTMT*
Ga0132255_10232022813300015374Arabidopsis RhizosphereERGVANHRKLLWTLLSFELWRESFVETPKRIETSVSSV*
Ga0132255_10361603923300015374Arabidopsis RhizosphereGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK*
Ga0136617_1069945913300017789Polar Desert SandQDEHERGHANHRKLLWTLLVFELWHESFIETPRRIEQSVSSRS
Ga0187785_1058997813300017947Tropical PeatlandLDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVGAI
Ga0184623_1015124813300018056Groundwater SedimentKLQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVSK
Ga0184632_1039001513300018075Groundwater SedimentQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTSKQ
Ga0190272_1008158313300018429SoilHERGVANHRKLLWTLLMFELWHESFIETARRIETSVVSGQ
Ga0190272_1151552813300018429SoilRLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVSSRQ
Ga0066669_1058575413300018482Grasslands SoilQDEHERGVANHRKLLWTLLMFELWHESFIETPKRIETSVGSKQ
Ga0190273_1167531913300018920SoilANHRKLLWTLLMFELWYESFIATPHRIETSVSSSRQ
Ga0210379_1044179513300021081Groundwater SedimentVTKLQDEHERGVANHRKLLWTLLMFELWQESFIETPRRIETSVGSRR
Ga0182009_1043478923300021445SoilEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSR
Ga0207645_1014700913300025907Miscanthus RhizosphereRGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK
Ga0207684_1068486623300025910Corn, Switchgrass And Miscanthus RhizosphereGVANHRKLLWTLLSFELWRESFVETPKRIETSVGAAQ
Ga0207684_1070632323300025910Corn, Switchgrass And Miscanthus RhizosphereGVANHRKPLWTLLMFELWHESFIETARRIETSVTSKQ
Ga0207654_1064203113300025911Corn RhizosphereDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG
Ga0207695_1142295313300025913Corn RhizosphereARLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT
Ga0207662_1013980713300025918Switchgrass RhizosphereRGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSR
Ga0207649_1058705323300025920Corn RhizosphereGVANHRKLLWTLLMFELWHESFVETPRRIETSVSK
Ga0207650_1111007013300025925Switchgrass RhizosphereRLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVASREG
Ga0207659_1064814223300025926Miscanthus RhizosphereAKLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVNA
Ga0207659_1064911123300025926Miscanthus RhizosphereDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETLVNSR
Ga0207701_1006387213300025930Corn, Switchgrass And Miscanthus RhizosphereERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK
Ga0207690_1063797823300025932Corn RhizosphereDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSILR
Ga0207709_1151545513300025935Miscanthus RhizosphereAYVAKLQDEHERGIANHRKLLWTLLSFELWRESFVETPKRIETSISA
Ga0207670_1069932123300025936Switchgrass RhizosphereEHERGVANHRKLLWTLLMFELWHESFVETPKRIETSVGSR
Ga0207670_1163719023300025936Switchgrass RhizosphereRGVANHRKLLWTLLMFELWHESFIETPRRIETSVASREG
Ga0207669_1186452223300025937Miscanthus RhizosphereARLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG
Ga0207691_1118660413300025940Miscanthus RhizosphereQEEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTAS
Ga0207667_1128595723300025949Corn RhizosphereQDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSIFR
Ga0207651_1024462013300025960Switchgrass RhizosphereLQDEHERGIANHRKLLWTLLMFELWHESFIETPRRIETSVTR
Ga0207640_1033345423300025981Corn RhizosphereFVSRLQDEHERGIANHRKLLWTLLMFELWHESFIETPKRIETSVSQ
Ga0207640_1069141923300025981Corn RhizosphereVSRLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVTK
Ga0207708_1043982043300026075Corn, Switchgrass And Miscanthus RhizosphereERGVANHRKLLWTLLSFELWRERFVETPRRIETSVSSV
Ga0207708_1076420433300026075Corn, Switchgrass And Miscanthus RhizosphereGVANHRKLLWTLLSFELWRESFVETPKRIETSVSSV
Ga0207641_1021516633300026088Switchgrass RhizosphereHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREA
Ga0207648_1067047713300026089Miscanthus RhizosphereDEHERGVANHRKLLWTLLSFELWRESFVETPKRIETSVSA
Ga0207648_1073708613300026089Miscanthus RhizosphereVANHRKLLWTLLMFELWHESFIETPRRIETSVASREG
Ga0207676_1071282913300026095Switchgrass RhizosphereLQDEHERGVANHRKLLWTLLMFELWHESFIETPRRIETSVASREG
Ga0207676_1222331213300026095Switchgrass RhizosphereEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVSSV
Ga0207676_1233332413300026095Switchgrass RhizosphereANHRKLLWTLLMFELWHESFIETPRRIETSVASREG
Ga0207675_10063092923300026118Switchgrass RhizosphereDQHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG
Ga0207675_10261492013300026118Switchgrass RhizosphereRGIANHRKLLWTLLMFELWHESFVETPRRIETSVSDRIT
Ga0209131_107433313300026320Grasslands SoilRLQDEHERGVANHRKLLWTLLSFELWRESFVETPRRIETSVTAR
Ga0209073_1010595823300027765Agricultural SoilERGVANHRKLLWTLLSFELWRESFVETPRKIEASLTAQ
Ga0209283_1017063423300027875Vadose Zone SoilARLQDEHERGVANHRKLLWTLLTFELWRESFVETPKRIETSVTASQQ
Ga0209590_1018361413300027882Vadose Zone SoilDEHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVSSSK
Ga0209488_1062629423300027903Vadose Zone SoilARLQDEHERGIANHRKLLWTLLTFELWRESFVETPRRIETSLSAT
Ga0073995_1140828613300031047SoilVANHRKLLWTLLSFELWRESFVETPRRIETSVAARQ
Ga0310813_1136927713300031716SoilDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGSR
Ga0307405_1202062923300031731RhizosphereARLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGT
Ga0307473_1099515313300031820Hardwood Forest SoilDEHERGAANHRKLLWTLLSFELWRESFVETPRRIETSVTARQ
Ga0307410_1082542123300031852RhizosphereRLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGT
Ga0307409_10023557333300031995RhizosphereLQDEHERGIANHRKLLWTLLMFELWHESFVETPRRIETSVGT
Ga0307414_1047530223300032004RhizosphereHERGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSR
Ga0310902_1006171133300032012SoilEHERGMANHRKLLWTLLMFELWHESFIETPRRIETSVRVR
Ga0310896_1013638513300032211SoilERGVANHRKLLWTLLMFELWHESFIETPRRIETSVRVN
Ga0334909_026221_2_1513300033988SoilAYVARLQDEHERGQANPRKLLWTLLVFELWHESFVETPRRIEHSALSSQ
Ga0334923_059848_2_1123300034376Hypolithic BiocrustVANHRKLLWTLLMFELWYESFIATAQRIETSVSSSQ
Ga0373959_0040941_851_9703300034820Rhizosphere SoilRGVANHRKLLWTLLMFELWHESFVETPRRIETSVGSREG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.