| Basic Information | |
|---|---|
| Family ID | F037790 |
| Family Type | Metagenome |
| Number of Sequences | 167 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVCGKA |
| Number of Associated Samples | 35 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.07 % |
| % of genes near scaffold ends (potentially truncated) | 33.53 % |
| % of genes from short scaffolds (< 2000 bps) | 75.45 % |
| Associated GOLD sequencing projects | 29 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.653 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (56.886 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.485 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (56.886 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF01019 | G_glu_transpept | 6.06 |
| PF11741 | AMIN | 4.24 |
| PF00873 | ACR_tran | 3.03 |
| PF10370 | DUF2437 | 3.03 |
| PF07228 | SpoIIE | 2.42 |
| PF13692 | Glyco_trans_1_4 | 2.42 |
| PF00881 | Nitroreductase | 2.42 |
| PF01261 | AP_endonuc_2 | 1.82 |
| PF13378 | MR_MLE_C | 1.82 |
| PF03577 | Peptidase_C69 | 1.82 |
| PF03150 | CCP_MauG | 1.82 |
| PF10415 | FumaraseC_C | 1.82 |
| PF01850 | PIN | 1.21 |
| PF01791 | DeoC | 1.21 |
| PF11954 | DUF3471 | 1.21 |
| PF00263 | Secretin | 1.21 |
| PF12704 | MacB_PCD | 1.21 |
| PF01408 | GFO_IDH_MocA | 1.21 |
| PF12146 | Hydrolase_4 | 1.21 |
| PF00266 | Aminotran_5 | 1.21 |
| PF02371 | Transposase_20 | 1.21 |
| PF02614 | UxaC | 1.21 |
| PF13493 | DUF4118 | 1.21 |
| PF14102 | Caps_synth_CapC | 1.21 |
| PF07929 | PRiA4_ORF3 | 1.21 |
| PF08447 | PAS_3 | 0.61 |
| PF13528 | Glyco_trans_1_3 | 0.61 |
| PF01061 | ABC2_membrane | 0.61 |
| PF01894 | UPF0047 | 0.61 |
| PF03741 | TerC | 0.61 |
| PF14602 | Hexapep_2 | 0.61 |
| PF05580 | Peptidase_S55 | 0.61 |
| PF02786 | CPSase_L_D2 | 0.61 |
| PF14524 | Wzt_C | 0.61 |
| PF08240 | ADH_N | 0.61 |
| PF01432 | Peptidase_M3 | 0.61 |
| PF13537 | GATase_7 | 0.61 |
| PF04143 | Sulf_transp | 0.61 |
| PF08245 | Mur_ligase_M | 0.61 |
| PF13810 | DUF4185 | 0.61 |
| PF07969 | Amidohydro_3 | 0.61 |
| PF13522 | GATase_6 | 0.61 |
| PF00589 | Phage_integrase | 0.61 |
| PF00924 | MS_channel | 0.61 |
| PF00230 | MIP | 0.61 |
| PF03737 | RraA-like | 0.61 |
| PF11175 | DUF2961 | 0.61 |
| PF12794 | MscS_TM | 0.61 |
| PF16576 | HlyD_D23 | 0.61 |
| PF00578 | AhpC-TSA | 0.61 |
| PF01569 | PAP2 | 0.61 |
| PF03551 | PadR | 0.61 |
| PF05193 | Peptidase_M16_C | 0.61 |
| PF00756 | Esterase | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 6.06 |
| COG4690 | Dipeptidase | Amino acid transport and metabolism [E] | 1.82 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG1904 | Glucuronate isomerase | Carbohydrate transport and metabolism [G] | 1.21 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.21 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.61 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.61 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.61 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.61 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.61 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.61 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.61 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.61 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.65 % |
| Unclassified | root | N/A | 26.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004022|Ga0055432_10209536 | Not Available | 563 | Open in IMG/M |
| 3300005204|Ga0068997_10139772 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006224|Ga0079037_100138240 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300006224|Ga0079037_100160736 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300006224|Ga0079037_100168721 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300006224|Ga0079037_100169165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 1933 | Open in IMG/M |
| 3300006224|Ga0079037_100169643 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300006224|Ga0079037_100219941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1718 | Open in IMG/M |
| 3300006224|Ga0079037_100521793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300006224|Ga0079037_100521793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300006224|Ga0079037_100784559 | Not Available | 935 | Open in IMG/M |
| 3300006224|Ga0079037_101097156 | Not Available | 789 | Open in IMG/M |
| 3300006224|Ga0079037_101610440 | Not Available | 648 | Open in IMG/M |
| 3300006224|Ga0079037_101921240 | Not Available | 591 | Open in IMG/M |
| 3300009091|Ga0102851_10059493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3119 | Open in IMG/M |
| 3300009091|Ga0102851_10060316 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
| 3300009091|Ga0102851_10134795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2216 | Open in IMG/M |
| 3300009091|Ga0102851_10540821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
| 3300009091|Ga0102851_10870448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300009091|Ga0102851_10962949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300009091|Ga0102851_10966571 | Not Available | 924 | Open in IMG/M |
| 3300009091|Ga0102851_11342214 | Not Available | 792 | Open in IMG/M |
| 3300009091|Ga0102851_11489749 | Not Available | 754 | Open in IMG/M |
| 3300009091|Ga0102851_11761257 | Not Available | 697 | Open in IMG/M |
| 3300009091|Ga0102851_12961243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300009091|Ga0102851_13401282 | Not Available | 511 | Open in IMG/M |
| 3300009111|Ga0115026_10015288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 3568 | Open in IMG/M |
| 3300009111|Ga0115026_10016664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3462 | Open in IMG/M |
| 3300009111|Ga0115026_10028388 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
| 3300009111|Ga0115026_10088744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1850 | Open in IMG/M |
| 3300009111|Ga0115026_10199066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1335 | Open in IMG/M |
| 3300009111|Ga0115026_10239277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1237 | Open in IMG/M |
| 3300009111|Ga0115026_10480903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300009131|Ga0115027_10003333 | All Organisms → cellular organisms → Bacteria | 4836 | Open in IMG/M |
| 3300009131|Ga0115027_10012879 | All Organisms → cellular organisms → Bacteria | 3305 | Open in IMG/M |
| 3300009131|Ga0115027_10048985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2155 | Open in IMG/M |
| 3300009131|Ga0115027_11513405 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300009167|Ga0113563_10052437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3455 | Open in IMG/M |
| 3300009167|Ga0113563_10084792 | All Organisms → cellular organisms → Bacteria | 2841 | Open in IMG/M |
| 3300009167|Ga0113563_10117078 | All Organisms → cellular organisms → Bacteria | 2488 | Open in IMG/M |
| 3300009167|Ga0113563_10121595 | All Organisms → cellular organisms → Bacteria → PVC group | 2449 | Open in IMG/M |
| 3300009167|Ga0113563_10247793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1810 | Open in IMG/M |
| 3300009167|Ga0113563_10431291 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300009167|Ga0113563_10579753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1239 | Open in IMG/M |
| 3300009167|Ga0113563_11166716 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300009167|Ga0113563_11914300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella lansingensis | 707 | Open in IMG/M |
| 3300009167|Ga0113563_11917820 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300009167|Ga0113563_13293915 | Not Available | 547 | Open in IMG/M |
| 3300009179|Ga0115028_10004626 | All Organisms → cellular organisms → Bacteria | 4422 | Open in IMG/M |
| 3300009179|Ga0115028_10005700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4171 | Open in IMG/M |
| 3300009179|Ga0115028_10006188 | All Organisms → cellular organisms → Bacteria | 4073 | Open in IMG/M |
| 3300009179|Ga0115028_10197134 | Not Available | 1270 | Open in IMG/M |
| 3300009179|Ga0115028_10197435 | Not Available | 1269 | Open in IMG/M |
| 3300009179|Ga0115028_10406567 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300009179|Ga0115028_10919133 | Not Available | 694 | Open in IMG/M |
| 3300012931|Ga0153915_11873410 | Not Available | 702 | Open in IMG/M |
| 3300014324|Ga0075352_1192766 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 598 | Open in IMG/M |
| 3300024056|Ga0124853_1031547 | Not Available | 1054 | Open in IMG/M |
| 3300024056|Ga0124853_1063233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300024056|Ga0124853_1185125 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300024056|Ga0124853_1328932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2065 | Open in IMG/M |
| 3300024056|Ga0124853_1452994 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300025955|Ga0210071_1043671 | Not Available | 572 | Open in IMG/M |
| 3300027715|Ga0208665_10057562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cronobacter → Cronobacter sakazakii → Cronobacter sakazakii 701 | 1145 | Open in IMG/M |
| 3300027871|Ga0209397_10060054 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300027871|Ga0209397_10547856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 577 | Open in IMG/M |
| 3300027877|Ga0209293_10049614 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300027890|Ga0209496_10003571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 3406 | Open in IMG/M |
| 3300027890|Ga0209496_10041289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1684 | Open in IMG/M |
| 3300027890|Ga0209496_10101549 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300027890|Ga0209496_10111691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
| 3300027890|Ga0209496_10633320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300033406|Ga0316604_10017152 | All Organisms → cellular organisms → Bacteria | 3833 | Open in IMG/M |
| 3300033406|Ga0316604_10019727 | All Organisms → cellular organisms → Bacteria | 3534 | Open in IMG/M |
| 3300033406|Ga0316604_10021536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3361 | Open in IMG/M |
| 3300033406|Ga0316604_10021536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3361 | Open in IMG/M |
| 3300033406|Ga0316604_10039305 | All Organisms → cellular organisms → Bacteria | 2431 | Open in IMG/M |
| 3300033406|Ga0316604_10247994 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300033406|Ga0316604_10602583 | Not Available | 604 | Open in IMG/M |
| 3300033406|Ga0316604_10721812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300033406|Ga0316604_10749319 | Not Available | 536 | Open in IMG/M |
| 3300033408|Ga0316605_10064597 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300033408|Ga0316605_10076476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2490 | Open in IMG/M |
| 3300033408|Ga0316605_10120919 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300033408|Ga0316605_10316198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 1376 | Open in IMG/M |
| 3300033408|Ga0316605_10324598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
| 3300033408|Ga0316605_10344798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1325 | Open in IMG/M |
| 3300033408|Ga0316605_10358235 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300033408|Ga0316605_10663383 | Not Available | 980 | Open in IMG/M |
| 3300033408|Ga0316605_10674905 | Not Available | 972 | Open in IMG/M |
| 3300033408|Ga0316605_11041815 | Not Available | 786 | Open in IMG/M |
| 3300033408|Ga0316605_11046969 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300033408|Ga0316605_11275510 | Not Available | 710 | Open in IMG/M |
| 3300033408|Ga0316605_12162128 | Not Available | 541 | Open in IMG/M |
| 3300033413|Ga0316603_10016737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4711 | Open in IMG/M |
| 3300033413|Ga0316603_10025281 | All Organisms → cellular organisms → Bacteria | 3995 | Open in IMG/M |
| 3300033413|Ga0316603_10028652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3805 | Open in IMG/M |
| 3300033413|Ga0316603_10186811 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 1752 | Open in IMG/M |
| 3300033413|Ga0316603_10451678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
| 3300033413|Ga0316603_10798590 | Not Available | 886 | Open in IMG/M |
| 3300033413|Ga0316603_10852006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300033413|Ga0316603_11324734 | Not Available | 682 | Open in IMG/M |
| 3300033414|Ga0316619_10084803 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1964 | Open in IMG/M |
| 3300033414|Ga0316619_10378369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300033414|Ga0316619_11045453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300033414|Ga0316619_11873589 | Not Available | 544 | Open in IMG/M |
| 3300033416|Ga0316622_100055518 | All Organisms → cellular organisms → Bacteria | 3749 | Open in IMG/M |
| 3300033416|Ga0316622_100455576 | Not Available | 1449 | Open in IMG/M |
| 3300033416|Ga0316622_100543446 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300033416|Ga0316622_101241341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300033416|Ga0316622_101311303 | Not Available | 846 | Open in IMG/M |
| 3300033418|Ga0316625_100018456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2714 | Open in IMG/M |
| 3300033418|Ga0316625_100048736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2035 | Open in IMG/M |
| 3300033418|Ga0316625_100609509 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300033419|Ga0316601_100242517 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300033419|Ga0316601_100288499 | Not Available | 1495 | Open in IMG/M |
| 3300033419|Ga0316601_100359982 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300033419|Ga0316601_100601937 | Not Available | 1068 | Open in IMG/M |
| 3300033419|Ga0316601_101347154 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300033419|Ga0316601_101514647 | Not Available | 675 | Open in IMG/M |
| 3300033419|Ga0316601_102534906 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300033434|Ga0316613_10022929 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
| 3300033434|Ga0316613_10542363 | Not Available | 792 | Open in IMG/M |
| 3300033434|Ga0316613_10580847 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300033480|Ga0316620_10341032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1330 | Open in IMG/M |
| 3300033480|Ga0316620_10475260 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300033481|Ga0316600_10029244 | All Organisms → cellular organisms → Bacteria | 2916 | Open in IMG/M |
| 3300033481|Ga0316600_10086454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1871 | Open in IMG/M |
| 3300033481|Ga0316600_10563488 | Not Available | 794 | Open in IMG/M |
| 3300033481|Ga0316600_10649276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300033481|Ga0316600_11383186 | Not Available | 500 | Open in IMG/M |
| 3300033482|Ga0316627_100015552 | All Organisms → cellular organisms → Bacteria | 3767 | Open in IMG/M |
| 3300033482|Ga0316627_100016935 | Not Available | 3662 | Open in IMG/M |
| 3300033482|Ga0316627_100126749 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300033482|Ga0316627_100260464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1391 | Open in IMG/M |
| 3300033482|Ga0316627_102079534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300033483|Ga0316629_10039443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2256 | Open in IMG/M |
| 3300033485|Ga0316626_10367986 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300033485|Ga0316626_10700609 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300033485|Ga0316626_10762351 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300033485|Ga0316626_10808981 | Not Available | 822 | Open in IMG/M |
| 3300033485|Ga0316626_11330070 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300033486|Ga0316624_10433754 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300033486|Ga0316624_10956268 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300033487|Ga0316630_10162152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1596 | Open in IMG/M |
| 3300033487|Ga0316630_10712715 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300033487|Ga0316630_11444976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300033487|Ga0316630_11497168 | Not Available | 608 | Open in IMG/M |
| 3300033488|Ga0316621_10072012 | Not Available | 1833 | Open in IMG/M |
| 3300033488|Ga0316621_10865750 | Not Available | 665 | Open in IMG/M |
| 3300033488|Ga0316621_11104325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300033488|Ga0316621_11155129 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300033513|Ga0316628_100173087 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
| 3300033513|Ga0316628_100802394 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300033521|Ga0316616_100223708 | Not Available | 1903 | Open in IMG/M |
| 3300033521|Ga0316616_100292435 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300033521|Ga0316616_100333795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300033521|Ga0316616_100741119 | Not Available | 1184 | Open in IMG/M |
| 3300033521|Ga0316616_101749228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300033521|Ga0316616_101901593 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300033521|Ga0316616_102775689 | Not Available | 659 | Open in IMG/M |
| 3300033521|Ga0316616_104745398 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300033557|Ga0316617_100158144 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 1733 | Open in IMG/M |
| 3300033557|Ga0316617_100222793 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300033557|Ga0316617_100478362 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300033557|Ga0316617_100539104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 56.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 23.95% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 15.57% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.80% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.60% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055432_102095362 | 3300004022 | Natural And Restored Wetlands | LMRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVCGKA* |
| Ga0068997_101397721 | 3300005204 | Natural And Restored Wetlands | MRMVRTHVQENGGAASAVGVGVEIGVGVAIAIDAIGKASLDRLSHDR* |
| Ga0079037_1001382402 | 3300006224 | Freshwater Wetlands | MRTVRTRVQENGGAASTVGIGIGVAVAIAIGACGKASLDRLSHDR* |
| Ga0079037_1001607362 | 3300006224 | Freshwater Wetlands | MRRMHTHAQENGGAASAVGVGIGIGVAVAIAICAGGKESLEG* |
| Ga0079037_1001687213 | 3300006224 | Freshwater Wetlands | VPALRLFLKQQLMRTVRTHVQENGGAASAIGVGIGTGVAVATAIGACGKASLDRLSHDR* |
| Ga0079037_1001691652 | 3300006224 | Freshwater Wetlands | MRTVRTHVQEDGGAVSAVGVRVGIGVAVDIAIGACGKASLDRLSHDR* |
| Ga0079037_1001696432 | 3300006224 | Freshwater Wetlands | MRRMRTHVQENGGAASAVGIGIGVAVATAIGACGEASLDRLSHGR* |
| Ga0079037_1002199412 | 3300006224 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGIGIGIGVAAAIAFGVCGKA* |
| Ga0079037_1005217932 | 3300006224 | Freshwater Wetlands | MRRMRTHVQENGGAASTVGVGIGIGVAVAIAFGVCGKASLDRLSHDR* |
| Ga0079037_1005217933 | 3300006224 | Freshwater Wetlands | MVLVLFSKQYLMRTVRTHVQENGGAASTVGVGIGIGVAVAIAIGACGKASLDRLSHDR* |
| Ga0079037_1007845591 | 3300006224 | Freshwater Wetlands | MRTVRTHVHENGGAASTVGIGIGIGVAVAIAIGACGKASLDR |
| Ga0079037_1010971562 | 3300006224 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGIGIGIGVAAAIAFGVCGKAWPERVNHDRR |
| Ga0079037_1016104401 | 3300006224 | Freshwater Wetlands | LMRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVFGTA* |
| Ga0079037_1019212401 | 3300006224 | Freshwater Wetlands | LLMRTVHTHVQENGGAVSAVGVRVGIGVAILVAIGACGKASLDRLSHDR* |
| Ga0102851_100594933 | 3300009091 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGVGVGIGVAVAIAIGAYGKASLDRL |
| Ga0102851_100603164 | 3300009091 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGVGVGIGVAVAIAFGVWGKA* |
| Ga0102851_101347951 | 3300009091 | Freshwater Wetlands | MRRMRTHVQENGGAASTVGVGVGIGDAVAIAIDACCKASLDLLSHDR |
| Ga0102851_105408212 | 3300009091 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGIGIGVAAAIAFGVCGKA* |
| Ga0102851_108704481 | 3300009091 | Freshwater Wetlands | MRTVRTRVQENGGAASAVGVGVGIGFAVAIAIGACGKVPLDRLSHDR* |
| Ga0102851_109629491 | 3300009091 | Freshwater Wetlands | KQYLMRTVRTHVQENGGAASAVGIGIGVAVAIAFGVCGKA* |
| Ga0102851_109665712 | 3300009091 | Freshwater Wetlands | MRTVRTRVQENGGSASAVGIGIAVAIAIKVCGKA* |
| Ga0102851_113422142 | 3300009091 | Freshwater Wetlands | MRTTRTNVQENGGAASAVGIGIGVAVAIAFGVCGKA* |
| Ga0102851_114897491 | 3300009091 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVCGK |
| Ga0102851_117612571 | 3300009091 | Freshwater Wetlands | MRTVRTYVQEDGGAVSAVGVRVGIGVAVAIAIGAYGKASLDRLSHDR* |
| Ga0102851_129612431 | 3300009091 | Freshwater Wetlands | MRTVRTHVQEDGGATSAVGIGIGIGVAVAIAIDACGKA* |
| Ga0102851_134012821 | 3300009091 | Freshwater Wetlands | MRTVRSHVQDNGGAASAVGIGIGVAVAIAIGACGKASLDRLSHDR* |
| Ga0115026_100152882 | 3300009111 | Wetland | MRTVHTHVQENGGAVSAVGVRVGIGVAILVAIGACGKASLDRLSHDR* |
| Ga0115026_100166643 | 3300009111 | Wetland | MRTVRTRVQENGGAASTVGVGIGIGVAVAIAVGACGKASLDRLSHDR* |
| Ga0115026_100283882 | 3300009111 | Wetland | MRTVRTRVQENGGAASAVGIGIGVAVAIAITVCGKA* |
| Ga0115026_100887443 | 3300009111 | Wetland | MRRTRTHAHENGGAASAVGIGIGIGVAVAIAFGVWGKAALDRLSHDR* |
| Ga0115026_101990662 | 3300009111 | Wetland | MRTVRTHVQENGGAASAVGIGIGVAVAIAFGVCGKASLDRLS |
| Ga0115026_102392771 | 3300009111 | Wetland | MRTVRTHVQENGGAASAVGVGVGIGIAVATAIGACGKAPLDRLSHD |
| Ga0115026_104809032 | 3300009111 | Wetland | RTHVQENGGAASAVGIGIGIGVAVAIAFGVCGKA* |
| Ga0115027_100033331 | 3300009131 | Wetland | MRTVRTHVQENGDAASAVGIGIAIAVAIAFGVCGKA* |
| Ga0115027_100128791 | 3300009131 | Wetland | MRRTRTHAHENGGAASAVGIGIGIGVAVAIAFGVWGKAALDRLSHDC* |
| Ga0115027_100489852 | 3300009131 | Wetland | RTVRTHVHENGGAASAVGIGIGIGIAVAIAFGVCGKA* |
| Ga0115027_115134051 | 3300009131 | Wetland | THVQENGGAASAVGIGVGVAVAIAIGACGRASLDRLSHDR* |
| Ga0113563_100524372 | 3300009167 | Freshwater Wetlands | MRRMRTHVQENGGAATAVGIGIGIGVAAAIAFRVCGKA* |
| Ga0113563_100847924 | 3300009167 | Freshwater Wetlands | MRTVRTHAQENGGAASGVGVGIGIGVAVAIAFGVWGKA* |
| Ga0113563_101170782 | 3300009167 | Freshwater Wetlands | MRTVRTHVQEYGGAASAVGIGIGIGVAAAIAFGVCGKA* |
| Ga0113563_101215951 | 3300009167 | Freshwater Wetlands | VHENGGAASTVGIDIGIEVAVAIAFGVCGKASLGRLSHDR* |
| Ga0113563_102477932 | 3300009167 | Freshwater Wetlands | MRTVRTHVQENGGAASAAGIGIGIGVAVAIAFDVWGKA* |
| Ga0113563_104312911 | 3300009167 | Freshwater Wetlands | MRTVRTHVQENGGAAFVVGVGVGIGVAVAIAIGAYGKASLDRLSHDR* |
| Ga0113563_105797531 | 3300009167 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGIGIGVAVAIAFGVCGKASLDRLSHDR* |
| Ga0113563_111667161 | 3300009167 | Freshwater Wetlands | MRTVRTHVQENGGAASTVGISIGIGIAVAIAFGVCGKA* |
| Ga0113563_119143004 | 3300009167 | Freshwater Wetlands | MRTVRSHVQDNGGAASAVGIGIGVAIAIAIGACGKASLDRLSHDR* |
| Ga0113563_119178202 | 3300009167 | Freshwater Wetlands | MRTVRTHVHENSGAASAVSIGIGIGIAVAIAFGVCGKA* |
| Ga0113563_132939151 | 3300009167 | Freshwater Wetlands | FRNSRSCRWRTLMTHENGGAASAVGIGVGIGVAVAIAIGVCGKA* |
| Ga0115028_100046263 | 3300009179 | Wetland | MRTVRTHVQENGGAASTVGIGIGIGVAVAIAFGVWGKA* |
| Ga0115028_100057002 | 3300009179 | Wetland | MRTVRTDVQENGGAASAVGIGIGIGVAVAIAFGVCGKA* |
| Ga0115028_100061881 | 3300009179 | Wetland | VQENGGAASAVGVGIGIGVAVAIAIGAYGKASLDRLSH |
| Ga0115028_101971343 | 3300009179 | Wetland | MRTVRTHVQENGGAASAVGVGVGIGVAVAIAIGAYGKTSLDRLSHDR* |
| Ga0115028_101974351 | 3300009179 | Wetland | MRTVRTRVQENGGAASTVGIGIGVAVAIAFGVCGKASLDRLSHDR* |
| Ga0115028_104065672 | 3300009179 | Wetland | MRRMRTHVQENGGAASAVGVGIGVAVATAIGACGEASLDRLSHGR* |
| Ga0115028_109191331 | 3300009179 | Wetland | MRRMRTHAQEHGGAASAVGVGVGIGVAVAIAIGACGKASLDRLSHDR* |
| Ga0153915_118734102 | 3300012931 | Freshwater Wetlands | VRTHVQENGGAASAVGIRIGIGVAVAIAFGVCCKA* |
| Ga0075352_11927662 | 3300014324 | Natural And Restored Wetlands | MRAVHTRVQENGGAASAVGVGIGVAVAIAIGACGKASLDRLSHDR* |
| Ga0124853_10315472 | 3300024056 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVCGKA |
| Ga0124853_10632332 | 3300024056 | Freshwater Wetlands | MRTVRTHVQEDGGATSAVGIGIGIGVAVAIAFGVCGKA |
| Ga0124853_11851253 | 3300024056 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVWGKA |
| Ga0124853_13289324 | 3300024056 | Freshwater Wetlands | VQENGGAASTVGVGIGIGVAVAIAFGVCGKASLDRLSHDR |
| Ga0124853_14529944 | 3300024056 | Freshwater Wetlands | MRTVRTHVQENGGAASAVGVGVGIGVAVAIAIGAYGKASLDRLSHDR |
| Ga0210071_10436711 | 3300025955 | Natural And Restored Wetlands | MRTVRTHVQEYGGAASAVGIGIGIGVAVAIAFGVWGKA |
| Ga0208665_100575621 | 3300027715 | Deep Subsurface | MRTVRTHVQENGGAASAVGIGIGVAVAIAISVCGKA |
| Ga0209397_100600542 | 3300027871 | Wetland | MRRMRTHVQENGGAASAVGIGIGVAVATAIGACGEASLDRLSHGR |
| Ga0209397_105478561 | 3300027871 | Wetland | MRTTRTNVQENGGAASAVGIGIGVAVAIAFGVCGKA |
| Ga0209293_100496141 | 3300027877 | Wetland | MRRTRTHAHENGGAASAVGIGIGIGVAVAIAFGVWGKAALDRLSHD |
| Ga0209496_100035714 | 3300027890 | Wetland | MRTVHTHVQENNGAASAVGVRVGIGVAVAIAIGACGKASLDRLSDDR |
| Ga0209496_100412893 | 3300027890 | Wetland | MRTVRTHVQENGGAASTVGIGIGIGVAVAIAFGVWGKA |
| Ga0209496_101015491 | 3300027890 | Wetland | RTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVCCKA |
| Ga0209496_101116911 | 3300027890 | Wetland | RTVRTHVQENGSTASAVGVGAGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0209496_106333201 | 3300027890 | Wetland | MRTVRTRVQENGGAASTVGIGIGVAVAIAIGACGKASLDRL |
| Ga0316604_100171526 | 3300033406 | Soil | MRRMRTHVQENGGAASAVGVGIGVAVATAIGACGEASLDRLSHGR |
| Ga0316604_100197274 | 3300033406 | Soil | MRTVRTHVQENGGAASTVGIDIGIGVAVAIAFGVCGKASLGRLSHDR |
| Ga0316604_100215364 | 3300033406 | Soil | MRTVRTRVQENGGAASAVGVGVGIGFAVAIAIGACGKVPLDRLSHDR |
| Ga0316604_100215365 | 3300033406 | Soil | MRTVRSHVQDNGGAASAVGIGIGVAIAIAIGACGKASLDRLSHDR |
| Ga0316604_100393053 | 3300033406 | Soil | MRTVRTHVQENGGAASTVGISIGIGIAVAIAFGVCGKA |
| Ga0316604_102479941 | 3300033406 | Soil | MRTVRTHVQENGGAASTVGIGIGIGVAVAIAFGVFCKA |
| Ga0316604_106025831 | 3300033406 | Soil | MRTVRSHVQDNGGAASAVGIGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316604_107218121 | 3300033406 | Soil | MRRTRTHAHENGGAASAVGIGIGIGVAVAIAFGVWGKAALDRLSHDC |
| Ga0316604_107493191 | 3300033406 | Soil | MRRMRTHVQENGGAASTVGVGIGIGVAVAIAVGACGKASLDRLSHDR |
| Ga0316605_100645971 | 3300033408 | Soil | MRTVRTHVQENGGAASAVGIGIGVAVAIAFGVWGKA |
| Ga0316605_100764761 | 3300033408 | Soil | MRTVRTHAQENGGAASGVGVGIGIGVAVAIALGVWGK |
| Ga0316605_101209192 | 3300033408 | Soil | MRTVRTDVQENGGAASAVGIGIGIGVAVAIAFGVCGKA |
| Ga0316605_103161982 | 3300033408 | Soil | MRTVRTHVQEDGGAVSAVGVRVGIGVAVDIAIGACGKASLDRLSHDR |
| Ga0316605_103245982 | 3300033408 | Soil | MRTVRTHVQENGGAASTVGIGIGVAVAIAIDACGKA |
| Ga0316605_103447982 | 3300033408 | Soil | MRTVRTHVQENGGAASAAGIGIGIGVAVAIAFDVWGKA |
| Ga0316605_103582351 | 3300033408 | Soil | MRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVCCKA |
| Ga0316605_106633832 | 3300033408 | Soil | MRTVRTHVQENGGAASAAGVGIGIGVAVAIACGVWGKA |
| Ga0316605_106749051 | 3300033408 | Soil | MRTVRTRVQENGGAASAVGIGIGVAVAIAFGVCGKA |
| Ga0316605_110418152 | 3300033408 | Soil | MRTVRTHVQENGGAASTVGIGIGIGVAVAIAFGVCGKA |
| Ga0316605_110469692 | 3300033408 | Soil | MRTVRTHVPENGGAASTVAIGIGIGVAVAIAFGVCGKA |
| Ga0316605_112755102 | 3300033408 | Soil | VQENGGAASAVGVGIGIGVAVAIAIGAYGKASLDRLSHDR |
| Ga0316605_121621282 | 3300033408 | Soil | MRTVRTHVQENGGAASAAGIGIGIGVAVAIAFGVCGKA |
| Ga0316603_100167373 | 3300033413 | Soil | MRTVRTHVHENGGAASAVGIGIGIGIAVAIAFGVCGKA |
| Ga0316603_100252815 | 3300033413 | Soil | MRTVRTHVQENGGAASTVGIGIGIGVAVAIAFGVCGKASLGRLSHDR |
| Ga0316603_100286522 | 3300033413 | Soil | MRGVRSHVQEDGGTASAVGVGIGAAVAVAIGACGQGIT |
| Ga0316603_101868113 | 3300033413 | Soil | MRTVRTRVQDNGGAASAVGVGIGIGVAVAIAIGACGKASPDRLSHDR |
| Ga0316603_103062223 | 3300033413 | Soil | REPATTRRVRTHVQENGGVVSAFGIGIGIGVAVAIAFRVCGKA |
| Ga0316603_104516781 | 3300033413 | Soil | MRTVRTHAQENGGAASGVGVGIGIGVAVAIAFGVWGKA |
| Ga0316603_107985902 | 3300033413 | Soil | MRTVRTHVHENGGAASTVGIGIGIGVAVAIAIGACGKA |
| Ga0316603_108520061 | 3300033413 | Soil | MVLVLFSKQYLMRTVRTHVQENGGAASTVGVGIGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316603_113247341 | 3300033413 | Soil | MRTVRTHVHENGGAASTVGIGIGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316619_100848032 | 3300033414 | Soil | MRAVRTHVQQNGGAASAVGIGIGLGVAVAIAFGVCGKA |
| Ga0316619_103783691 | 3300033414 | Soil | MRTVRTHVQENGGAASAVGIGIGVAVAIAFGVCGKASLDRLSHDR |
| Ga0316619_110454531 | 3300033414 | Soil | MRTHVQENGGAASTVGVGIGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316619_118735892 | 3300033414 | Soil | MRTVRTHVQENGGAASAIGVGIGTGVAVATAIGACGKASLDRLSHDR |
| Ga0316622_1000555184 | 3300033416 | Soil | MRTVRSHVQDNGGAASAIGVGIGTGVAVATAVGACGKAPLDRLSHDR |
| Ga0316622_1004555761 | 3300033416 | Soil | MRTVRTHVQENGGAASAVDIGIGVAVAIAFGVCGKA |
| Ga0316622_1005434462 | 3300033416 | Soil | MRTVRTRVQENGGAASAVGIGIGVAVAIAITVCGKA |
| Ga0316622_1012413412 | 3300033416 | Soil | MRRMRTHVQENGGAATAVGIGIGIGVAAAIAFRVCGKA |
| Ga0316622_1013113031 | 3300033416 | Soil | MRTVRTHVQENGGAASAVGVGVGIGVAVAIAIGAYGKTSLDRLSHDR |
| Ga0316625_1000184561 | 3300033418 | Soil | MRRMRTHVQENGGAASAVGIGIGIGIGFAAAIAFGVCGKAWPE |
| Ga0316625_1000487361 | 3300033418 | Soil | MRTVRTHVQENGGAASTVGIGIGVAVAIAIDACGK |
| Ga0316625_1006095092 | 3300033418 | Soil | VQENGGAASAVGVGIGIGVAVAIAIGAYGKASLDRLNHDR |
| Ga0316601_1002425172 | 3300033419 | Soil | MRRMRTHVQENGGAASAVGIGIGIGIGVAAAIAFGVCGKA |
| Ga0316601_1002884992 | 3300033419 | Soil | LMRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVCGKA |
| Ga0316601_1003599821 | 3300033419 | Soil | MRTVRTHVQENGGAASAVGVGVGIGVAVAIAIGAYGKASLD |
| Ga0316601_1006019372 | 3300033419 | Soil | MRTVRTHVQENGGAASAVGLGVGIGVAVAIAIGAYGKTSFDRLSHDR |
| Ga0316601_1013471541 | 3300033419 | Soil | MRTVRTHVQENNGAASAVGVRVGIGVAVAIAIGAYGKASLDRLSHDR |
| Ga0316601_1015146471 | 3300033419 | Soil | MRTVHTHVQENGGAVSAVGVRVGIGVAILVAIGACGKASLDRLSHDR |
| Ga0316601_1025349061 | 3300033419 | Soil | MRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVC |
| Ga0316613_100229295 | 3300033434 | Soil | MRTVRTHVHENGGAASAVGIGIGIGIAVAIAVGVCGKA |
| Ga0316613_105423631 | 3300033434 | Soil | MRTVRTHVQKNGGAASAVGIGIGVAVAIAISVCGKA |
| Ga0316613_105808471 | 3300033434 | Soil | MRTVRTHVHENGGAASTVGIDIGIEVAVAIAFGVCGKASLGRLSHDR |
| Ga0316620_103410322 | 3300033480 | Soil | MRRMRTHVQENGGAASAVGIGIGIGVAAAIAFGVCGKA |
| Ga0316620_104752602 | 3300033480 | Soil | MRTVRTHVQENGGAASAVGVGVGIGVAVAIAISVCGKA |
| Ga0316600_100292444 | 3300033481 | Soil | MRTVRTHVQENGGAASAVGVGVGIGVAVAIAIGAYGKAS |
| Ga0316600_100864542 | 3300033481 | Soil | MRTVRTHVQENGGDASAVGIGIGIGIAAAIAFGVCGKA |
| Ga0316600_105634882 | 3300033481 | Soil | MRTVRTHVQQNGGAASAVGIGIGIGAAVAIAFGVCGKA |
| Ga0316600_106492763 | 3300033481 | Soil | HPATHENGGAASAVGIGIGIGVAVAIAFGVWGKAALDRLSHDR |
| Ga0316600_113831862 | 3300033481 | Soil | MRTVRTHVQENNGAASAVGVRVGIGVAVAITIGACGKASLDRLS |
| Ga0316627_1000155525 | 3300033482 | Soil | MRTVRTRVQENGGAASAVGVGVGIGFAVAIAIGACGKV |
| Ga0316627_1000169356 | 3300033482 | Soil | HVQDNGGAASAVGIGIGVAIAIAIGACGKASLDRLSHDR |
| Ga0316627_1001267492 | 3300033482 | Soil | MRTVRTHVQENGDAASAVGIGIAIAVAIAFGVCGKA |
| Ga0316627_1002604641 | 3300033482 | Soil | RTRTHAHENGGAASAVGIGIGIGVAVAIAFGVWGKAALDRLSHDR |
| Ga0316627_1020795342 | 3300033482 | Soil | THAQENGGAASAARVGIGIGVAVAIAIGACGKASPDRLSHDR |
| Ga0316629_100394434 | 3300033483 | Soil | GRTRVQENGGAASAVGIGRGIGIAVAIAFGVCGKA |
| Ga0316626_103679862 | 3300033485 | Soil | MRTVRTHVQQNGGAASAVGIGIGIGVAVAIAFGVCGKA |
| Ga0316626_107006092 | 3300033485 | Soil | RIRGHSGKQYLMRTVRTHVQENGSTASAVGVGIGIGFAVAIAIGAYGKASLDRLSHDR |
| Ga0316626_107623512 | 3300033485 | Soil | MREVRSQVQEDGGAASAVGVGIGVAVAIAIGACGQASLDRLS |
| Ga0316626_108089812 | 3300033485 | Soil | MRTVRTHVQENGGAASAVGIGIGIGVAVAIAFGVFGTA |
| Ga0316626_113300702 | 3300033485 | Soil | MRRMRTHVQENGGAASAVGIGIGIGIGFAAAIAFGVCGKAWPERVNHDRRLRLRRD |
| Ga0316624_104337542 | 3300033486 | Soil | MRTVRTHVQENDGAASAVGVGVGIGVAVAIAIGAYGKASLDRLSHDR |
| Ga0316624_109562682 | 3300033486 | Soil | MRTVRTHVQGNGGAASAVGIGIGIGVAVAIAFGVCGKA |
| Ga0316630_101621521 | 3300033487 | Soil | MLTVRTHVQQNGGAASAVGIGIGIGVAVAIAFGVCG |
| Ga0316630_107127152 | 3300033487 | Soil | MRTVRTHVPENGGAASTVGIGIGIGVAVAIAFGVCGKA |
| Ga0316630_114449762 | 3300033487 | Soil | MRRTRTHAHENGGAASAVGIGIGIGVAVAIAFGVWGKAAL |
| Ga0316630_114971681 | 3300033487 | Soil | RTVRTHVQENGGAASAVGIGVGIGVAVAIAFGVCGKA |
| Ga0316621_100720122 | 3300033488 | Soil | MRRMRTHVQENGGAASTVGVGIGIGVAVAIAFGVCGK |
| Ga0316621_108657502 | 3300033488 | Soil | PLMRTVRTHVQENGGAASAVGIGVGIGVAVAIAFGVCGKA |
| Ga0316621_111043251 | 3300033488 | Soil | TVRTRVQENGGAASTVGIGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316621_111551291 | 3300033488 | Soil | MRTVRTHVQENNGAASAVGVRVGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316628_1001730872 | 3300033513 | Soil | MCTVRTHVQENGGAASAVGVGIGIAVAIAFGVCGKA |
| Ga0316628_1008023941 | 3300033513 | Soil | MRTVRAHVQENGGAASAVGIGIGIGVAVAIAFGVCGKA |
| Ga0316616_1002237082 | 3300033521 | Soil | MRRMRTHVQENGGAASTVGVGIGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316616_1002924352 | 3300033521 | Soil | MRTVRTHVQENGGAASTVGIGIGIGVAVAIAIGACG |
| Ga0316616_1003337951 | 3300033521 | Soil | TVRTHVQENGGAASAVGIGIGIGVAVAIAFGVFGTA |
| Ga0316616_1007411192 | 3300033521 | Soil | MRRMRTHAQEHGGAASAVGVGVGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316616_1017492281 | 3300033521 | Soil | DRNGGAASAVGIDIGIGVAVAIAIGACGKASLDRLSHDR |
| Ga0316616_1019015933 | 3300033521 | Soil | MRTVRTHVHENGGAASTVGIGIGIGVAVAIAIGACGKASLDRLS |
| Ga0316616_1027756891 | 3300033521 | Soil | LMRTVRTHVPENGGAASTVAIGIGIGVAVAIAFGVCGKA |
| Ga0316616_1047453981 | 3300033521 | Soil | ENGGAVSAVGVRVGIGVTILVAIGACGKASLDRLSHDR |
| Ga0316617_1001581442 | 3300033557 | Soil | MRTVHTHVQENGGAVSAVGVRVGIGVTILVAIGACGKASLDRLSHDR |
| Ga0316617_1002227933 | 3300033557 | Soil | MRRMHTHAQENGGAASAVGVGIGIGVAVAIAICAGGKESLEG |
| Ga0316617_1004783621 | 3300033557 | Soil | MRRMRTHVQVNGGAASAVGIGIGIGVAVAIAFGVCGKA |
| Ga0316617_1005391042 | 3300033557 | Soil | DGAAYAVAVGVRIGVAIAIAIGAYGKASLDRLSHDR |
| ⦗Top⦘ |