Basic Information | |
---|---|
Family ID | F037713 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 167 |
Average Sequence Length | 39 residues |
Representative Sequence | LDPQTHAFVCATAAITSIAFTVSVLNVLAVVLSHVLS |
Number of Associated Samples | 131 |
Number of Associated Scaffolds | 166 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 56.36 % |
% of genes near scaffold ends (potentially truncated) | 23.95 % |
% of genes from short scaffolds (< 2000 bps) | 81.44 % |
Associated GOLD sequencing projects | 127 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.826 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.755 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.527 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.898 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 166 Family Scaffolds |
---|---|---|
PF00999 | Na_H_Exchanger | 38.55 |
PF13537 | GATase_7 | 17.47 |
PF02397 | Bac_transf | 10.24 |
PF13522 | GATase_6 | 4.22 |
PF00126 | HTH_1 | 3.61 |
PF03466 | LysR_substrate | 1.81 |
PF00465 | Fe-ADH | 1.81 |
PF02350 | Epimerase_2 | 1.20 |
PF00890 | FAD_binding_2 | 1.20 |
PF13727 | CoA_binding_3 | 1.20 |
PF13408 | Zn_ribbon_recom | 0.60 |
PF13424 | TPR_12 | 0.60 |
PF13462 | Thioredoxin_4 | 0.60 |
PF04007 | DUF354 | 0.60 |
PF07596 | SBP_bac_10 | 0.60 |
PF01872 | RibD_C | 0.60 |
PF07587 | PSD1 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
---|---|---|---|
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 38.55 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 38.55 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 38.55 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 38.55 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 38.55 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 10.24 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 1.81 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 1.81 |
COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.81 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 1.81 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 1.81 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 1.20 |
COG2165 | Type II secretory pathway, pseudopilin PulG | Cell motility [N] | 1.20 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.60 |
COG1817 | Predicted glycosyltransferase | General function prediction only [R] | 0.60 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.83 % |
Unclassified | root | N/A | 13.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_179098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
3300000559|F14TC_101026286 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300000887|AL16A1W_10436709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
3300000956|JGI10216J12902_115286279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
3300000956|JGI10216J12902_115714243 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300001538|A10PFW1_11067078 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300004081|Ga0063454_100085798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1437 | Open in IMG/M |
3300004156|Ga0062589_101524709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
3300004156|Ga0062589_101887143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300005167|Ga0066672_10686414 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300005171|Ga0066677_10216525 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300005174|Ga0066680_10038322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2757 | Open in IMG/M |
3300005180|Ga0066685_11076697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 527 | Open in IMG/M |
3300005181|Ga0066678_10068898 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
3300005186|Ga0066676_10238962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1182 | Open in IMG/M |
3300005332|Ga0066388_100256296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2390 | Open in IMG/M |
3300005332|Ga0066388_100789440 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300005355|Ga0070671_101917795 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005454|Ga0066687_10030813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2363 | Open in IMG/M |
3300005526|Ga0073909_10008751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3038 | Open in IMG/M |
3300005544|Ga0070686_100400075 | Not Available | 1044 | Open in IMG/M |
3300005545|Ga0070695_101632510 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300005552|Ga0066701_10749468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300005555|Ga0066692_10304900 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300005557|Ga0066704_10899676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300005559|Ga0066700_10183885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1436 | Open in IMG/M |
3300005560|Ga0066670_10009989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4016 | Open in IMG/M |
3300005575|Ga0066702_10834948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300005578|Ga0068854_100623418 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300005587|Ga0066654_10005591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4393 | Open in IMG/M |
3300006034|Ga0066656_11100936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 511 | Open in IMG/M |
3300006046|Ga0066652_100002439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 10202 | Open in IMG/M |
3300006573|Ga0074055_11831572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1731 | Open in IMG/M |
3300007076|Ga0075435_100450815 | Not Available | 1109 | Open in IMG/M |
3300007255|Ga0099791_10507072 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300009012|Ga0066710_100049615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5175 | Open in IMG/M |
3300009012|Ga0066710_100050341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5145 | Open in IMG/M |
3300009012|Ga0066710_100968929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1312 | Open in IMG/M |
3300009012|Ga0066710_102652597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
3300009012|Ga0066710_104483781 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 522 | Open in IMG/M |
3300009038|Ga0099829_10645187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 880 | Open in IMG/M |
3300009038|Ga0099829_11262030 | Not Available | 611 | Open in IMG/M |
3300009089|Ga0099828_11609094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300009090|Ga0099827_10001040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 13814 | Open in IMG/M |
3300009090|Ga0099827_10852195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 789 | Open in IMG/M |
3300009090|Ga0099827_11247754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
3300009098|Ga0105245_10014655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6825 | Open in IMG/M |
3300009137|Ga0066709_100094382 | All Organisms → cellular organisms → Bacteria | 3635 | Open in IMG/M |
3300009137|Ga0066709_102440713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
3300009147|Ga0114129_11840349 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300009148|Ga0105243_13033529 | Not Available | 509 | Open in IMG/M |
3300009818|Ga0105072_1020896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1194 | Open in IMG/M |
3300009836|Ga0105068_1038042 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300010037|Ga0126304_10501745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
3300010303|Ga0134082_10272036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300010335|Ga0134063_10747865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300010336|Ga0134071_10093177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1424 | Open in IMG/M |
3300010371|Ga0134125_12753087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300010373|Ga0134128_11038484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 905 | Open in IMG/M |
3300010400|Ga0134122_11216804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
3300011106|Ga0151489_1238412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
3300012198|Ga0137364_10545484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 873 | Open in IMG/M |
3300012201|Ga0137365_10198724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1499 | Open in IMG/M |
3300012204|Ga0137374_10003034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19700 | Open in IMG/M |
3300012204|Ga0137374_10131486 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
3300012204|Ga0137374_10276904 | Not Available | 1390 | Open in IMG/M |
3300012206|Ga0137380_10596155 | Not Available | 967 | Open in IMG/M |
3300012206|Ga0137380_10691027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 886 | Open in IMG/M |
3300012206|Ga0137380_11248453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 628 | Open in IMG/M |
3300012207|Ga0137381_10609371 | Not Available | 951 | Open in IMG/M |
3300012207|Ga0137381_10845536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 792 | Open in IMG/M |
3300012209|Ga0137379_10169848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2093 | Open in IMG/M |
3300012210|Ga0137378_10254518 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
3300012350|Ga0137372_10357850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1116 | Open in IMG/M |
3300012353|Ga0137367_10844515 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300012355|Ga0137369_10000584 | All Organisms → cellular organisms → Bacteria | 33419 | Open in IMG/M |
3300012356|Ga0137371_10280273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1300 | Open in IMG/M |
3300012356|Ga0137371_11119374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300012359|Ga0137385_11209226 | Not Available | 617 | Open in IMG/M |
3300012360|Ga0137375_10028190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6412 | Open in IMG/M |
3300012469|Ga0150984_104336284 | Not Available | 645 | Open in IMG/M |
3300012469|Ga0150984_114450843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300012927|Ga0137416_11224957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
3300012930|Ga0137407_11960670 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300012941|Ga0162652_100007474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1266 | Open in IMG/M |
3300012955|Ga0164298_10212788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1139 | Open in IMG/M |
3300012955|Ga0164298_10516989 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300012955|Ga0164298_11138056 | Not Available | 587 | Open in IMG/M |
3300012961|Ga0164302_10766547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300012961|Ga0164302_11649422 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300012987|Ga0164307_10499730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
3300013294|Ga0120150_1029860 | Not Available | 1086 | Open in IMG/M |
3300013764|Ga0120111_1000485 | All Organisms → cellular organisms → Bacteria | 20815 | Open in IMG/M |
3300014031|Ga0120173_1001351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3379 | Open in IMG/M |
3300014154|Ga0134075_10175916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
3300014166|Ga0134079_10391727 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300015357|Ga0134072_10239527 | Not Available | 648 | Open in IMG/M |
3300017659|Ga0134083_10219521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300018027|Ga0184605_10001180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8255 | Open in IMG/M |
3300018027|Ga0184605_10080610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1419 | Open in IMG/M |
3300018027|Ga0184605_10091518 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300018027|Ga0184605_10256121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 795 | Open in IMG/M |
3300018051|Ga0184620_10023898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1548 | Open in IMG/M |
3300018052|Ga0184638_1009353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3284 | Open in IMG/M |
3300018052|Ga0184638_1256210 | Not Available | 601 | Open in IMG/M |
3300018056|Ga0184623_10310774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
3300018061|Ga0184619_10131584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
3300018066|Ga0184617_1057901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1002 | Open in IMG/M |
3300018076|Ga0184609_10256218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
3300018431|Ga0066655_10097892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1637 | Open in IMG/M |
3300018431|Ga0066655_10097892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1637 | Open in IMG/M |
3300018468|Ga0066662_10027007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3340 | Open in IMG/M |
3300019868|Ga0193720_1005936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1677 | Open in IMG/M |
3300019878|Ga0193715_1123284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300019879|Ga0193723_1073154 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300020004|Ga0193755_1055831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1286 | Open in IMG/M |
3300020012|Ga0193732_1056121 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300020016|Ga0193696_1017170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1951 | Open in IMG/M |
3300020022|Ga0193733_1161032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
3300020059|Ga0193745_1044452 | Not Available | 975 | Open in IMG/M |
3300021080|Ga0210382_10381428 | Not Available | 623 | Open in IMG/M |
3300021080|Ga0210382_10385619 | Not Available | 620 | Open in IMG/M |
3300021415|Ga0193694_1035661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300022756|Ga0222622_11293976 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300024288|Ga0179589_10291738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300025937|Ga0207669_10766695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
3300025940|Ga0207691_10961047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
3300026118|Ga0207675_101075166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
3300026295|Ga0209234_1151079 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300026550|Ga0209474_10091085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2073 | Open in IMG/M |
3300026552|Ga0209577_10128611 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
3300027725|Ga0209178_1440641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300027748|Ga0209689_1119992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1323 | Open in IMG/M |
3300027862|Ga0209701_10307547 | Not Available | 909 | Open in IMG/M |
3300027875|Ga0209283_10775807 | Not Available | 592 | Open in IMG/M |
3300027882|Ga0209590_10002446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7445 | Open in IMG/M |
3300027882|Ga0209590_10072581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1986 | Open in IMG/M |
3300027882|Ga0209590_10593706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 712 | Open in IMG/M |
3300028536|Ga0137415_11126968 | Not Available | 598 | Open in IMG/M |
3300028704|Ga0307321_1063276 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300028711|Ga0307293_10264658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
3300028715|Ga0307313_10000238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 9757 | Open in IMG/M |
3300028715|Ga0307313_10069947 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300028717|Ga0307298_10095594 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300028721|Ga0307315_10000607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8140 | Open in IMG/M |
3300028792|Ga0307504_10149882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
3300028796|Ga0307287_10341459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300028799|Ga0307284_10075566 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300028799|Ga0307284_10090369 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300028802|Ga0307503_10315219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300028803|Ga0307281_10125792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
3300028807|Ga0307305_10142705 | Not Available | 1105 | Open in IMG/M |
3300028824|Ga0307310_10006239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4518 | Open in IMG/M |
3300028828|Ga0307312_10508161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
3300028828|Ga0307312_10984313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
3300028884|Ga0307308_10052293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1922 | Open in IMG/M |
3300028884|Ga0307308_10111206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1306 | Open in IMG/M |
3300028884|Ga0307308_10115229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1282 | Open in IMG/M |
3300031170|Ga0307498_10019618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1520 | Open in IMG/M |
3300031199|Ga0307495_10067220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
3300031720|Ga0307469_11108697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
3300031720|Ga0307469_11880710 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300032013|Ga0310906_10795403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300032180|Ga0307471_100300468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1692 | Open in IMG/M |
3300032205|Ga0307472_100205926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1501 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.75% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.19% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.40% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.80% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.20% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.20% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.20% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.20% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.20% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.60% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_03054090 | 2199352025 | Soil | LDPQTQAFVHATAAITSIVFTISVLNVIAVVLSHVLR |
F14TC_1010262862 | 3300000559 | Soil | MRMDPLTEAFVYATAFITSVAFAVSVLNVLAVILSHVLY* |
AL16A1W_104367092 | 3300000887 | Permafrost | LDPQTQAFVHATAAITSVAFTVSFLNVLAVVLSHVLS* |
JGI10216J12902_1152862792 | 3300000956 | Soil | VNLDPNTHAFVLATAALTSITFAIAAMNVLAVVLSNVLR* |
JGI10216J12902_1157142432 | 3300000956 | Soil | LDPRTHAFVCATAAITSIAFTISVLNVLAVVLSNVLQ* |
A10PFW1_110670782 | 3300001538 | Permafrost | LDPQTHAFVQATAVITSIAFTVSVLNVLAVVLSHVLQ* |
Ga0063454_1000857982 | 3300004081 | Soil | MSFDPNTHAFVIVTAAVTAGTFAISVMNVLAVVLSHVLR* |
Ga0062589_1015247092 | 3300004156 | Soil | MQHDPATHMFIMATAAITSIAFMVSVLNVLAVILSHLMT* |
Ga0062589_1018871432 | 3300004156 | Soil | VSLDPQTQAFVHATAAITSIAFMVSVLNVLAVVLSHVLR* |
Ga0066672_106864142 | 3300005167 | Soil | MNLDPNTHAFVVATAAITSITFMIAVMNVLAVVLSHILY* |
Ga0066677_102165253 | 3300005171 | Soil | WGMGMDPNTHAFVLATAAITSIAFAISFMNVLAVVLSHLLQ* |
Ga0066680_100383222 | 3300005174 | Soil | MRMDPNTHALVLATAAITSIAFAVSVMNVLAVILSHLLA* |
Ga0066685_110766972 | 3300005180 | Soil | MRLDPNTHALVLAAAAITSVVFAISVMNVLAVILSHLLV* |
Ga0066678_100688982 | 3300005181 | Soil | MRLDPNTHAFVLATAALTSIAFTVSALNVLAVILSHLLQ* |
Ga0066676_102389622 | 3300005186 | Soil | LNLDPNTHALLLGTAFLTSVTFAISVMNVLAVVLSHVLH* |
Ga0066388_1002562962 | 3300005332 | Tropical Forest Soil | MWGMRMDPNTHMFVLATAAITSIVFAISVMNVLAVILSHLYQ* |
Ga0066388_1007894402 | 3300005332 | Tropical Forest Soil | MNLDPGTQAFVYATALITSIAFAVSVLKVLAVILSHLMT* |
Ga0070671_1019177951 | 3300005355 | Switchgrass Rhizosphere | VTLDPNTHAFVAATAGLTSVAFTVSALNVLAVILSHVFN* |
Ga0066687_100308132 | 3300005454 | Soil | MGMDPNTHAFVLATAAITSIAFAISFMNVLAVVLSHLLQ* |
Ga0073909_100087513 | 3300005526 | Surface Soil | LDPQTQAFVHATAAITSIVFTISVLNVIAVVLSHVLR* |
Ga0070686_1004000751 | 3300005544 | Switchgrass Rhizosphere | MVQAGDGVNLDPNTQAFVYATALITSIAFAVAVLNILAVVLSYV |
Ga0070695_1016325102 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLDPNTQAFVYATALITSIAFAVAVLNILAVVLSHVLQ* |
Ga0066701_107494682 | 3300005552 | Soil | LSLDPNTHTFVVATALITSIAFAVSAMNVLAVVLSHILQ* |
Ga0066692_103049001 | 3300005555 | Soil | VLNLDPNTHALVLGTAFLTSVTFAISVMNVLAVVLSHVLH* |
Ga0066704_108996762 | 3300005557 | Soil | SGDCWGMRMDPNTHALVLATAAITSIAFAVSVMNVLAVILSHLLA* |
Ga0066700_101838852 | 3300005559 | Soil | MRLDPNTHAFVVATAGLTSIAFMVSFLNVLAVILSHVLN* |
Ga0066670_100099895 | 3300005560 | Soil | LNLDPNTHALVLGTAFLTSVTFAISVMNVLAVVLSHVLH* |
Ga0066702_108349483 | 3300005575 | Soil | TGASLVPGIMNLDPNTHAFVVATAAITSITFMIAVMNVLAVVLSHILY* |
Ga0068854_1006234182 | 3300005578 | Corn Rhizosphere | LDPNTHAFVAATAGLTSVAFTVSALNVLAVILSHVFN* |
Ga0066654_100055917 | 3300005587 | Soil | DPNTHAFVVATAAITSITFMIAVMNVLAVVLSHILY* |
Ga0066656_111009362 | 3300006034 | Soil | MRLDPNTHAFVLATAAFTSIAFAISVMNVLAVILSHLLQ* |
Ga0066652_1000024395 | 3300006046 | Soil | MRLDPNTHAFVLATAAITSIAFTVSALNVLAVILSHLLQ* |
Ga0074055_118315722 | 3300006573 | Soil | LDPQTQAFVHATAAITSIVFTISVLNVLAVVLSHVLR* |
Ga0075435_1004508152 | 3300007076 | Populus Rhizosphere | MRMDPNTHAFVLATAAITSIVFAISVMNILAVILSHLYQ* |
Ga0099791_105070721 | 3300007255 | Vadose Zone Soil | LDPQTQAFVHATAAITSIAFTVSFLNVLAVVLSHVLS* |
Ga0066710_1000496152 | 3300009012 | Grasslands Soil | LDPQTQAFVQATAVITSIAFTVSVLNVLAVVLSHVLR |
Ga0066710_1000503413 | 3300009012 | Grasslands Soil | MRLDPNTHAFVLATAAITSIAFTVSALNVLAVILSHLLQ |
Ga0066710_1009689291 | 3300009012 | Grasslands Soil | GGVRLDPGTQMFVYATAALTSVAFTVSVLNVLAVVLSHVLS |
Ga0066710_1026525972 | 3300009012 | Grasslands Soil | LSLDPNTHTFVVATALITSIAFAVSAMNVLAVVLSHILQ |
Ga0066710_1044837812 | 3300009012 | Grasslands Soil | MDPNTHALVLATAAITSIAFAISVMNVLAVILSHLLS |
Ga0099829_106451872 | 3300009038 | Vadose Zone Soil | MDPNTHALVLATAAITSIAFAVSVMNVLAVILSHLLS* |
Ga0099829_112620302 | 3300009038 | Vadose Zone Soil | MDPNTHAFVLATALITSISFVVFALNLLALILSHVLS* |
Ga0099828_116090942 | 3300009089 | Vadose Zone Soil | LSLDPNTHAFVLATALMTSIAFAVSAMNILAVILSHLMR* |
Ga0099827_100010409 | 3300009090 | Vadose Zone Soil | LEPQTHAFVQATAVITSIAFTVSVLNVLAVVLSHVLG* |
Ga0099827_108521952 | 3300009090 | Vadose Zone Soil | MDPNTHALVLATAAITSIAFAVSVMNVLAVILSHLLA* |
Ga0099827_112477542 | 3300009090 | Vadose Zone Soil | VNLDPNTHAFVLATAAITSIAFVVSAMNVLAVVLSHVLH* |
Ga0105245_100146552 | 3300009098 | Miscanthus Rhizosphere | LDPNTQAFVYATALITSIAFAVAVLNILAVVLSYVLQ* |
Ga0066709_1000943822 | 3300009137 | Grasslands Soil | LDPQTQAFVQATAVITSIAFTVSVLNVLAVVLSHVLR* |
Ga0066709_1024407131 | 3300009137 | Grasslands Soil | MDPNTHAFVLATALITSITFAISVMNVLAVVLSHVMR* |
Ga0114129_118403492 | 3300009147 | Populus Rhizosphere | VKLDPVTQAFVYATALITSIAFTVAALNVLAVILSHVLA* |
Ga0105243_130335292 | 3300009148 | Miscanthus Rhizosphere | LDPNTQAFVYATALITSIAFAVAVLNILAVVLSHVLQ* |
Ga0105072_10208962 | 3300009818 | Groundwater Sand | VNLDPRTQAFVYATALFTSIAFTVSVLNVLAVVLSHVLG* |
Ga0105068_10380421 | 3300009836 | Groundwater Sand | VNLDPRTQAFVYATALVTSIAFTVSVLNVLAVVLSHVLG* |
Ga0126304_105017452 | 3300010037 | Serpentine Soil | MQHDPATHMFIMATAAITSIAFMVSVLNVLAVILSHVMN* |
Ga0134082_102720362 | 3300010303 | Grasslands Soil | MRLDPNTHALVLATAAITSVAFAISAMNVLAVILSHLLA* |
Ga0134063_107478652 | 3300010335 | Grasslands Soil | SLDPQTQAFVQATAVITSIAFTVSVLNVLAVVLSHVLR* |
Ga0134071_100931772 | 3300010336 | Grasslands Soil | LDPQTQAFVQATAVITSIAFTVSVLKVLAVVLSHVLR* |
Ga0134125_127530871 | 3300010371 | Terrestrial Soil | QTHAFVCATAAITSIAFTVSVLNVLAVVLSHVLR* |
Ga0134128_110384842 | 3300010373 | Terrestrial Soil | LDPQTQVFVYATAAITSIVFTISVLNVLAVVLSHVLR* |
Ga0134122_112168042 | 3300010400 | Terrestrial Soil | PQTQVFVYATAAITSIVFTISVLNVLAVVLSHVLR* |
Ga0151489_12384122 | 3300011106 | Soil | LDPQTQAFVHAAAAITSIVFTISVLNVLAVVLSHVLR* |
Ga0137364_105454842 | 3300012198 | Vadose Zone Soil | LDPQTHAFVQATAVITSIAFTVSVLNVLAVVLSHVLG* |
Ga0137365_101987242 | 3300012201 | Vadose Zone Soil | MDPNTHAFVLATAFVTSITFAISMMNVLAVVLSHVMR* |
Ga0137374_100030347 | 3300012204 | Vadose Zone Soil | LDPQTHAFVCATAAITSIAFTISVLKVLAVVLSNVLN* |
Ga0137374_101314864 | 3300012204 | Vadose Zone Soil | LDPNTHAFVVATAAITSITFMISVMQILAVILSHY* |
Ga0137374_102769041 | 3300012204 | Vadose Zone Soil | MSLDPNTHAFLLATGLIPSIAFALSAMNVLAITLSHILL* |
Ga0137380_105961551 | 3300012206 | Vadose Zone Soil | MSLDPNTHAFLLATALIPSIAFALSAMNVLAVMLSHILP* |
Ga0137380_106910272 | 3300012206 | Vadose Zone Soil | LSLDPNTHAYVLATALMTSIAFAVSVMNILAVILSHLMR* |
Ga0137380_112484532 | 3300012206 | Vadose Zone Soil | MNLDPNTHAFVMATAAVTSICFAISAMNVLAVILSHVF* |
Ga0137381_106093711 | 3300012207 | Vadose Zone Soil | LRHLDNFCGPLSLDPNTHAFVLATALITSIAFAVSGMNVLAVVLSHALR* |
Ga0137381_108455362 | 3300012207 | Vadose Zone Soil | LDPQTQAFVQATAVITSIAFTVSVLNVLAVVLSHVLG* |
Ga0137379_101698482 | 3300012209 | Vadose Zone Soil | MNLDPNTHAFVMATAAVTSICFMISALNVLAVILSHIL* |
Ga0137378_102545183 | 3300012210 | Vadose Zone Soil | VKLDPNTHALVLGTAFLTSVAFVIAVLNILAVILSHLLR* |
Ga0137372_103578502 | 3300012350 | Vadose Zone Soil | MDPNTHSFVLATAFVTSITFAISMMNVLAVVLSHVMR* |
Ga0137367_108445151 | 3300012353 | Vadose Zone Soil | LDPQTHAFVCATAAITSIAFAVSVLNVLAVVLSNVLN* |
Ga0137369_100005847 | 3300012355 | Vadose Zone Soil | VGELGPQTHAFVCATAAITSIAFTISVLNVLAVVLSNVLN* |
Ga0137371_102802732 | 3300012356 | Vadose Zone Soil | MDPNTRALVLATAGITSVVFAISVMNVLAVILSHLLT* |
Ga0137371_111193742 | 3300012356 | Vadose Zone Soil | ELRGRGSLDPQTQAFVQATAVITSIAFTVSVLNVLAVVLSHVLR* |
Ga0137385_112092261 | 3300012359 | Vadose Zone Soil | MSLDPNTHAFLLATALIPSIAFALSAMNVLAVMLS |
Ga0137375_100281906 | 3300012360 | Vadose Zone Soil | LDPQTHAFVCATAAITSIAFTISVLNVLAVVLSNVLN* |
Ga0150984_1043362842 | 3300012469 | Avena Fatua Rhizosphere | PNTHAFVVATAFLTSAAFAIAAMNVLAFVLAFVL* |
Ga0150984_1144508432 | 3300012469 | Avena Fatua Rhizosphere | VRLDPQTQAFVHATAAITSIVFTISVLNVIAVVLSHVLR* |
Ga0137416_112249571 | 3300012927 | Vadose Zone Soil | LDPQTQAFVYATAAITSVAFTVSVLNVLAVVLSHVLS* |
Ga0137407_119606701 | 3300012930 | Vadose Zone Soil | LDPQTHAFVQATAVITSIAFTVSVLNVLAVVLSHVL |
Ga0162652_1000074742 | 3300012941 | Soil | LDPQTQAFVHATAAITSIVFAISVLNVLAVVLSHVLR* |
Ga0164298_102127882 | 3300012955 | Soil | LDPTTQVFVQATAVLTSIAFTVSVLNVLSVVLSHVLQ* |
Ga0164298_105169891 | 3300012955 | Soil | LDPNTQAFVYATALITSIAFAVAVLNILAGVLSHVLQ* |
Ga0164298_111380562 | 3300012955 | Soil | LDPNTQAFVYATALITSVAFAIAVLNILAFVLSYVLQ* |
Ga0164302_107665471 | 3300012961 | Soil | QGDGVNLDPNTQAFVYATALITSIAFAVAVLNILAVVLSHVLQ* |
Ga0164302_116494222 | 3300012961 | Soil | LDPNTQAFVYATALITSIAFEVAVLNMLAVVLSHGLQ* |
Ga0164307_104997301 | 3300012987 | Soil | MGVNLDPNTQAFVYATALITSIAFAVAVLNILAVVLSHVLQ* |
Ga0120150_10298601 | 3300013294 | Permafrost | PQTHAFVQATAVITSIAFTVSVLNVLAVVLSHVMQ* |
Ga0120111_10004852 | 3300013764 | Permafrost | LDPQTHAFVQATAVITSIAFTVSVLNVLAVVLSHVMQ* |
Ga0120173_10013512 | 3300014031 | Permafrost | LDPQTHAFVCATAAITSIAFTVSVLNVLAVVLSHVLS* |
Ga0134075_101759162 | 3300014154 | Grasslands Soil | LDPQTQAFVQATALITSIAFTVSVLNVLAVVLSHVLR* |
Ga0134079_103917272 | 3300014166 | Grasslands Soil | VNLDPNTHAFVLATAALTSITFAIAVMNVLAVVLSHILR* |
Ga0134072_102395272 | 3300015357 | Grasslands Soil | MSLDPNTHAFVVATAAITSITFMIAVMNVLAVVLSHILY* |
Ga0134083_102195211 | 3300017659 | Grasslands Soil | RGSLDPQTQAFVQATAVITSIAFTVSVLNVLAVVLSHVLR |
Ga0184605_100011806 | 3300018027 | Groundwater Sediment | LDPVTQVFVYATAAITSVAFTVSALNVLAVVLSHVLS |
Ga0184605_100806101 | 3300018027 | Groundwater Sediment | MDPNTRALVLATAGITSVAFAISVMNVLAVILSHLLV |
Ga0184605_100915182 | 3300018027 | Groundwater Sediment | LDPQTQAFVHATAAITSIVFAISVLNVLAVVLSHVLR |
Ga0184605_102561212 | 3300018027 | Groundwater Sediment | VNLDPNTQAFVYATAFLTSVAFMVAVLNVLAVVLSHVLR |
Ga0184620_100238982 | 3300018051 | Groundwater Sediment | LDPQTQAFVHATAAITSIVFTISVLNVLAVVLSHVLR |
Ga0184638_10093534 | 3300018052 | Groundwater Sediment | VNLDPRTQAFVYATALFTSIAFTVSVLNVLAVVLSHVLG |
Ga0184638_12562102 | 3300018052 | Groundwater Sediment | VRPDPATHLFIMATAALTSIAFMVSALNVLAVVLSHVMN |
Ga0184623_103107742 | 3300018056 | Groundwater Sediment | VNLDPRTQAFVYATALFTSIAFTVSVLNVLAFVLSHVLG |
Ga0184619_101315841 | 3300018061 | Groundwater Sediment | ERGFWGMRMDPNTRALVLATAGITSVAFAISVMNVLAVILSHLLV |
Ga0184617_10579012 | 3300018066 | Groundwater Sediment | LDPQTQAFVHATAAITSVAFTVSALNVLAVVLSHVLS |
Ga0184609_102562182 | 3300018076 | Groundwater Sediment | SVTQVFVYATAAITSVAFTVSALNVLAVVLSHVLS |
Ga0066655_100978922 | 3300018431 | Grasslands Soil | MNLDPNTHAFVVATAAITSITFMIAVMNVLAVVLSHILY |
Ga0066655_100978923 | 3300018431 | Grasslands Soil | LNLDPNTHALVLGTAFLTSVTFAISVMNVLAVVLSHVLH |
Ga0066662_100270073 | 3300018468 | Grasslands Soil | MRMDPNTHALVLATAAITSIAFAVSVMNVLAVILSHLLA |
Ga0193720_10059362 | 3300019868 | Soil | MVRAGGRGNLDPNTQAFVYATALITSIAFAVAVLNILAVVLSHVLQ |
Ga0193715_11232841 | 3300019878 | Soil | LDPNTQAFVYATALITSIAFAVAVLNILAVVLSHVLQ |
Ga0193723_10731542 | 3300019879 | Soil | LDPNTQAFVYATALITSIAFAIAVLNVLAVVLSHVLQ |
Ga0193755_10558312 | 3300020004 | Soil | LDPQTQAFVHAAAAITSIVFTISVLNVIAVVLSHVLR |
Ga0193732_10561212 | 3300020012 | Soil | VNLDPNTQAFVYATALITSIAFAVAVLNVLAVVLS |
Ga0193696_10171702 | 3300020016 | Soil | LDPQTQVFVHATAAITSIVFTISVLNVLAVVLSHVLR |
Ga0193733_11610322 | 3300020022 | Soil | VTWFGEGDGVNLDPNTQAFVYATALITSIAFAVAVLNVLAVVLSHVLQ |
Ga0193745_10444522 | 3300020059 | Soil | SQGEGVNLDPNTQAFVYATALITSIAFAIAVLNVLAVVLSHVLQ |
Ga0210382_103814282 | 3300021080 | Groundwater Sediment | PQTQAFVHATAAITSIVFAISVLNVLAVVLSHVLR |
Ga0210382_103856191 | 3300021080 | Groundwater Sediment | PQTHAFVCATAAITSIAFTISVLNVLAVVLSNVLN |
Ga0193694_10356611 | 3300021415 | Soil | DPQTQAFVHATAAITSIVFTISVLNVLAVVLSHVLR |
Ga0222622_112939762 | 3300022756 | Groundwater Sediment | MVLCKGRGELDPQTHAFVCATAAITSIAFTISVLNVLAVVLSNVLN |
Ga0179589_102917382 | 3300024288 | Vadose Zone Soil | LDPQTQAFVHATAAITSIVFTISVLNALAVVLSHVLR |
Ga0207669_107666952 | 3300025937 | Miscanthus Rhizosphere | LDPQTQVFVYATAAITSIVFTISVLNVLAVVLSHVLR |
Ga0207691_109610472 | 3300025940 | Miscanthus Rhizosphere | VNLDPNTQAFVYATALITSIAFAVAVLNILAVVLSYVLQ |
Ga0207675_1010751662 | 3300026118 | Switchgrass Rhizosphere | LDPQTQAFVHATAAITSIVFTISVLNVIAVVLYHVLR |
Ga0209234_11510792 | 3300026295 | Grasslands Soil | MRMDPNTHALVLATAAITSIAFAVSVMNVLAVILSHLLS |
Ga0209474_100910853 | 3300026550 | Soil | MGMDPNTHAFVLATAAITSIAFAISFMNVLAVVLSHLLQ |
Ga0209577_101286112 | 3300026552 | Soil | MNLDPNTHAFVLATAALTSIAFMVSVLNVLAVILSHLLQ |
Ga0209178_14406412 | 3300027725 | Agricultural Soil | MDPNTHAFVLATAAITSIVFAISVMNILAVILSHLYQ |
Ga0209689_11199922 | 3300027748 | Soil | MRLDPNTHAFVVATAGLTSIAFMVSFLNVLAVILSHVLN |
Ga0209701_103075473 | 3300027862 | Vadose Zone Soil | MDPNTHAFVLATALITSISFVVFALNLLALILSHVLS |
Ga0209283_107758072 | 3300027875 | Vadose Zone Soil | PTGRTLEMDPNTHAFVLATALITSISFVVFALNLLALILSHVLS |
Ga0209590_100024465 | 3300027882 | Vadose Zone Soil | LEPQTHAFVQATAVITSIAFTVSVLNVLAVVLSHVLG |
Ga0209590_100725811 | 3300027882 | Vadose Zone Soil | LSLDPNTHAFVLATALMTSIAFAVSAMNILAVILSHLMR |
Ga0209590_105937062 | 3300027882 | Vadose Zone Soil | MGMDPNTHALVLATAAITSIAFAVSVMNVLAVILSHLLA |
Ga0137415_111269681 | 3300028536 | Vadose Zone Soil | LDPQTQAFVYATAAITSVAFTVSVLNVLAVVLSHVLS |
Ga0307321_10632761 | 3300028704 | Soil | LDPQTQAFVHATAAITSIVFAISVLNVLAVVLSHVL |
Ga0307293_102646581 | 3300028711 | Soil | LDPQTQAFVHATAAITSIVFTISILNVLAVVLSHVLR |
Ga0307313_100002388 | 3300028715 | Soil | LDPVTEVFVYATAAITSVAFTVSALNVLAVVLSHVLS |
Ga0307313_100699472 | 3300028715 | Soil | LDPHTHAFVQATAVITSIAFTVSVLNVLAVVLSHVLQ |
Ga0307298_100955942 | 3300028717 | Soil | MRGGVRLDPQTQAFVHATAAITSIVFTISVLNVLAVVLSHVLR |
Ga0307315_100006071 | 3300028721 | Soil | LDPQTQAFVHATAAITSIVFAISVLNVLAVVLSHV |
Ga0307504_101498822 | 3300028792 | Soil | MRGGVRLDPQTHAFVHATAAITSIVFTISVLNVLAVVLSHVLR |
Ga0307287_103414592 | 3300028796 | Soil | VDPQTHAFVCATAAITSIAFTISVLNVLAVVLSNVLN |
Ga0307284_100755662 | 3300028799 | Soil | MDPQTQAFVHMAAAITSIVFAISVLNVLAVVLSHVMR |
Ga0307284_100903692 | 3300028799 | Soil | LDPQTQVFVYATAAITSIAFAVSVLNVLAVVLSHVMR |
Ga0307503_100878902 | 3300028802 | Soil | MVRPGDGVNLDPNTQAFVYATALITSIAFAVAVLNILAVVLSYVLQ |
Ga0307503_103152192 | 3300028802 | Soil | GVNLDPTTHAFVCATAFITSVAFMVSVLNVLAVVLSHVLR |
Ga0307281_101257922 | 3300028803 | Soil | VTWFEQGEEMNLDPNTQAFVYATALITSVAFAVAVLNVLAVVLSHVLN |
Ga0307305_101427052 | 3300028807 | Soil | CSQGEGELDPQTHAFVCATAAITSIAFTISVLNVLAVVLSNVLN |
Ga0307310_100062391 | 3300028824 | Soil | NLDPNTQAFVYATALITSIAFAVAVLNILAVVLSHVLQ |
Ga0307312_105081612 | 3300028828 | Soil | MVLQGRAELDPQTQAFVQATALITSIAFTVSVLNVLAVVLSHVLS |
Ga0307312_109843132 | 3300028828 | Soil | LDPQTHAFVCATAAITSIAFTISVLNVLAVVLSNVLN |
Ga0307308_100522931 | 3300028884 | Soil | DGSGRGRGNLDPNTQAFVYATALITSTAFAVAVLNILAVVLSHVLQ |
Ga0307308_101112061 | 3300028884 | Soil | DPNTQAFVYATAFLTSVAFMVAVLNVLAVVLSHVLR |
Ga0307308_101152292 | 3300028884 | Soil | MRMDPNTRALVLATAGITSVAFAISVMNVLAVILSHLLV |
Ga0307498_100196182 | 3300031170 | Soil | LDPQTQAFVHATAAITSIVFTISVLNVIAVVLSHLLR |
Ga0307495_100672201 | 3300031199 | Soil | PNTQAFVYATALITSIAFAVAVLNILAVVLSHVLQ |
Ga0307497_106277892 | 3300031226 | Soil | MVRAGDGVNLDPNTQAFVYATALITSIAFAVAVLNILAVVLSYVLQ |
Ga0307469_111086971 | 3300031720 | Hardwood Forest Soil | DPQTQVFVYATAAITSIVFTISVLNVLAVVLSHVLR |
Ga0307469_118807102 | 3300031720 | Hardwood Forest Soil | MVLAGIEGEMRLDPATQAFVYATAFITSVAFTVSVLNVLAVILSHVLN |
Ga0310906_107954031 | 3300032013 | Soil | TSCGREGVRLDPQTQAFVHATAAITSIVFTISVLNVIAVVLSHVLR |
Ga0307471_1003004682 | 3300032180 | Hardwood Forest Soil | LEPQTQVFVYATAAITSIVFTISVLNVLAVVLSHVLR |
Ga0307472_1002059262 | 3300032205 | Hardwood Forest Soil | LDPQTQVFVYATAAITSIVFTISVLNVIAVVLSHVLR |
⦗Top⦘ |