| Basic Information | |
|---|---|
| Family ID | F037712 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDIWMHGALLAGVDLR |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.04 % |
| % of genes near scaffold ends (potentially truncated) | 35.33 % |
| % of genes from short scaffolds (< 2000 bps) | 91.62 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.844 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.755 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.156 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.305 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.06% β-sheet: 0.00% Coil/Unstructured: 94.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 53.29 |
| PF12680 | SnoaL_2 | 16.17 |
| PF07730 | HisKA_3 | 1.20 |
| PF00196 | GerE | 1.20 |
| PF08922 | DUF1905 | 0.60 |
| PF14026 | DUF4242 | 0.60 |
| PF03861 | ANTAR | 0.60 |
| PF13546 | DDE_5 | 0.60 |
| PF00532 | Peripla_BP_1 | 0.60 |
| PF00872 | Transposase_mut | 0.60 |
| PF13185 | GAF_2 | 0.60 |
| PF01872 | RibD_C | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 53.29 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.20 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.20 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.20 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.20 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.60 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.60 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.60 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.84 % |
| Unclassified | root | N/A | 22.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig129404 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 2124908016|OU_2_1_1_newblercontig65747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1072 | Open in IMG/M |
| 3300001867|JGI12627J18819_10421556 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005172|Ga0066683_10043822 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
| 3300005329|Ga0070683_101459083 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005332|Ga0066388_100196645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2634 | Open in IMG/M |
| 3300005337|Ga0070682_101690445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300005354|Ga0070675_100556570 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005435|Ga0070714_100764481 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005435|Ga0070714_102107762 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005436|Ga0070713_101822303 | Not Available | 590 | Open in IMG/M |
| 3300005436|Ga0070713_102440294 | Not Available | 505 | Open in IMG/M |
| 3300005518|Ga0070699_100763541 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005561|Ga0066699_10257413 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300005563|Ga0068855_100406878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1490 | Open in IMG/M |
| 3300005764|Ga0066903_105419717 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005764|Ga0066903_108127807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300005983|Ga0081540_1001360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 21209 | Open in IMG/M |
| 3300005985|Ga0081539_10150117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1122 | Open in IMG/M |
| 3300006580|Ga0074049_12881819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 875 | Open in IMG/M |
| 3300006755|Ga0079222_11012890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 716 | Open in IMG/M |
| 3300006800|Ga0066660_10776035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 781 | Open in IMG/M |
| 3300006847|Ga0075431_100720152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 975 | Open in IMG/M |
| 3300007255|Ga0099791_10084226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1452 | Open in IMG/M |
| 3300009036|Ga0105244_10143762 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300009038|Ga0099829_10637930 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300009098|Ga0105245_13061496 | Not Available | 518 | Open in IMG/M |
| 3300009137|Ga0066709_101786489 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300009520|Ga0116214_1084108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1166 | Open in IMG/M |
| 3300009839|Ga0116223_10294733 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300010043|Ga0126380_10705263 | Not Available | 812 | Open in IMG/M |
| 3300010047|Ga0126382_12196678 | Not Available | 531 | Open in IMG/M |
| 3300010048|Ga0126373_10117297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2485 | Open in IMG/M |
| 3300010048|Ga0126373_10630080 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300010048|Ga0126373_11184941 | Not Available | 830 | Open in IMG/M |
| 3300010048|Ga0126373_11824691 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010152|Ga0126318_11189168 | Not Available | 613 | Open in IMG/M |
| 3300010301|Ga0134070_10072766 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300010321|Ga0134067_10063585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1210 | Open in IMG/M |
| 3300010322|Ga0134084_10466046 | Not Available | 506 | Open in IMG/M |
| 3300010326|Ga0134065_10284063 | Not Available | 628 | Open in IMG/M |
| 3300010336|Ga0134071_10291463 | Not Available | 818 | Open in IMG/M |
| 3300010343|Ga0074044_10149318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1564 | Open in IMG/M |
| 3300010359|Ga0126376_10285871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1425 | Open in IMG/M |
| 3300010359|Ga0126376_12069864 | Not Available | 612 | Open in IMG/M |
| 3300010364|Ga0134066_10145289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 739 | Open in IMG/M |
| 3300010364|Ga0134066_10152509 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300010366|Ga0126379_11371040 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300010366|Ga0126379_13201890 | Not Available | 548 | Open in IMG/M |
| 3300010371|Ga0134125_11213656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 824 | Open in IMG/M |
| 3300010376|Ga0126381_100087397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3944 | Open in IMG/M |
| 3300010376|Ga0126381_101769218 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010397|Ga0134124_13016085 | Not Available | 515 | Open in IMG/M |
| 3300010867|Ga0126347_1370015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1175 | Open in IMG/M |
| 3300010937|Ga0137776_1588042 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300011106|Ga0151489_1110885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300011107|Ga0151490_1160162 | Not Available | 598 | Open in IMG/M |
| 3300011120|Ga0150983_12082380 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300011270|Ga0137391_11290888 | Not Available | 577 | Open in IMG/M |
| 3300012096|Ga0137389_10211451 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300012198|Ga0137364_11370866 | Not Available | 524 | Open in IMG/M |
| 3300012349|Ga0137387_10433156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300012355|Ga0137369_10944456 | Not Available | 576 | Open in IMG/M |
| 3300012492|Ga0157335_1003844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 984 | Open in IMG/M |
| 3300012495|Ga0157323_1006257 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012496|Ga0157353_1010110 | Not Available | 769 | Open in IMG/M |
| 3300012503|Ga0157313_1035983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300012507|Ga0157342_1018120 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300012582|Ga0137358_10251512 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300012948|Ga0126375_10389297 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300012958|Ga0164299_10766731 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012961|Ga0164302_10595991 | Not Available | 800 | Open in IMG/M |
| 3300012961|Ga0164302_10871069 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012971|Ga0126369_12795477 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012971|Ga0126369_13133305 | Not Available | 541 | Open in IMG/M |
| 3300012971|Ga0126369_13450581 | Not Available | 518 | Open in IMG/M |
| 3300012987|Ga0164307_10433086 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300013100|Ga0157373_10248137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1259 | Open in IMG/M |
| 3300013104|Ga0157370_10607300 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300013105|Ga0157369_10313932 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300013297|Ga0157378_10215807 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300013308|Ga0157375_10976974 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300014054|Ga0120135_1088029 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300014969|Ga0157376_13131086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300015264|Ga0137403_10062333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 3806 | Open in IMG/M |
| 3300015357|Ga0134072_10014944 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300015373|Ga0132257_102069061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300016294|Ga0182041_10967429 | Not Available | 768 | Open in IMG/M |
| 3300016341|Ga0182035_11356255 | Not Available | 638 | Open in IMG/M |
| 3300016341|Ga0182035_11409295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 626 | Open in IMG/M |
| 3300016387|Ga0182040_10817439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
| 3300016445|Ga0182038_11434742 | Not Available | 619 | Open in IMG/M |
| 3300017939|Ga0187775_10093514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 998 | Open in IMG/M |
| 3300017974|Ga0187777_10217994 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300017975|Ga0187782_10484005 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300018058|Ga0187766_11422749 | Not Available | 510 | Open in IMG/M |
| 3300018433|Ga0066667_10043854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2642 | Open in IMG/M |
| 3300020582|Ga0210395_10159454 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300020583|Ga0210401_10545725 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300021358|Ga0213873_10078236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 922 | Open in IMG/M |
| 3300021374|Ga0213881_10345157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300021475|Ga0210392_10152248 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300021478|Ga0210402_10324645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1426 | Open in IMG/M |
| 3300021560|Ga0126371_11788523 | Not Available | 736 | Open in IMG/M |
| 3300022557|Ga0212123_10259779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1241 | Open in IMG/M |
| 3300024055|Ga0247794_10186929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 663 | Open in IMG/M |
| 3300024290|Ga0247667_1047709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 800 | Open in IMG/M |
| 3300025898|Ga0207692_10883928 | Not Available | 587 | Open in IMG/M |
| 3300025900|Ga0207710_10215807 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300025920|Ga0207649_10681104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 796 | Open in IMG/M |
| 3300025929|Ga0207664_10315097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1379 | Open in IMG/M |
| 3300026306|Ga0209468_1036132 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300026328|Ga0209802_1207846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 744 | Open in IMG/M |
| 3300026480|Ga0257177_1041618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 698 | Open in IMG/M |
| 3300027505|Ga0209218_1027581 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300027521|Ga0209524_1033771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1072 | Open in IMG/M |
| 3300027560|Ga0207981_1009663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1718 | Open in IMG/M |
| 3300027619|Ga0209330_1022260 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300027646|Ga0209466_1012963 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300027655|Ga0209388_1077569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 957 | Open in IMG/M |
| 3300027842|Ga0209580_10332294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 757 | Open in IMG/M |
| 3300027874|Ga0209465_10176453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300027884|Ga0209275_10308788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 879 | Open in IMG/M |
| 3300028146|Ga0247682_1046534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 781 | Open in IMG/M |
| 3300028380|Ga0268265_11467602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 685 | Open in IMG/M |
| 3300031543|Ga0318516_10039400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2533 | Open in IMG/M |
| 3300031543|Ga0318516_10154116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1321 | Open in IMG/M |
| 3300031544|Ga0318534_10010263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 4672 | Open in IMG/M |
| 3300031546|Ga0318538_10574504 | Not Available | 611 | Open in IMG/M |
| 3300031564|Ga0318573_10430548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 709 | Open in IMG/M |
| 3300031640|Ga0318555_10748682 | Not Available | 527 | Open in IMG/M |
| 3300031668|Ga0318542_10586329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300031680|Ga0318574_10122221 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300031680|Ga0318574_10361011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 847 | Open in IMG/M |
| 3300031713|Ga0318496_10147704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1282 | Open in IMG/M |
| 3300031718|Ga0307474_10447255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1010 | Open in IMG/M |
| 3300031724|Ga0318500_10242581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 872 | Open in IMG/M |
| 3300031736|Ga0318501_10095093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1478 | Open in IMG/M |
| 3300031748|Ga0318492_10481388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 657 | Open in IMG/M |
| 3300031764|Ga0318535_10404079 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031770|Ga0318521_10065092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1925 | Open in IMG/M |
| 3300031797|Ga0318550_10651298 | Not Available | 505 | Open in IMG/M |
| 3300031805|Ga0318497_10051588 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300031845|Ga0318511_10115011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1154 | Open in IMG/M |
| 3300031846|Ga0318512_10610438 | Not Available | 557 | Open in IMG/M |
| 3300031859|Ga0318527_10308697 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031893|Ga0318536_10389093 | Not Available | 704 | Open in IMG/M |
| 3300031894|Ga0318522_10037822 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300031897|Ga0318520_10390404 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300031910|Ga0306923_10731009 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300031941|Ga0310912_11345402 | Not Available | 540 | Open in IMG/M |
| 3300031942|Ga0310916_10578936 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300031981|Ga0318531_10329933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 689 | Open in IMG/M |
| 3300032025|Ga0318507_10487398 | Not Available | 536 | Open in IMG/M |
| 3300032041|Ga0318549_10351995 | Not Available | 663 | Open in IMG/M |
| 3300032043|Ga0318556_10011009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3779 | Open in IMG/M |
| 3300032051|Ga0318532_10221872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 671 | Open in IMG/M |
| 3300032054|Ga0318570_10166610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → unclassified Dactylosporangium → Dactylosporangium sp. | 989 | Open in IMG/M |
| 3300032075|Ga0310890_10133662 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300032770|Ga0335085_10024213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8570 | Open in IMG/M |
| 3300032828|Ga0335080_10062926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4110 | Open in IMG/M |
| 3300032898|Ga0335072_11230773 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300032955|Ga0335076_10933631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 749 | Open in IMG/M |
| 3300033004|Ga0335084_10399107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1417 | Open in IMG/M |
| 3300034090|Ga0326723_0112993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora | 1179 | Open in IMG/M |
| 3300034818|Ga0373950_0114534 | Not Available | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.40% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.20% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.20% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.20% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 1.20% | |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.60% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.60% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.60% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.60% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.60% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.60% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.60% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01818880 | 2124908016 | VSCQPTPLGVAGFMGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR | |
| OU_02049330 | 2124908016 | VSCQPTPLGVAAFTGPPRLTGLGNQISGVLGGELP | |
| JGI12627J18819_104215562 | 3300001867 | Forest Soil | RLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0066683_100438223 | 3300005172 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELSQDIWMHGALLAGVDLR* |
| Ga0070683_1014590832 | 3300005329 | Corn Rhizosphere | VAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0066388_1001966454 | 3300005332 | Tropical Forest Soil | VAGFTGPPRLIGQISGVLGGELPQDIWMHGALLAGVDLREPVSSW |
| Ga0070682_1016904451 | 3300005337 | Corn Rhizosphere | VRCQPTPLGVARFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0070675_1005565702 | 3300005354 | Miscanthus Rhizosphere | PQVSCQPTPLGVAGFTGTPRLTGLGNQIPGVLGGELSQDIWMHGAPRVDLR* |
| Ga0070714_1007644812 | 3300005435 | Agricultural Soil | MAGFTGPPRLDGLGDQILVAVGSELPEDIWMHGALLTRVDLR* |
| Ga0070714_1021077621 | 3300005435 | Agricultural Soil | VAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVGLR* |
| Ga0070713_1018223031 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VSCQPTPLGVAGFMGPPRLTGLGNQIPGVLSGELSQDIWMHGALLAGVDLR* |
| Ga0070713_1024402941 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLL |
| Ga0070699_1007635412 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMRGALLAGVDFR* |
| Ga0066699_102574132 | 3300005561 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPEDVWMHGVLLAGVDLR* |
| Ga0068855_1004068781 | 3300005563 | Corn Rhizosphere | VSCQPTPLSVAGFTGPPRLTGLGNPIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0066903_1054197171 | 3300005764 | Tropical Forest Soil | VSCQPTPLRVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMNGVLLAGVDLR* |
| Ga0066903_1081278072 | 3300005764 | Tropical Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMQGVLLAGVDLR* |
| Ga0081540_100136022 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0081539_101501172 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VSCQPTPLGVAGFTGPPRLTGLGNQISDALGGELPQDIWMHGALLAGVDLR* |
| Ga0074049_128818191 | 3300006580 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDV |
| Ga0079222_110128901 | 3300006755 | Agricultural Soil | VSCQPTPLSVAGFTGPPRLTGLGNPIPGVLGGELPQDIWMHGALLAGVDLR* |
| Ga0066660_107760352 | 3300006800 | Soil | VSCQPTPLGGAGFTGLPRLTGLGNQIPGVLSGELP |
| Ga0075431_1007201522 | 3300006847 | Populus Rhizosphere | VSCQPTPLGVAGFTGPPRLIGLGKQIPGVPSGELPQDF |
| Ga0099791_100842262 | 3300007255 | Vadose Zone Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0105244_101437622 | 3300009036 | Miscanthus Rhizosphere | VSCQPTPLGGAGFTGPPRLTGLGDQIQGVLGGELPQDIWMHGALLAGVDLR* |
| Ga0099829_106379302 | 3300009038 | Vadose Zone Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDIWMHGALLAGVDLR* |
| Ga0105245_130614961 | 3300009098 | Miscanthus Rhizosphere | VSCQPTPLGGAGFTGPPRLTGLGNQILGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0066709_1017864891 | 3300009137 | Grasslands Soil | PRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0116214_10841081 | 3300009520 | Peatlands Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGA |
| Ga0116223_102947332 | 3300009839 | Peatlands Soil | VSCRPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0126380_107052632 | 3300010043 | Tropical Forest Soil | MGPPRLTSLGNQLPDVVGGEPPQDVWMHGVLLAGVDLR* |
| Ga0126382_121966781 | 3300010047 | Tropical Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDIWMHGALP |
| Ga0126373_101172974 | 3300010048 | Tropical Forest Soil | VASFMGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0126373_106300801 | 3300010048 | Tropical Forest Soil | VRCQPTPLGVAGFTGPLRLSGLGNQIPDVLSGELPQDVRMHGALLAGVDLR* |
| Ga0126373_111849411 | 3300010048 | Tropical Forest Soil | VSCPSTALAVAGFTGPPCLTGRGNQIPDVLGGELLQDVWMHGVLLAGVDSR* |
| Ga0126373_118246911 | 3300010048 | Tropical Forest Soil | TGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0126318_111891682 | 3300010152 | Soil | VHCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGA |
| Ga0134070_100727662 | 3300010301 | Grasslands Soil | VSCQPTPLGVAGFTAPPRLTGLCNQIQGVLGGELPQDIWMHGALLAGVGLR* |
| Ga0134067_100635852 | 3300010321 | Grasslands Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVRMHGVLLAGVDLR* |
| Ga0134084_104660461 | 3300010322 | Grasslands Soil | VSCQPTPLGVAGFTSPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0134065_102840632 | 3300010326 | Grasslands Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDVRMHCALLAGVDLR |
| Ga0134071_102914632 | 3300010336 | Grasslands Soil | VSCQPTPLGVAGFTGPPRLTGLCNQIQGVLGGELPQDIWMHGALLAGVDLR* |
| Ga0074044_101493182 | 3300010343 | Bog Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQILGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0126376_102858712 | 3300010359 | Tropical Forest Soil | VSCQPTPLGVVGFTGPPRLTGLGNQIPDVLSGELPQDIWMHGALLAGVDLRNRYR |
| Ga0126376_120698641 | 3300010359 | Tropical Forest Soil | VRCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQHVWMHGVFLAGVDLR* |
| Ga0134066_101452892 | 3300010364 | Grasslands Soil | LSCQLTPLGVAGFTGSPRLIGLGNQVPGVLGGEMPQDIWMHGALLAAVDLR* |
| Ga0134066_101525091 | 3300010364 | Grasslands Soil | PLGVTGFTGPPRLTGLGNQIPDVLGGELPHDIWMHGALLAGVDLR* |
| Ga0126379_113710402 | 3300010366 | Tropical Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQISGVLGGELSQGVWMHGVLFAGVDLR* |
| Ga0126379_132018901 | 3300010366 | Tropical Forest Soil | VSCQPTPPGVAGFTGPPRLTGRGNQIPGVLGGELPQGVWMHGVLLAGVDLR* |
| Ga0134125_112136561 | 3300010371 | Terrestrial Soil | VSCQPTPLSVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMPGHAA* |
| Ga0126381_1000873971 | 3300010376 | Tropical Forest Soil | MGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0126381_1017692182 | 3300010376 | Tropical Forest Soil | VSCQPTPLGVAGFTGPPRPTGHGNQIPGVLGGDLPQDVWMHGVLLAGVDLR* |
| Ga0134124_130160852 | 3300010397 | Terrestrial Soil | VRCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0126347_13700151 | 3300010867 | Boreal Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMH |
| Ga0137776_15880422 | 3300010937 | Sediment | VSCQPKQLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLVGVDLR* |
| Ga0151489_11108852 | 3300011106 | Soil | VSGQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0151490_11601621 | 3300011107 | Soil | VSCHPTPLGVTGFTGPPRLTGLGNQIPGVLSGELPQDVRMHGVLLAGVDLR* |
| Ga0150983_120823803 | 3300011120 | Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPVVLSGELPQDVRMHGVLLAGVDLR* |
| Ga0137391_112908881 | 3300011270 | Vadose Zone Soil | VRCQPTPLGVAGFTGPHRLTGLGHQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0137389_102114512 | 3300012096 | Vadose Zone Soil | VRCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0137364_113708661 | 3300012198 | Vadose Zone Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGLDLR* |
| Ga0137387_104331562 | 3300012349 | Vadose Zone Soil | VRCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLARVDLR* |
| Ga0137369_109444561 | 3300012355 | Vadose Zone Soil | VSCQPTPLGVAGFTGPPRLTGLGNPIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0157335_10038442 | 3300012492 | Arabidopsis Rhizosphere | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHDALLAGVDLR* |
| Ga0157323_10062571 | 3300012495 | Arabidopsis Rhizosphere | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGEQPQDIWMHGALLAGVDLR* |
| Ga0157353_10101102 | 3300012496 | Unplanted Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVNLC* |
| Ga0157313_10359832 | 3300012503 | Arabidopsis Rhizosphere | VRCQPTPLGVACFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0157342_10181201 | 3300012507 | Arabidopsis Rhizosphere | VPLGVAGFTGPPRLTGLGNQIPGVLSDELPQDIWMHGVLLAGVNLR* |
| Ga0137358_102515122 | 3300012582 | Vadose Zone Soil | VSCQPTPLGVAGFTGPPRFTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0126375_103892972 | 3300012948 | Tropical Forest Soil | VSCQPTPLGVEGFTGPPRLSGLGNQIPGVLGGELPQDIWMHGALRVDLR* |
| Ga0164299_107667312 | 3300012958 | Soil | AGFTGPPRLTGLGNQMPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0164302_105959912 | 3300012961 | Soil | VSCQPTPLGVAGFTGPPRLTGFGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0164302_108710691 | 3300012961 | Soil | VRCQPTPLGVAGFTGPPRLTGLGNQIQGVLGDALPADIWMHGALLAGVDLR* |
| Ga0126369_127954772 | 3300012971 | Tropical Forest Soil | PRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0126369_131333052 | 3300012971 | Tropical Forest Soil | VSCQPTPPGVASFAGPPRRTSLGNQIPNVAGGEQPQDIWMHGALLTGVDLR* |
| Ga0126369_134505812 | 3300012971 | Tropical Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHG |
| Ga0164307_104330861 | 3300012987 | Soil | VSCQPAPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0157373_102481372 | 3300013100 | Corn Rhizosphere | VSCQPTPLGGAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0157370_106073002 | 3300013104 | Corn Rhizosphere | VSCQPAPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0157369_103139321 | 3300013105 | Corn Rhizosphere | VSCQPTPLGVAGFTGQPRLTGLGNQIPGVLGGELQQDVWMHGVLLAGSI |
| Ga0157378_102158073 | 3300013297 | Miscanthus Rhizosphere | VRCQPTPLGGARFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0157375_109769742 | 3300013308 | Miscanthus Rhizosphere | AGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0120135_10880291 | 3300014054 | Permafrost | GFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0157376_131310861 | 3300014969 | Miscanthus Rhizosphere | TPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0137403_100623335 | 3300015264 | Vadose Zone Soil | VSCQPTPLGVAGCTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR* |
| Ga0134072_100149442 | 3300015357 | Grasslands Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDVRMHGVLLAGVDLR* |
| Ga0132257_1020690611 | 3300015373 | Arabidopsis Rhizosphere | VSCQPTPLGVARFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR* |
| Ga0182041_109674292 | 3300016294 | Soil | VSCQPTPPGVASFMGPPRLTSLSNQLPDVAGGEPPQDVWMHGVLLAGVDLR |
| Ga0182035_113562552 | 3300016341 | Soil | VSCQPTPPGVASFMGPPRLTSLGNQPPDVVGGEPPQDVWMHGVLLAGVDLR |
| Ga0182035_114092952 | 3300016341 | Soil | VAGFTGPPRLTGLGNQIPGVLGGELPQDIWMHGALLAG |
| Ga0182040_108174392 | 3300016387 | Soil | MGPPRLTSLGNQLPDVVGGEPPHDVWMHGVLLAGVDLR |
| Ga0182038_114347421 | 3300016445 | Soil | VSCQPTPLGVAGFTDPPRLTGLGNQIPDVAGGDLPQDIWMHGALLAGVDLRLTGIEL |
| Ga0187775_100935143 | 3300017939 | Tropical Peatland | VSCQPTPPGVASFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR |
| Ga0187777_102179943 | 3300017974 | Tropical Peatland | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVD |
| Ga0187782_104840053 | 3300017975 | Tropical Peatland | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR |
| Ga0187766_114227492 | 3300018058 | Tropical Peatland | MPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGA |
| Ga0066667_100438541 | 3300018433 | Grasslands Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR |
| Ga0210395_101594542 | 3300020582 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNHIPGVLSGKLPQDIWMHGALLAGVDLR |
| Ga0210401_105457252 | 3300020583 | Soil | VSCQPTPPGVAGFMGPPRLTSLGNQLPDVVGGEPPQDVWMHGVLLAGVDLR |
| Ga0213873_100782363 | 3300021358 | Rhizosphere | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGLDRR |
| Ga0213881_103451571 | 3300021374 | Exposed Rock | GFMGSPRLAGLGDQLADVPGGELPQYVWMHGVLLAGVDLG |
| Ga0210392_101522482 | 3300021475 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELLQDIWMHGALLAGVDLR |
| Ga0210402_103246453 | 3300021478 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELLQDIW |
| Ga0126371_117885231 | 3300021560 | Tropical Forest Soil | VAGFTGPPRLTGLGNQIPGVLSGELPLDIWMHGALLTGVDLR |
| Ga0212123_102597791 | 3300022557 | Iron-Sulfur Acid Spring | VSCQPTPLGVAGFAGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR |
| Ga0247794_101869292 | 3300024055 | Soil | VSCQPTPLGVAGFTGPPRLAGLGNQIPGVPGGELPQDVWMHGVLLA |
| Ga0247667_10477092 | 3300024290 | Soil | VSCQPTPLSVAGFTGPPRLTGLGNPIPGVLSGELPQDIWMHGALLAGVDLR |
| Ga0207692_108839282 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VSCQPTPLGGAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR |
| Ga0207710_102158072 | 3300025900 | Switchgrass Rhizosphere | VRCQPTPLGVARFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDLR |
| Ga0207649_106811042 | 3300025920 | Corn Rhizosphere | VSCQPTPLGVAGFTGPPRLIGLGNQIPGVRGGELPQDVWMHGVLLAGSIFVNRDRAG |
| Ga0207664_103150974 | 3300025929 | Agricultural Soil | VAGFTGPPRLTGLGNQIPGVLGGELPQDVWMHGVLLAGVDFR |
| Ga0209468_10361322 | 3300026306 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELSQDIWMHGALLAGVDLR |
| Ga0209802_12078462 | 3300026328 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHG |
| Ga0257177_10416182 | 3300026480 | Soil | MGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALL |
| Ga0209218_10275812 | 3300027505 | Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGEPPQDVWMQGVLLAGVDLR |
| Ga0209524_10337712 | 3300027521 | Forest Soil | VSCQPTPLGVAGFTGPPRLTGRGNQIPGVLSGELPQDIWMHGALLAGVDLR |
| Ga0207981_10096632 | 3300027560 | Soil | MAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR |
| Ga0209330_10222602 | 3300027619 | Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGMLGGEPPQDVWMQGVLLAGVDLR |
| Ga0209466_10129632 | 3300027646 | Tropical Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDIWMHGALLAGVDLR |
| Ga0209388_10775691 | 3300027655 | Vadose Zone Soil | VCCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMRG |
| Ga0209580_103322941 | 3300027842 | Surface Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAG |
| Ga0209465_101764531 | 3300027874 | Tropical Forest Soil | MGPPRLTSLGNQLPDVVGGEPPQDVWMHGVLLGGVDLRQPGS |
| Ga0209275_103087882 | 3300027884 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQD |
| Ga0247682_10465341 | 3300028146 | Soil | VRCQPTPLGVARFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR |
| Ga0268265_114676022 | 3300028380 | Switchgrass Rhizosphere | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVFSGELPQDIWMHGAL |
| Ga0318516_100394003 | 3300031543 | Soil | VSCQPTPLGVAGFIGPPRLTGLGNQLPDVLGGELPQDV |
| Ga0318516_101541162 | 3300031543 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPDVVGGELPQDVSMHGVLLAGVDLR |
| Ga0318534_100102636 | 3300031544 | Soil | VSCQPTPPGVASFMGPPRLTSLGNQLPDVVGGEPPHDVWMHGVLLAGVDLR |
| Ga0318538_105745041 | 3300031546 | Soil | VAGFTGPPRLTGLGNQIPDVAGGDLPQDIWMHGALLAGVDLR |
| Ga0318573_104305482 | 3300031564 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDTW |
| Ga0318555_107486822 | 3300031640 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDTWMH |
| Ga0318542_105863292 | 3300031668 | Soil | VSCQPTPPGVAGFTGPPRLTGLGNQLPDLGGGELPQDVW |
| Ga0318574_101222211 | 3300031680 | Soil | VGCPPAPPGVTGFTGPPRLTGLGNQLPDVVGGELPQDVWMHGVLLAGVDFR |
| Ga0318574_103610111 | 3300031680 | Soil | VSCQPTPPGVASFMGPPRLTSLSNQLPDVVGGEPPQDVWMHGVLLAGVDLP |
| Ga0318496_101477044 | 3300031713 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMQGVLLAGVDLR |
| Ga0307474_104472551 | 3300031718 | Hardwood Forest Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDIWM |
| Ga0318500_102425812 | 3300031724 | Soil | VSCQPTPPGVAGFMGPPRLTSLGNQRPNVVGGELPQNVWMHGVLLAGVDLR |
| Ga0318501_100950932 | 3300031736 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPDVVGGELPHYVSMHGVLLAGVDLR |
| Ga0318492_104813881 | 3300031748 | Soil | VSCQPTPLGVAGFTGPPRLTGPGNQIPGVLSGELPQGIWMHGA |
| Ga0318535_104040792 | 3300031764 | Soil | PPQVSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMQGVLLAGVDLR |
| Ga0318521_100650921 | 3300031770 | Soil | VSCQPTPLGVAGFIGPPRLTGLGNQLPDVLGGELPQ |
| Ga0318550_106512982 | 3300031797 | Soil | VSRQPTPPGVASFMGPPRLTSLGNQLPDVVGGEPPQD |
| Ga0318497_100515881 | 3300031805 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGKLPQDIWMHGALLAGVDLR |
| Ga0318511_101150112 | 3300031845 | Soil | VSCQPTPLGVAGFTGPPRLTGPGNQIPGVLSGELPQDIWMHGALLAGVDRR |
| Ga0318512_106104381 | 3300031846 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDIWMHSALPGWIFVNRY |
| Ga0310892_103098392 | 3300031858 | Soil | VAGFTGPPRLIGLGKQIPGVPSGELPQDFWMHGVLLAGSIFVNRDRAGVL |
| Ga0318527_103086971 | 3300031859 | Soil | GVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMQGVLLAGVDLR |
| Ga0318536_103890932 | 3300031893 | Soil | VSCQPTPPGVASFMGPPRLTSLGNQLPDVVGGEPPHDVCMHGVLLAGVDLR |
| Ga0318522_100378222 | 3300031894 | Soil | VSCQPTPLGVAGFTDPPRLTGLGNQIPDVVGGELPQDVSMHGVLLAGVDLR |
| Ga0318520_103904041 | 3300031897 | Soil | PLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVWMQGVLLAGVDLR |
| Ga0306923_107310092 | 3300031910 | Soil | VGCQPTPLGVAGFTGPPRLTGLGNQLPDVVGGELPQDVWVHGVLFAGVGLR |
| Ga0310912_113454021 | 3300031941 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQAIWMHGA |
| Ga0310916_105789362 | 3300031942 | Soil | VAGFTGPPRLTGLGNQIPGVLGGELPQDVWMQGVLLAGVDLR |
| Ga0318531_103299331 | 3300031981 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDVW |
| Ga0318507_104873982 | 3300032025 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPDVVGGELPQD |
| Ga0318549_103519952 | 3300032041 | Soil | LTASSELPPTPLGVAGVTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGVDLR |
| Ga0318556_100110092 | 3300032043 | Soil | VSCQPTPLGVAGFMGPPRLTSLGNQLPDVVGGEPPHDVWMHGVLLAGVDLR |
| Ga0318532_102218721 | 3300032051 | Soil | MAGFTGPPRLTGRGNQIPGVLGGELPQDVWMHGVLLAGVDLR |
| Ga0318570_101666102 | 3300032054 | Soil | VSCQPTPLGVAGFIGPPRLTGLGNQLPDVLGGELPQD |
| Ga0310890_101336622 | 3300032075 | Soil | VSCHPTPLGVTGFTGPPRLTGLGNQIPDVLGGELPHDIWMHGALLAGVDLR |
| Ga0335085_100242132 | 3300032770 | Soil | VSCQPTPPGVASFTGPPRLTSLGNQLPDVVGGELPQDVWMHGVLLAGVDLR |
| Ga0335080_100629266 | 3300032828 | Soil | VSCQPTPPGVASFTGPPRLTSLGNQLPDVVGGEPPQDVWMHGVLLAGVDLR |
| Ga0335072_112307731 | 3300032898 | Soil | VSCQPTPPGVAGFTGPPRLTGLGNQIPGVLSGELPQD |
| Ga0335076_109336311 | 3300032955 | Soil | VSCQPTPLGVAGFTGPPRLADLGNQVPGVLSGELPQDIW |
| Ga0335084_103991072 | 3300033004 | Soil | VSCQPTPLGVAGFTGPPRLTGLGNQIPGVLSGELPQDIWMHGALLAGIDLR |
| Ga0326723_0112993_897_1052 | 3300034090 | Peat Soil | LSCQPTPLGVAGFTGSPRLIGLGNQVPGLLGGELPQDIWMHGALLAAVDLR |
| Ga0373950_0114534_215_370 | 3300034818 | Rhizosphere Soil | VRCQPTPLGVAGFTGPPRLTGLGNQIPGVLGGELPQDIWMHGALLAGVDLR |
| ⦗Top⦘ |