| Basic Information | |
|---|---|
| Family ID | F037701 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MIKSKEWRVSNRVWLGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 78.88 % |
| % of genes near scaffold ends (potentially truncated) | 20.96 % |
| % of genes from short scaffolds (< 2000 bps) | 59.88 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.874 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (31.736 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.024 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.042 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 35.53% Coil/Unstructured: 64.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF13640 | 2OG-FeII_Oxy_3 | 8.98 |
| PF02945 | Endonuclease_7 | 5.39 |
| PF13524 | Glyco_trans_1_2 | 4.19 |
| PF04973 | NMN_transporter | 2.40 |
| PF00590 | TP_methylase | 1.80 |
| PF01370 | Epimerase | 1.20 |
| PF01844 | HNH | 1.20 |
| PF05050 | Methyltransf_21 | 1.20 |
| PF00255 | GSHPx | 1.20 |
| PF08241 | Methyltransf_11 | 1.20 |
| PF12804 | NTP_transf_3 | 0.60 |
| PF13692 | Glyco_trans_1_4 | 0.60 |
| PF14025 | DUF4241 | 0.60 |
| PF09834 | DUF2061 | 0.60 |
| PF11346 | DUF3149 | 0.60 |
| PF00037 | Fer4 | 0.60 |
| PF00067 | p450 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 2.40 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 1.20 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.87 % |
| All Organisms | root | All Organisms | 37.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2199916473 | Not Available | 25101 | Open in IMG/M |
| 3300001275|B570J13894_1000017 | Not Available | 23514 | Open in IMG/M |
| 3300002408|B570J29032_109486251 | Not Available | 802 | Open in IMG/M |
| 3300002408|B570J29032_109866556 | Not Available | 1779 | Open in IMG/M |
| 3300002835|B570J40625_100076849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4362 | Open in IMG/M |
| 3300002835|B570J40625_100189441 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300003277|JGI25908J49247_10130237 | Not Available | 593 | Open in IMG/M |
| 3300003388|JGI25910J50241_10124452 | Not Available | 688 | Open in IMG/M |
| 3300005581|Ga0049081_10013090 | Not Available | 3133 | Open in IMG/M |
| 3300005581|Ga0049081_10014640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2966 | Open in IMG/M |
| 3300005581|Ga0049081_10027092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2176 | Open in IMG/M |
| 3300005581|Ga0049081_10029221 | Not Available | 2093 | Open in IMG/M |
| 3300005581|Ga0049081_10054469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1512 | Open in IMG/M |
| 3300005581|Ga0049081_10069729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1321 | Open in IMG/M |
| 3300005581|Ga0049081_10106152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
| 3300005582|Ga0049080_10006665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora acidiphila | 4010 | Open in IMG/M |
| 3300005582|Ga0049080_10023734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2141 | Open in IMG/M |
| 3300005582|Ga0049080_10039239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1645 | Open in IMG/M |
| 3300005582|Ga0049080_10043946 | Not Available | 1548 | Open in IMG/M |
| 3300005582|Ga0049080_10044907 | Not Available | 1531 | Open in IMG/M |
| 3300005582|Ga0049080_10176995 | Not Available | 709 | Open in IMG/M |
| 3300005582|Ga0049080_10228509 | Not Available | 611 | Open in IMG/M |
| 3300005582|Ga0049080_10314426 | Not Available | 504 | Open in IMG/M |
| 3300005584|Ga0049082_10176649 | Not Available | 735 | Open in IMG/M |
| 3300005584|Ga0049082_10280424 | Not Available | 559 | Open in IMG/M |
| 3300005585|Ga0049084_10283530 | Not Available | 552 | Open in IMG/M |
| 3300006639|Ga0079301_1020328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2325 | Open in IMG/M |
| 3300007735|Ga0104988_10865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 34464 | Open in IMG/M |
| 3300008116|Ga0114350_1063086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1295 | Open in IMG/M |
| 3300008120|Ga0114355_1043195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2116 | Open in IMG/M |
| 3300008953|Ga0104241_1006951 | Not Available | 789 | Open in IMG/M |
| 3300008962|Ga0104242_1016722 | Not Available | 1277 | Open in IMG/M |
| 3300008962|Ga0104242_1060435 | Not Available | 635 | Open in IMG/M |
| 3300009068|Ga0114973_10029727 | Not Available | 3315 | Open in IMG/M |
| 3300009068|Ga0114973_10094078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora acidiphila | 1709 | Open in IMG/M |
| 3300009152|Ga0114980_10029795 | Not Available | 3379 | Open in IMG/M |
| 3300009152|Ga0114980_10031644 | Not Available | 3268 | Open in IMG/M |
| 3300009152|Ga0114980_10077523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1995 | Open in IMG/M |
| 3300009152|Ga0114980_10119190 | Not Available | 1573 | Open in IMG/M |
| 3300009155|Ga0114968_10003932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11127 | Open in IMG/M |
| 3300009155|Ga0114968_10019746 | Not Available | 4651 | Open in IMG/M |
| 3300009155|Ga0114968_10028205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3786 | Open in IMG/M |
| 3300009159|Ga0114978_10012695 | Not Available | 6429 | Open in IMG/M |
| 3300009159|Ga0114978_10097679 | Not Available | 1943 | Open in IMG/M |
| 3300009159|Ga0114978_10409886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300009160|Ga0114981_10021935 | Not Available | 3681 | Open in IMG/M |
| 3300009160|Ga0114981_10594341 | Not Available | 588 | Open in IMG/M |
| 3300009161|Ga0114966_10787584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300009164|Ga0114975_10031277 | Not Available | 3186 | Open in IMG/M |
| 3300009181|Ga0114969_10522194 | Not Available | 661 | Open in IMG/M |
| 3300009184|Ga0114976_10070608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2026 | Open in IMG/M |
| 3300010885|Ga0133913_11303062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1855 | Open in IMG/M |
| 3300010885|Ga0133913_12505682 | Not Available | 1257 | Open in IMG/M |
| 3300010885|Ga0133913_12843976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1163 | Open in IMG/M |
| 3300011010|Ga0139557_1033285 | Not Available | 907 | Open in IMG/M |
| 3300013004|Ga0164293_10016201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6255 | Open in IMG/M |
| 3300013004|Ga0164293_10175131 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300013004|Ga0164293_10184596 | Not Available | 1520 | Open in IMG/M |
| 3300013004|Ga0164293_10512128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300013004|Ga0164293_10724176 | Not Available | 636 | Open in IMG/M |
| 3300013005|Ga0164292_10083008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2446 | Open in IMG/M |
| 3300013005|Ga0164292_11023460 | Not Available | 514 | Open in IMG/M |
| 3300013372|Ga0177922_10450810 | Not Available | 699 | Open in IMG/M |
| 3300013372|Ga0177922_10482254 | Not Available | 646 | Open in IMG/M |
| 3300013372|Ga0177922_10817930 | Not Available | 1362 | Open in IMG/M |
| 3300013372|Ga0177922_10980298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1488 | Open in IMG/M |
| 3300017723|Ga0181362_1076796 | Not Available | 675 | Open in IMG/M |
| 3300017778|Ga0181349_1284099 | Not Available | 541 | Open in IMG/M |
| 3300020151|Ga0211736_10146138 | Not Available | 544 | Open in IMG/M |
| 3300020159|Ga0211734_10246657 | Not Available | 4278 | Open in IMG/M |
| 3300020159|Ga0211734_10930438 | Not Available | 1279 | Open in IMG/M |
| 3300020159|Ga0211734_11074324 | Not Available | 4242 | Open in IMG/M |
| 3300020160|Ga0211733_10153627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1326 | Open in IMG/M |
| 3300020160|Ga0211733_11209657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1356 | Open in IMG/M |
| 3300020161|Ga0211726_10091670 | Not Available | 7901 | Open in IMG/M |
| 3300020161|Ga0211726_10373732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1711 | Open in IMG/M |
| 3300020161|Ga0211726_10440927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3783 | Open in IMG/M |
| 3300020161|Ga0211726_10490623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2683 | Open in IMG/M |
| 3300020162|Ga0211735_11310672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
| 3300020172|Ga0211729_10010976 | Not Available | 523 | Open in IMG/M |
| 3300020172|Ga0211729_10264213 | Not Available | 508 | Open in IMG/M |
| 3300020172|Ga0211729_10556481 | Not Available | 925 | Open in IMG/M |
| 3300020172|Ga0211729_10715672 | Not Available | 718 | Open in IMG/M |
| 3300020172|Ga0211729_11451507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3263 | Open in IMG/M |
| 3300020172|Ga0211729_11466672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300020205|Ga0211731_10486053 | Not Available | 676 | Open in IMG/M |
| 3300020506|Ga0208091_1000440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7659 | Open in IMG/M |
| 3300020506|Ga0208091_1010926 | Not Available | 1127 | Open in IMG/M |
| 3300021963|Ga0222712_10717655 | Not Available | 561 | Open in IMG/M |
| 3300022752|Ga0214917_10006376 | Not Available | 12271 | Open in IMG/M |
| 3300022752|Ga0214917_10013571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7257 | Open in IMG/M |
| 3300023174|Ga0214921_10018984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7482 | Open in IMG/M |
| 3300023174|Ga0214921_10033422 | Not Available | 4960 | Open in IMG/M |
| 3300023174|Ga0214921_10034196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4882 | Open in IMG/M |
| 3300023174|Ga0214921_10063806 | Not Available | 3082 | Open in IMG/M |
| 3300023174|Ga0214921_10088082 | Not Available | 2405 | Open in IMG/M |
| 3300023174|Ga0214921_10505720 | Not Available | 572 | Open in IMG/M |
| 3300027468|Ga0209247_1023082 | Not Available | 853 | Open in IMG/M |
| 3300027608|Ga0208974_1003982 | Not Available | 5237 | Open in IMG/M |
| 3300027608|Ga0208974_1005667 | Not Available | 4282 | Open in IMG/M |
| 3300027608|Ga0208974_1006319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4011 | Open in IMG/M |
| 3300027608|Ga0208974_1011329 | Not Available | 2893 | Open in IMG/M |
| 3300027608|Ga0208974_1019896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2094 | Open in IMG/M |
| 3300027608|Ga0208974_1056034 | Not Available | 1121 | Open in IMG/M |
| 3300027659|Ga0208975_1008440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3628 | Open in IMG/M |
| 3300027659|Ga0208975_1044241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1385 | Open in IMG/M |
| 3300027659|Ga0208975_1048955 | Not Available | 1303 | Open in IMG/M |
| 3300027659|Ga0208975_1050960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1007794 | Not Available | 11143 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1066330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1941 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1119651 | Not Available | 1211 | Open in IMG/M |
| 3300027733|Ga0209297_1001500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13559 | Open in IMG/M |
| 3300027734|Ga0209087_1026791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2786 | Open in IMG/M |
| 3300027736|Ga0209190_1039109 | Not Available | 2479 | Open in IMG/M |
| 3300027736|Ga0209190_1098006 | Not Available | 1357 | Open in IMG/M |
| 3300027736|Ga0209190_1176415 | Not Available | 901 | Open in IMG/M |
| 3300027756|Ga0209444_10120525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1043 | Open in IMG/M |
| 3300027759|Ga0209296_1000731 | Not Available | 28049 | Open in IMG/M |
| 3300027770|Ga0209086_10013912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5298 | Open in IMG/M |
| 3300027770|Ga0209086_10251903 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300027782|Ga0209500_10003178 | Not Available | 11387 | Open in IMG/M |
| 3300027782|Ga0209500_10155092 | Not Available | 1074 | Open in IMG/M |
| 3300027808|Ga0209354_10050779 | Not Available | 1671 | Open in IMG/M |
| 3300027969|Ga0209191_1098171 | Not Available | 1252 | Open in IMG/M |
| 3300027971|Ga0209401_1020883 | Not Available | 3336 | Open in IMG/M |
| 3300027973|Ga0209298_10071705 | Not Available | 1559 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1021732 | Not Available | 4582 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1270904 | Not Available | 541 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1123699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10164951 | Not Available | 1274 | Open in IMG/M |
| 3300031758|Ga0315907_10763207 | Not Available | 727 | Open in IMG/M |
| 3300033816|Ga0334980_0260727 | Not Available | 681 | Open in IMG/M |
| 3300034012|Ga0334986_0083361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1947 | Open in IMG/M |
| 3300034020|Ga0335002_0176086 | Not Available | 1356 | Open in IMG/M |
| 3300034061|Ga0334987_0103221 | Not Available | 2188 | Open in IMG/M |
| 3300034061|Ga0334987_0165334 | Not Available | 1600 | Open in IMG/M |
| 3300034061|Ga0334987_0285329 | Not Available | 1103 | Open in IMG/M |
| 3300034062|Ga0334995_0018601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6250 | Open in IMG/M |
| 3300034063|Ga0335000_0412677 | Not Available | 800 | Open in IMG/M |
| 3300034066|Ga0335019_0267248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300034066|Ga0335019_0324813 | Not Available | 959 | Open in IMG/M |
| 3300034071|Ga0335028_0047327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2927 | Open in IMG/M |
| 3300034082|Ga0335020_0088169 | Not Available | 1590 | Open in IMG/M |
| 3300034093|Ga0335012_0224411 | Not Available | 985 | Open in IMG/M |
| 3300034101|Ga0335027_0022271 | Not Available | 5361 | Open in IMG/M |
| 3300034101|Ga0335027_0183940 | Not Available | 1500 | Open in IMG/M |
| 3300034101|Ga0335027_0222133 | Not Available | 1326 | Open in IMG/M |
| 3300034102|Ga0335029_0291450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
| 3300034102|Ga0335029_0467085 | Not Available | 742 | Open in IMG/M |
| 3300034102|Ga0335029_0498666 | Not Available | 707 | Open in IMG/M |
| 3300034102|Ga0335029_0560922 | Not Available | 649 | Open in IMG/M |
| 3300034103|Ga0335030_0121930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1883 | Open in IMG/M |
| 3300034103|Ga0335030_0223393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300034103|Ga0335030_0318292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
| 3300034103|Ga0335030_0687849 | Not Available | 615 | Open in IMG/M |
| 3300034104|Ga0335031_0051882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2955 | Open in IMG/M |
| 3300034106|Ga0335036_0299432 | Not Available | 1069 | Open in IMG/M |
| 3300034116|Ga0335068_0016659 | Not Available | 4569 | Open in IMG/M |
| 3300034118|Ga0335053_0477579 | Not Available | 740 | Open in IMG/M |
| 3300034200|Ga0335065_0092306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2063 | Open in IMG/M |
| 3300034200|Ga0335065_0798639 | Not Available | 529 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 31.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 17.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.20% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.60% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300002277 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200104905 | 2199352005 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNATIDFLWFWVSLEY |
| B570J13894_100001751 | 3300001275 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNATIDFLWFWVSLEY* |
| B570J29592_1058042 | 3300002277 | Freshwater | VIKSKEWRVSNKVWFSAGFSSRRFGLGFSVDKYNLSIDFVCFWINLEY* |
| B570J29032_1094862512 | 3300002408 | Freshwater | MIKSKEWRISNRVWLGVGFAPRRIGLGFSVDRFNANIDFLWFWVSLEY* |
| B570J29032_1098665565 | 3300002408 | Freshwater | KLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| B570J29032_1099073873 | 3300002408 | Freshwater | MTKYKEWRVSNRTWVSVGFNPRRFGLGFSVDRYNLSIDFVCFWINIEY* |
| B570J40625_1000768494 | 3300002835 | Freshwater | MIKSKEWRVSNRVWLGVGFSPRRIALGFSVDRFNANIDFLCFWVSLEY* |
| B570J40625_1001894416 | 3300002835 | Freshwater | VSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| JGI25908J49247_101302371 | 3300003277 | Freshwater Lake | VNTRVWVSTGFNPRRIALGFSVDKFYANIDFLWFWVTLEY* |
| JGI25910J50241_101244521 | 3300003388 | Freshwater Lake | MIRSKEWRVNTRVWVSTGFNPRRIALGFSVDKFYANIDFLWFWVTLEY* |
| Ga0049081_100130903 | 3300005581 | Freshwater Lentic | MIRSKEWRVNTRVWVSTGFNPRRIALGFSVDRFNANIDFLWFWVTIEY* |
| Ga0049081_100146406 | 3300005581 | Freshwater Lentic | MIKTKEWRVSNRVWLGVGFNPRRIALGFSVDKFNANIDFLWFWISLEY* |
| Ga0049081_100270923 | 3300005581 | Freshwater Lentic | MVKLMIKSKEWRVSNRVWLGVGFNPRRIGLGFHVDRFCINIDFLWFWVTLEY* |
| Ga0049081_100292212 | 3300005581 | Freshwater Lentic | MIKSKEWRVSNRVWLGVGFNPRRIGLGFSVDRFNANIDFLWFWVSLEY* |
| Ga0049081_100544692 | 3300005581 | Freshwater Lentic | MIKSKEWRVSNRVWVSAGFNPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0049081_100697293 | 3300005581 | Freshwater Lentic | MGKLMIKSKEWRISNRVWIGVGFAPRRIALGFSVDRFNANVDFLWFWVTLEY* |
| Ga0049081_101061521 | 3300005581 | Freshwater Lentic | KSKEWRVSNRVWLGVGFNPRRIALGFSVDRFNANIDLLWFWVSLEY* |
| Ga0049080_100066654 | 3300005582 | Freshwater Lentic | MIKSKEWRISNRVWIGVGFAPRRIALGFSVDRFNANVDFLWFWVTLEY* |
| Ga0049080_100237345 | 3300005582 | Freshwater Lentic | MIKSKEWRVSNRVWVSAGFNPRRIALGFSVDRFNANIDFLWFWVTIEY* |
| Ga0049080_100392393 | 3300005582 | Freshwater Lentic | MIKSKEWRVSNRVWLSVGFNPRRIGLGFSVDRFNVNVDFLWFWVTLEY* |
| Ga0049080_100439464 | 3300005582 | Freshwater Lentic | MIKSKEWRVSNRVWVGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0049080_100449071 | 3300005582 | Freshwater Lentic | KLMIKSKEWRVSNRVWVGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0049080_101769953 | 3300005582 | Freshwater Lentic | MIKSKEWRVSNRVWLGVGFNPRRIALGFSVDRFNANIDLLWFWVSLEY* |
| Ga0049080_102285091 | 3300005582 | Freshwater Lentic | IRHTHRMGKLMIKSKEWRVSNRVWIGVGFNPRRIALGFSVDRFNANIDFFWFWISLEY* |
| Ga0049080_103144263 | 3300005582 | Freshwater Lentic | MIKSKEWRVSNRVWLSVGFTPRRIGVGFHVDRFCANIDFLWFWVTLEY* |
| Ga0049082_101766492 | 3300005584 | Freshwater Lentic | MIKSKEWRVSNRAWISAGFNPRRIALGFSVDRFCANIDFLWFWVTLEY* |
| Ga0049082_102804242 | 3300005584 | Freshwater Lentic | MIKSKEWRVSNRVWVSAGFNPRRIALGFSVDRFNANIDFLWFWVTLEY* |
| Ga0049084_100128902 | 3300005585 | Freshwater Lentic | MIKYKEWRVNNRTWVSVGFNPRRFGLGFSVDRYNLSIDFVCFWINIEY* |
| Ga0049084_102835303 | 3300005585 | Freshwater Lentic | WLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0079301_10203285 | 3300006639 | Deep Subsurface | VIKSKEWRVSNEVWFSAGFSSRRFGLGFSVDKYNLSIDFVCFWINLEY* |
| Ga0104988_1086515 | 3300007735 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANVDFLWFWVSLEY* |
| Ga0114350_10630861 | 3300008116 | Freshwater, Plankton | MEKLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0114355_10431956 | 3300008120 | Freshwater, Plankton | RHTHRMEKLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0104241_10069513 | 3300008953 | Freshwater | MIKSKEWRVSNRIWVSAGFNPRRIALGFSVDRFYANIDFFWFWVTLEY* |
| Ga0104242_10167221 | 3300008962 | Freshwater | MIKSKEWRVTNRAWLSVGFAPRRIGIGFHVDRFCANIDFLWFWVTLEY* |
| Ga0104242_10604351 | 3300008962 | Freshwater | MIKSKEWRVSNRVWLGVGFNPRRIALGFSVDRFNANIDFIWFWVSLEY* |
| Ga0114973_100297274 | 3300009068 | Freshwater Lake | MIRSKEWRVNTRFWVSTGFNPRRIALGFSVDRFNANIDFLWFWVTLEY* |
| Ga0114973_100940783 | 3300009068 | Freshwater Lake | MVKLMIKSKEWRVSNRVWLGVGFNPRRIALGFSIDRFNTNIDFLWFWVSLEY* |
| Ga0114980_100297952 | 3300009152 | Freshwater Lake | MIKSKEWRVSNTVWVSAGFNPRRIALGFSVDKFYANIDFFCFWVTLEY* |
| Ga0114980_100316441 | 3300009152 | Freshwater Lake | MIKSKEWRVSNRVWVGVGFAPRRIALGFSVDRFNANIDFLWFWVTLEY* |
| Ga0114980_100775235 | 3300009152 | Freshwater Lake | MIKSKEWRVSNRVWVSVGFAPRRIGVGFHVDRFCANIDFLWFWVTLEY* |
| Ga0114980_101191903 | 3300009152 | Freshwater Lake | MIKSKEWRVSNRVWVSVGFAPRRIALGFSVDRFNVNIDFLWFWVTLEY* |
| Ga0114968_100039329 | 3300009155 | Freshwater Lake | MIKSKEWRVSNRVWLGVGFNPRRIALGFSIDRFNTNIDFLWFWVSLEY* |
| Ga0114968_100197463 | 3300009155 | Freshwater Lake | MIRTKEWRVTNRSWLSVGFAPRRIGLGFHVDRFCFNIDFLWFWVTLEY* |
| Ga0114968_100282053 | 3300009155 | Freshwater Lake | MIKSKEWRVSNRVWVGVGFAPRRIALGFSVDRFNANIDFLWFWVTIEY* |
| Ga0114978_100126952 | 3300009159 | Freshwater Lake | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDKFNANIDFLWFWVSLEY* |
| Ga0114978_100976795 | 3300009159 | Freshwater Lake | MIKSKEWRVSSRVWVSTGFNPRRIALGFSVDRFNANIDFLWFWVTIEY* |
| Ga0114978_104098863 | 3300009159 | Freshwater Lake | WRVSNRVWIGVGFNPRRIALGFSVDRFNANIDFLWFWISLEY* |
| Ga0114981_1002193510 | 3300009160 | Freshwater Lake | TNRSWLSVGFAPRRIGLGFHVDRFCINIDFLWFWVTLEY* |
| Ga0114981_105943412 | 3300009160 | Freshwater Lake | MIKSKEWRVSNRVWVSVGFAPRRIGVGFHVDRFCANIDFLWF |
| Ga0114966_107875841 | 3300009161 | Freshwater Lake | MIKSKEWRVSNRAWISAGFNPRRIALGFSVDRFNANIDFLWFWVTLEY* |
| Ga0114975_100312776 | 3300009164 | Freshwater Lake | MIRTKEWRVTNRSWLSIGFAPRRIGLGFHVDRFCFNIDFLWFWVTLEY* |
| Ga0114969_105221941 | 3300009181 | Freshwater Lake | MVKLMIKSKEWRVSNRVWLGVGFNPRRIALGFSIDRFNTNIDFLWFWVTIEY* |
| Ga0114976_100706084 | 3300009184 | Freshwater Lake | MIKSKEWRVSNRAWVSVGFNPRRIALGFSVDRFNANIDFFWFWVTLEY* |
| Ga0133913_113030623 | 3300010885 | Freshwater Lake | MIRTKEWRVTNRSWLSVGFAPRRIGLGFHVDRFSINIDFLWFWVTLEY* |
| Ga0133913_125056823 | 3300010885 | Freshwater Lake | MIKSKEWRVSNRVWIGVGFNPRRIALGFSVDRFNANIDFLWFWISLEY* |
| Ga0133913_128439761 | 3300010885 | Freshwater Lake | MIRTKEWRVNTRFWVSTGFNPRRIALGFSVDRFNANIDFLWFW |
| Ga0139557_10332852 | 3300011010 | Freshwater | MVKLMIKSKEWRVSNRAWVGVGFNPRRIALGFSVDRFNAN |
| Ga0164293_100162017 | 3300013004 | Freshwater | MIKSKEWRVSNRVWIGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0164293_101751311 | 3300013004 | Freshwater | MTKYKEWRVSNRTWVSVGFNPRRFGLGFSVDRYNLSIDFVCF |
| Ga0164293_101845963 | 3300013004 | Freshwater | MIKSKEWRVSNRVWLGVGFSPRRIGLGFSVDRFNANIDFLWFWVSLEY* |
| Ga0164293_105121281 | 3300013004 | Freshwater | KLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWISLEY* |
| Ga0164293_107241761 | 3300013004 | Freshwater | MIKSKEWRVSNRVWVGIGFNPRRIGLGFSVDRFNA |
| Ga0164292_100830083 | 3300013005 | Freshwater | MGKLMIKSKEWRVSNRVWVGIGFNPRRIGLGFSVDRFNANIDFLWFWVSLEY* |
| Ga0164292_110234603 | 3300013005 | Freshwater | SNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0177922_104508101 | 3300013372 | Freshwater | MIKSKEWRVSNRVWVAVGFNPRRIALGFSVDRFNANIDFLWFWVTLEY* |
| Ga0177922_104822541 | 3300013372 | Freshwater | ILMIKSKEWRVSNRVWLGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0177922_104944483 | 3300013372 | Freshwater | MIKYKEWRVSNRTWFSVGFNPRRFGLGFSIDRYNLSIDFVCFWINIEY* |
| Ga0177922_108179301 | 3300013372 | Freshwater | MIKSKEWRVSNRVWLGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0177922_109802984 | 3300013372 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY* |
| Ga0181362_10767961 | 3300017723 | Freshwater Lake | MVKLMIKSKEWRVSNRVWVGAGFNPRRIALGFSVDRFNANIDFLWFWVTLEY |
| Ga0181349_12840992 | 3300017778 | Freshwater Lake | MIKSKEWRVSNRVWVGAGFNPRRIALGFSVDRFNANIDFLWFWVTIEY |
| Ga0211736_101461382 | 3300020151 | Freshwater | MIKSKEWRVSNRVWVSVGFNPRRIALGFSVDRFNANIDFLCFWVSLEY |
| Ga0211734_102466572 | 3300020159 | Freshwater | MIKSKEWRVSNRVWIGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0211734_109304382 | 3300020159 | Freshwater | VGLMIKSKEWRVSNRVWVSAGFNPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0211734_110743243 | 3300020159 | Freshwater | MIKTKEWRVSNRVWLGVGFSPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0211733_101536274 | 3300020160 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0211733_112096572 | 3300020160 | Freshwater | MIRTKEWRVNNRVWVSAGFNPRRIALGFSVDKFYANIDFLWFWVTLEY |
| Ga0211726_1009167012 | 3300020161 | Freshwater | MIKSKEWRVSNRVWVSAGFNPRRIALGFSIDKFYANIDFLWFWVTLEY |
| Ga0211726_103737321 | 3300020161 | Freshwater | MIKSKEWRVSNRVWISAGFNPRRIALGFSVDKFYANIDFLCFWVTLEY |
| Ga0211726_104409276 | 3300020161 | Freshwater | MIKSREWRVSNRVWISAGFNPRRIALGFSVDKFYANIDFLCFWVSLEY |
| Ga0211726_104906236 | 3300020161 | Freshwater | MIKSKEWRVSNRVWFGVGFSPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0211735_113106721 | 3300020162 | Freshwater | MIKSKEWRVSNRVWISAGFNPRRIALGFSVDKFYANIDFLCFWVT |
| Ga0211729_100109762 | 3300020172 | Freshwater | MIKSKEWRVSNRVWIGVGFSPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0211729_102642131 | 3300020172 | Freshwater | GIPIEWKIMIKSKEWRVNNRVWIGVGFNPRRIALGFSVDRFNTNFDFLCFWVTLEY |
| Ga0211729_105564815 | 3300020172 | Freshwater | MIKSKEWRVSNRVWVSAGFNPRRIALGFSVDKFYANIDFFWFWVTLEY |
| Ga0211729_107156722 | 3300020172 | Freshwater | MGKLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0211729_114515079 | 3300020172 | Freshwater | MIKSKEWRVSNRVWIGVGFAPRRIALGFSVDRFNANIDFLCFWVSLEY |
| Ga0211729_114666723 | 3300020172 | Freshwater | VGLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSIEY |
| Ga0211731_104860533 | 3300020205 | Freshwater | MIKSKEWRVSNRVWISAGFNPRRIALGFSVDKFYANIDFLCFWVSLEY |
| Ga0208091_10004402 | 3300020506 | Freshwater | VIKSKEWRVSNKVWFSAGFSSRRFGLGFSVDKYNLSIDFVCFWINLEY |
| Ga0208091_10109264 | 3300020506 | Freshwater | MIKSKEWRVSNRVWIGVGFAPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0222712_107176551 | 3300021963 | Estuarine Water | MIKSKEWRVTNRAWLSVGFAPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0214917_100063767 | 3300022752 | Freshwater | MIRTKEWRVTNRSWLSVGFAPHRIGLGFHVDRFCINIDFLWFWITLEY |
| Ga0214917_100135718 | 3300022752 | Freshwater | MIITKEWRVTNRAWLSVGFAPRRIGLGFSVDKFYANIDFLWFWVTLEY |
| Ga0214921_1001898414 | 3300023174 | Freshwater | MIKSKEWRVSNRVWVNVGFNPRRIALGFSVDRFNFNIDFLWFWVTLEY |
| Ga0214921_100334229 | 3300023174 | Freshwater | MIKSKEWRVSNRIWVSAGFNPRRIALGFSVDRFYANIDFFWFWVTLEY |
| Ga0214921_100341965 | 3300023174 | Freshwater | MIKSKEWRVSNRVWISAGFNPRRIALGFSVDRFNANIDFLWFWVTIEY |
| Ga0214921_100638066 | 3300023174 | Freshwater | MIKSKEWRVSNKVWLGIGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0214921_100880825 | 3300023174 | Freshwater | MIKSKEWRVTNRAWLSVGFAPRRIGIGFHVDRFCANIDFLWFWVTLEY |
| Ga0214921_105057203 | 3300023174 | Freshwater | MIKSKEWRVSNRVWVSAGFNPRRIALGFSVDRFNANIDFLWFWVTIEY |
| Ga0209247_10230821 | 3300027468 | Freshwater Lake | MIRSKEWRVNTRVWVSTGFNPRRIALGFSVDKFYANIDFLWFWVTLEY |
| Ga0208787_100067930 | 3300027518 | Deep Subsurface | VIKSKEWRVSNEVWFSAGFSSRRFGLGFSVDKYNLSIDFVCFWINLEY |
| Ga0208974_10039825 | 3300027608 | Freshwater Lentic | MIKSKEWRVSNRVWLGVGFNPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0208974_10056679 | 3300027608 | Freshwater Lentic | MIKSKEWRISNRVWIGVGFAPRRIALGFSVDRFNANVDFLWFWVTLEY |
| Ga0208974_100631910 | 3300027608 | Freshwater Lentic | MIKTKEWRVSNRVWLGVGFNPRRIALGFSVDKFNANIDFLWFWISLEY |
| Ga0208974_10113293 | 3300027608 | Freshwater Lentic | MIRSKEWRVNTRVWVSTGFNPRRIALGFSVDRFNANIDFLWFWVTIEY |
| Ga0208974_10198963 | 3300027608 | Freshwater Lentic | MIKSKEWRVSNRVWLSVGFNPRRIGLGFSVDRFNVNVDFLWFWVTLEY |
| Ga0208974_10560342 | 3300027608 | Freshwater Lentic | MIKSKEWRVSNRVWVGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0208975_10084409 | 3300027659 | Freshwater Lentic | MVKLMIKSKEWRVSNRVWLGVGFNPRRIGLGFHVDRFCINIDFLWFWVTLEY |
| Ga0208975_10442412 | 3300027659 | Freshwater Lentic | MIKSKEWRISNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0208975_10489555 | 3300027659 | Freshwater Lentic | RVWVAVGFNPRRIALGFSVDRFNANIDFLWFWVTLEY |
| Ga0208975_10509602 | 3300027659 | Freshwater Lentic | MIKSKEWRVSNRVWLGVGFNPRRIALGFSVDRFNANIDLLWFWVSLEY |
| (restricted) Ga0247836_100779410 | 3300027728 | Freshwater | MIKSKEWRVSNKVWVSAGFNPRRIALGFSVDRFNASIDFLWFWVTLEY |
| (restricted) Ga0247836_10663305 | 3300027728 | Freshwater | MIKIKEWRVSNRVWISVGYDPRRIALGFSVDRFNANIDFLWFWVTLEY |
| (restricted) Ga0247836_11196511 | 3300027728 | Freshwater | EWRVSNRVWISVGYDPRRIALGFSVDRFNANIDFLWFWVTLEY |
| Ga0209297_100150014 | 3300027733 | Freshwater Lake | MIKSKEWRVSNRVWVSVGFAPRRIGVGFHVDRFCANIDFLWFWVTLEY |
| Ga0209087_10267914 | 3300027734 | Freshwater Lake | MVKLMIKSKEWRVSNRAWVSVGFNPRRIALGFSVDRFNANIDFFWFWVTLEY |
| Ga0209190_10391095 | 3300027736 | Freshwater Lake | MIRTKEWRVTNRSWLSVGFAPRRIGLGFHVDRFCFNIDFLWFWVTLEY |
| Ga0209190_10980062 | 3300027736 | Freshwater Lake | MIKSKEWRVSNRVWLGVGFNPRRIALGFSIDRFNTNIDFLWFWVSLEY |
| Ga0209190_11764153 | 3300027736 | Freshwater Lake | MIKSKEWRVSNRVWVGVGFAPRRIALGFSVDRFNANIDFLWFWVTIEY |
| Ga0209444_101205251 | 3300027756 | Freshwater Lake | MIRSKEWRVNTRVWVSTGFNPRRIALGFSVDRFNANIDFLWFWVTLEY |
| Ga0209296_100073150 | 3300027759 | Freshwater Lake | MIRTKEWRVTNRSWLSIGFAPRRIGLGFHVDRFCFNIDFLWFWVTLEY |
| Ga0209086_1001391210 | 3300027770 | Freshwater Lake | MVKLMIKSKEWRVSNRVWLGVGFNPRRIALGFSIDRFNTNIDFLWFWVSLEY |
| Ga0209086_102519031 | 3300027770 | Freshwater Lake | EWRVNTRFWVSTGFNPRRIALGFSVDRFNANIDFLWFWVTLEY |
| Ga0209500_100031785 | 3300027782 | Freshwater Lake | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDKFNANIDFLWFWVSLEY |
| Ga0209500_101550922 | 3300027782 | Freshwater Lake | MIKSKEWRVSNRVWVGVGFAPRRIALGFSVDRFNANIDFLWFWVTLEY |
| Ga0209354_100507795 | 3300027808 | Freshwater Lake | MIKSKEWRVNNRVWVGVGFNPRRIALGFSVDRFNANIDFLWFWFTLEY |
| Ga0209191_10981714 | 3300027969 | Freshwater Lake | MIKSKEWRVSNRVWVSVGFAPRRIGVGFHVDRFCANIDFL |
| Ga0209401_10208838 | 3300027971 | Freshwater Lake | MIRSKEWRVNTRFWVSTGFNPRRIALGFSVDRFNANIDFLWFWVTLEY |
| Ga0209298_100717052 | 3300027973 | Freshwater Lake | MIKSKEWRVSNRVWVSVGFAPRRIALGFSVDRFNVNIDFLWFWVTLEY |
| (restricted) Ga0247834_102173211 | 3300027977 | Freshwater | MIKSKEWRVSNRVWLGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY |
| (restricted) Ga0247835_12709041 | 3300028114 | Freshwater | MIKSKEWRVSNRVWVSVGFAPRRIGLGFSVDRFNANIDFLWFWISLEY |
| (restricted) Ga0247831_11236994 | 3300028559 | Freshwater | KSKEWRVSNRVWLSVGFNPRRIGLGFSVDRFNVNIDFLWFWVSLEY |
| (restricted) Ga0247842_101649511 | 3300029268 | Freshwater | NRVWISVGYDPRRIALGFSVDRFNANIDFLWFWVTLEY |
| Ga0315907_107632074 | 3300031758 | Freshwater | MEKLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0334980_0260727_486_632 | 3300033816 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0334986_0083361_993_1151 | 3300034012 | Freshwater | MGKIMIKSKEWRVSNRVWLGVGFAPRRIGLGFSVDRFNANIDFLWFWVSFEY |
| Ga0335002_0176086_946_1092 | 3300034020 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNVNIDFLWFWISLEY |
| Ga0334987_0103221_1256_1402 | 3300034061 | Freshwater | MIKTKEWRVSNRVWLGVGFAPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0334987_0165334_867_1025 | 3300034061 | Freshwater | MGKLMIKSKEWRVSNRVWLGVGFSPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0334987_0285329_725_883 | 3300034061 | Freshwater | MEKLMIKSKEWRVSNRVWIGVGFNPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0334995_0018601_914_1060 | 3300034062 | Freshwater | MIKSKEWRVSNRVWLGVGFSPRRIALGFSVDRFNANIDFLCFWVSLEY |
| Ga0335000_0412677_641_799 | 3300034063 | Freshwater | MEKLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWISLEY |
| Ga0335019_0267248_958_1083 | 3300034066 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWF |
| Ga0335019_0324813_78_224 | 3300034066 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLCFWVSLEY |
| Ga0335028_0047327_2696_2842 | 3300034071 | Freshwater | MIKSKEWRVSNKIWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0335020_0088169_1479_1589 | 3300034082 | Freshwater | MIKSKEWRISNRVWLGVGFAPRRIALGFSLDRFNANI |
| Ga0335010_0000046_4901_5047 | 3300034092 | Freshwater | MIKSKEWRVSNKVWFSAGFSSRRFGLGFSVDKYNLSIDFVCFWINLEY |
| Ga0335012_0224411_139_285 | 3300034093 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIALGFSMDRFNANIDFLWFWVSLEY |
| Ga0335027_0022271_1967_2113 | 3300034101 | Freshwater | MIKSKEWRISNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWISLEY |
| Ga0335027_0183940_417_563 | 3300034101 | Freshwater | MIKSKEWRVSNRVWVGVGFAPRRIALGFSVDRFNANIDFLCFWVSLEY |
| Ga0335027_0222133_1071_1217 | 3300034101 | Freshwater | MIKSKEWRVSNRVWIGVGFSPRRIALGFSVDRFNANIDFLCFWVSLEY |
| Ga0335029_0291450_844_1002 | 3300034102 | Freshwater | MEKLMIKSKEWRLSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWISLEY |
| Ga0335029_0467085_538_696 | 3300034102 | Freshwater | MEKLMIKSKEWRVSNRVWLGVGFAPRRIGLGFSVDRFNANIDFLWFWVSFEY |
| Ga0335029_0498666_3_110 | 3300034102 | Freshwater | WLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0335029_0560922_25_171 | 3300034102 | Freshwater | MIKSKEWRVSNRVWVGVGFAPRRIALGFSIDRFNANIDFLWFWVSLEY |
| Ga0335030_0121930_386_544 | 3300034103 | Freshwater | MGKLMIKSKEWRVSNRVWIGVGFAPRRIALGFSIDRFNANIDFLWFWVSLEY |
| Ga0335030_0223393_344_502 | 3300034103 | Freshwater | MGKLMIKSKEWRVSNRVWLGVGFAPRRIGLGFSVDRFNANIDFLWFWVSLEY |
| Ga0335030_0318292_1_114 | 3300034103 | Freshwater | RVWLGVGFAPRRIGLGFSIDRFNANIDFLWFWVSLEY |
| Ga0335030_0687849_502_615 | 3300034103 | Freshwater | RVWLGVGFAPRRIALGFSVDRFNANIDFLWFWISLEY |
| Ga0335031_0051882_2385_2543 | 3300034104 | Freshwater | MGKLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDKFNTNIDFLWFWVSLEY |
| Ga0335036_0299432_932_1069 | 3300034106 | Freshwater | SKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0335068_0016659_1146_1292 | 3300034116 | Freshwater | MIRTKEWRISNRVWLGVGFAPRRIALGFSVDRFNANIDFLWFWVSLEY |
| Ga0335053_0477579_333_479 | 3300034118 | Freshwater | MIKSKEWRVSNRVWLGVGFAPRRIGLGFSVDRFNANIDFLWFWVSFEY |
| Ga0335065_0092306_1464_1622 | 3300034200 | Freshwater | MGKLMIKSKEWRVSNRVWLGVGFAPRRIALGFSVDRFNANIDFLCFWVSLEY |
| Ga0335065_0798639_8_166 | 3300034200 | Freshwater | MGKLMIKSKEWRVSNRVWLGVGFSPRRIALGFSVDRFNANIDFLCFWVSLEY |
| ⦗Top⦘ |