| Basic Information | |
|---|---|
| Family ID | F037698 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MCANHDEMTHQINWAYQNKLREQWLLDNPDAQYIGWMSI |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 77.25 % |
| % of genes near scaffold ends (potentially truncated) | 16.17 % |
| % of genes from short scaffolds (< 2000 bps) | 69.46 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (77.246 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.156 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.060 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.886 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 16.17 |
| PF09250 | Prim-Pol | 7.78 |
| PF03354 | TerL_ATPase | 3.59 |
| PF12850 | Metallophos_2 | 2.40 |
| PF05869 | Dam | 2.40 |
| PF00145 | DNA_methylase | 1.80 |
| PF00149 | Metallophos | 1.20 |
| PF12728 | HTH_17 | 1.20 |
| PF05709 | Sipho_tail | 0.60 |
| PF05065 | Phage_capsid | 0.60 |
| PF01464 | SLT | 0.60 |
| PF09445 | Methyltransf_15 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 3.59 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.80 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.60 |
| COG4722 | Phage-related protein YomH | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.41 % |
| Unclassified | root | N/A | 6.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001963|GOS2229_1002904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1765 | Open in IMG/M |
| 3300002206|metazooDRAFT_1302354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300002273|B570J29588_100643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2470 | Open in IMG/M |
| 3300002274|B570J29581_103893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300002278|B570J29590_106955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300002294|B570J29584_1004604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300002294|B570J29584_1011170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300002298|B570J29599_1010449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300002306|B570J29618_1013528 | Not Available | 509 | Open in IMG/M |
| 3300002383|B570J29604_1009374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300002394|B570J29614_1004830 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300002408|B570J29032_109547695 | Not Available | 860 | Open in IMG/M |
| 3300002408|B570J29032_109600030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300002835|B570J40625_100018250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12051 | Open in IMG/M |
| 3300002835|B570J40625_100019456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11574 | Open in IMG/M |
| 3300002835|B570J40625_100254638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1825 | Open in IMG/M |
| 3300002835|B570J40625_100413431 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300002835|B570J40625_100559891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1057 | Open in IMG/M |
| 3300003499|JGI25930J51415_1039364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
| 3300004054|Ga0063232_10248154 | Not Available | 537 | Open in IMG/M |
| 3300004096|Ga0066177_10391028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300004112|Ga0065166_10417602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300004123|Ga0066181_10228836 | Not Available | 530 | Open in IMG/M |
| 3300004123|Ga0066181_10233143 | Not Available | 525 | Open in IMG/M |
| 3300004240|Ga0007787_10211721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300005517|Ga0070374_10232692 | Not Available | 944 | Open in IMG/M |
| 3300005517|Ga0070374_10254760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300005517|Ga0070374_10381080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300005527|Ga0068876_10330511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
| 3300005581|Ga0049081_10122758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300005581|Ga0049081_10140786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300005581|Ga0049081_10229491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300005581|Ga0049081_10249124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300005581|Ga0049081_10251762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300005581|Ga0049081_10259008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300005581|Ga0049081_10283107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300005582|Ga0049080_10111669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300005582|Ga0049080_10258826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300005805|Ga0079957_1030397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3585 | Open in IMG/M |
| 3300005805|Ga0079957_1040786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2946 | Open in IMG/M |
| 3300005805|Ga0079957_1060146 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300005805|Ga0079957_1101884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1562 | Open in IMG/M |
| 3300005805|Ga0079957_1129127 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300005805|Ga0079957_1150234 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300006639|Ga0079301_1106935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 852 | Open in IMG/M |
| 3300006802|Ga0070749_10279104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
| 3300006802|Ga0070749_10284692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 930 | Open in IMG/M |
| 3300006805|Ga0075464_10193981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
| 3300006805|Ga0075464_10194861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1202 | Open in IMG/M |
| 3300006805|Ga0075464_10330364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300006805|Ga0075464_10355026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300006805|Ga0075464_10455496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300006805|Ga0075464_10455963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300006805|Ga0075464_10757416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300006805|Ga0075464_10974411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300006805|Ga0075464_11012959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300006863|Ga0075459_1066152 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300007165|Ga0079302_1125126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300007363|Ga0075458_10094590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300007540|Ga0099847_1103086 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300007734|Ga0104986_1010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10073 | Open in IMG/M |
| 3300007734|Ga0104986_1738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27162 | Open in IMG/M |
| 3300007735|Ga0104988_10502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16511 | Open in IMG/M |
| 3300008261|Ga0114336_1023202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4261 | Open in IMG/M |
| 3300008261|Ga0114336_1034231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2776 | Open in IMG/M |
| 3300008261|Ga0114336_1100606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1360 | Open in IMG/M |
| 3300008266|Ga0114363_1010131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5259 | Open in IMG/M |
| 3300008266|Ga0114363_1192123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300008266|Ga0114363_1223319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300008448|Ga0114876_1176206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300008450|Ga0114880_1058151 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300008450|Ga0114880_1132494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300009158|Ga0114977_10114239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
| 3300009159|Ga0114978_10052110 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300009159|Ga0114978_10130302 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300009160|Ga0114981_10015574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4450 | Open in IMG/M |
| 3300009164|Ga0114975_10012526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5254 | Open in IMG/M |
| 3300009194|Ga0114983_1033790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1269 | Open in IMG/M |
| 3300010354|Ga0129333_10009292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9295 | Open in IMG/M |
| 3300010354|Ga0129333_11228958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300010368|Ga0129324_10373122 | Not Available | 553 | Open in IMG/M |
| 3300010370|Ga0129336_10597624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300012729|Ga0157625_1231990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300013004|Ga0164293_10000344 | Not Available | 35680 | Open in IMG/M |
| 3300013004|Ga0164293_10321075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
| 3300013372|Ga0177922_11113871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 546 | Open in IMG/M |
| 3300017722|Ga0181347_1029618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1706 | Open in IMG/M |
| 3300017722|Ga0181347_1158052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300017754|Ga0181344_1108915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300017754|Ga0181344_1158171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300017754|Ga0181344_1174883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300017785|Ga0181355_1079108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1375 | Open in IMG/M |
| 3300020048|Ga0207193_1100202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2642 | Open in IMG/M |
| 3300020084|Ga0194110_10489035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300020172|Ga0211729_10471904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3164 | Open in IMG/M |
| 3300020172|Ga0211729_10838787 | Not Available | 615 | Open in IMG/M |
| 3300020498|Ga0208050_1002152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2679 | Open in IMG/M |
| 3300020506|Ga0208091_1000284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10367 | Open in IMG/M |
| 3300020527|Ga0208232_1014502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
| 3300020531|Ga0208487_1001403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4640 | Open in IMG/M |
| 3300020533|Ga0208364_1025988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300020537|Ga0208722_1037951 | Not Available | 658 | Open in IMG/M |
| 3300020569|Ga0208229_1000216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14848 | Open in IMG/M |
| 3300020571|Ga0208723_1003395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3181 | Open in IMG/M |
| 3300020573|Ga0208485_1004595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3479 | Open in IMG/M |
| 3300021961|Ga0222714_10021307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5052 | Open in IMG/M |
| 3300021962|Ga0222713_10034899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4002 | Open in IMG/M |
| 3300021963|Ga0222712_10051657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3065 | Open in IMG/M |
| 3300022179|Ga0181353_1057990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300022752|Ga0214917_10005625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13332 | Open in IMG/M |
| 3300022752|Ga0214917_10039294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3386 | Open in IMG/M |
| 3300023179|Ga0214923_10005320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15045 | Open in IMG/M |
| 3300025635|Ga0208147_1147931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300025848|Ga0208005_1064562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1137 | Open in IMG/M |
| 3300027486|Ga0255086_1062304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300027608|Ga0208974_1000561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15208 | Open in IMG/M |
| 3300027733|Ga0209297_1003140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8887 | Open in IMG/M |
| 3300027734|Ga0209087_1002920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9499 | Open in IMG/M |
| 3300027734|Ga0209087_1003304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8918 | Open in IMG/M |
| 3300027759|Ga0209296_1003003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11679 | Open in IMG/M |
| 3300027782|Ga0209500_10090270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1536 | Open in IMG/M |
| 3300027900|Ga0209253_10889933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300027973|Ga0209298_10001495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15159 | Open in IMG/M |
| 3300027973|Ga0209298_10337765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300028025|Ga0247723_1002019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11246 | Open in IMG/M |
| 3300028025|Ga0247723_1008290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4309 | Open in IMG/M |
| 3300028025|Ga0247723_1016957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2561 | Open in IMG/M |
| 3300028025|Ga0247723_1033746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1585 | Open in IMG/M |
| 3300028025|Ga0247723_1056618 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300031758|Ga0315907_10583672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300031784|Ga0315899_10854258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300031787|Ga0315900_10044647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4749 | Open in IMG/M |
| 3300031857|Ga0315909_10003421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19347 | Open in IMG/M |
| 3300031951|Ga0315904_11278923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 557 | Open in IMG/M |
| 3300031963|Ga0315901_10206656 | All Organisms → Viruses → Predicted Viral | 1695 | Open in IMG/M |
| 3300032116|Ga0315903_10063636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3678 | Open in IMG/M |
| 3300033979|Ga0334978_0477901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300033981|Ga0334982_0038838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2684 | Open in IMG/M |
| 3300033981|Ga0334982_0262448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300033993|Ga0334994_0035779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3186 | Open in IMG/M |
| 3300033996|Ga0334979_0004330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10087 | Open in IMG/M |
| 3300033996|Ga0334979_0009056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6904 | Open in IMG/M |
| 3300033996|Ga0334979_0024808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4029 | Open in IMG/M |
| 3300033996|Ga0334979_0196848 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
| 3300034012|Ga0334986_0023080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4206 | Open in IMG/M |
| 3300034012|Ga0334986_0144830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
| 3300034012|Ga0334986_0275834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300034019|Ga0334998_0417975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300034020|Ga0335002_0173531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
| 3300034060|Ga0334983_0479650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300034061|Ga0334987_0005449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12141 | Open in IMG/M |
| 3300034061|Ga0334987_0227321 | All Organisms → Viruses → Predicted Viral | 1289 | Open in IMG/M |
| 3300034061|Ga0334987_0642447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300034062|Ga0334995_0706782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300034082|Ga0335020_0088298 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
| 3300034101|Ga0335027_0069826 | All Organisms → Viruses → Predicted Viral | 2767 | Open in IMG/M |
| 3300034104|Ga0335031_0463084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300034104|Ga0335031_0632492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300034106|Ga0335036_0338681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300034106|Ga0335036_0740690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300034112|Ga0335066_0482554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300034112|Ga0335066_0700199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300034118|Ga0335053_0652623 | Not Available | 598 | Open in IMG/M |
| 3300034120|Ga0335056_0335931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300034120|Ga0335056_0404384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300034166|Ga0335016_0417804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300034283|Ga0335007_0637599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 11.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.78% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.19% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.59% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.59% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.40% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.40% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.99% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.80% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.80% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.60% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.60% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.60% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300002273 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002383 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002394 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2229_10029044 | 3300001963 | Marine | VCDSHDQGTHQIDWAYQNELRKQWLADNPDAGYIGWMSI* |
| metazooDRAFT_13023542 | 3300002206 | Lake | MCDSHDQRTHEINWAYQNQLREQWLLDNPDAKYIGWMSI* |
| B570J29588_1006432 | 3300002273 | Freshwater | MCADDDEMTHQINWAYQNQLRKQWLLDNPDSQYIGWMSI* |
| B570J29581_1038932 | 3300002274 | Freshwater | MCANHDEMTHQINWAYQNKLRKQWLLDNPDAQYIGWMSI* |
| B570J29590_1069551 | 3300002278 | Freshwater | MDVCRNGVPYMCNSHDELTHQIDWAYQNKLRSQWLLDNPDAQYIGWMSI* |
| B570J29584_10046042 | 3300002294 | Freshwater | MCAXHDEMTHQINWAYQNXLRKQWLLDNPDXQYIGWMSI* |
| B570J29584_10111702 | 3300002294 | Freshwater | MCANHDEMTHTINWTYQNKLREQWLLDNPDAQYIGWMSI* |
| B570J29599_10104491 | 3300002298 | Freshwater | MCDSHDELTHQIDWAYQNELRKQWLLDNPDAQYIGWMSI* |
| B570J29618_10135282 | 3300002306 | Freshwater | RVLDVCRSGVPYMCANHDEMTHIINWAYQNKLREQWLLDNPDAEYIGWMSI* |
| B570J29604_10093742 | 3300002383 | Freshwater | QGVFYMCDSHDERTHQIDWVYQNKLRSQWLIDNPDSQYIGWMSI* |
| B570J29614_10048303 | 3300002394 | Freshwater | MCANHDEMTHQINWAYQNELRKQWLLDHPDAQYIGWMSI* |
| B570J29032_1095476953 | 3300002408 | Freshwater | GVPYMCANHDEMTHIINWAYQNKLREQWLLDNPDAEYIGWMSI* |
| B570J29032_1096000301 | 3300002408 | Freshwater | MCDSHDEGTHQIDWAYQNELRKQWLIDNPDSQYIGWMSI* |
| B570J40625_10001825022 | 3300002835 | Freshwater | MCANHDEMTHQINWAYQNELRKQWLSDNPHAQYIGWMSI* |
| B570J40625_1000194564 | 3300002835 | Freshwater | MCANHDEMTHIINWAYQNKLREQWLLDNPDAEYIGWMSI* |
| B570J40625_1002546383 | 3300002835 | Freshwater | MCANHDEMTHTINWTYQNKLREQWLLDNPNAQYIGWMSI* |
| B570J40625_1004134313 | 3300002835 | Freshwater | MRIMDVCRQGVFYMCDSHDEGTHQIDWAYQNELRKQWLIDNPDSQYIGWMSI* |
| B570J40625_1005598913 | 3300002835 | Freshwater | MCANHDEMTHTINWIHQNKLREQWLLDNPNAQYIGWMSI* |
| JGI25930J51415_10393641 | 3300003499 | Freshwater Lake | MCANHDEMTHQINWVYQNKLREQWLIDNPNAQYIGWMSI* |
| Ga0063232_102481542 | 3300004054 | Freshwater Lake | MCANHDKMTHEINWAYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0066177_103910282 | 3300004096 | Freshwater Lake | MWVVDVCGNGVPYMCDSHDELTHQIDWAYQNKLHKQWLTDNPDAGYIGWMSI* |
| Ga0065166_104176021 | 3300004112 | Freshwater Lake | MCNSHNQGEHEMNWIYQNQLREQWIIDNPDAEYEGWMSI* |
| Ga0066181_102288361 | 3300004123 | Freshwater Lake | MRVLDVRRSGVPYMCANHDKMTHEINWAYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0066181_102331432 | 3300004123 | Freshwater Lake | RVLDVRRSGVPYMCANHDEITHNINWVYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0007787_102117214 | 3300004240 | Freshwater Lake | MCNSHDQGEHEINWTYQNQLREQWIVDHPEAEYEGWMSI* |
| Ga0070374_102326922 | 3300005517 | Freshwater Lake | MCANHDEITHNINWVYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0070374_102547602 | 3300005517 | Freshwater Lake | MCANHDEMTHNINWAYQNKLREQWLLDNPNAQYIGWMSI* |
| Ga0070374_103810802 | 3300005517 | Freshwater Lake | MCANHDEMTHNINWTYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0068876_103305112 | 3300005527 | Freshwater Lake | MCDSHNEGDHEMNWAYQNQLRKQWLIDHPEAEYEGWMSI* |
| Ga0049081_101227583 | 3300005581 | Freshwater Lentic | MCADHDEMTHQINWAYQNELRKQWLLDNPDAQYIGWMSI* |
| Ga0049081_101407863 | 3300005581 | Freshwater Lentic | MCADHDEMTHQINWVYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0049081_102294913 | 3300005581 | Freshwater Lentic | MCNDHDEMTHQINWAYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0049081_102491242 | 3300005581 | Freshwater Lentic | MCDSHDQGEHEIDWAYQNELHKQWLVNNPDAGYIGWMSI* |
| Ga0049081_102517621 | 3300005581 | Freshwater Lentic | MCANHDEMTHEINWAYQNKLREQWLLDNPNAQYIGWMSI* |
| Ga0049081_102590082 | 3300005581 | Freshwater Lentic | MCANHDEMTHNINWAYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0049081_102831071 | 3300005581 | Freshwater Lentic | MRVLDVRRSGVPYMCANHDEMTHEIDWVYQNKLREQWLLDNPDAKYIGWMSI* |
| Ga0049080_101116693 | 3300005582 | Freshwater Lentic | MCANHDEMTHTINWAYQNKLRAQWLLDNPDAQYIGWMSI* |
| Ga0049080_102588262 | 3300005582 | Freshwater Lentic | MCANHDEMTHEINWIYQNKLREQWLIDNPNAQYIGWMSI* |
| Ga0079957_10303972 | 3300005805 | Lake | MDVFRQGVPYMCSDHDERTHEINWIYQNQLREQWLLDNPDAQYEGWMSI* |
| Ga0079957_10407868 | 3300005805 | Lake | MCADHDEMTHQVNWTYQNELRKQWLLDNPDAQYIGWMSI* |
| Ga0079957_10601463 | 3300005805 | Lake | MCDSHNKGDHEMNWAYQNELRKQWLIDHPEAEYEGWMSI* |
| Ga0079957_11018844 | 3300005805 | Lake | MCDSHDQGEHEIDWAYQNELHKQWLADNPDAGYIGWMSI* |
| Ga0079957_11291273 | 3300005805 | Lake | MCDSHDELTHQIDWAYQNKLRSQWLLDNPDAQYIGWMSI* |
| Ga0079957_11502341 | 3300005805 | Lake | YMCDSHDELTHQIDWAYQNKLRSQWLLDNPDAQYIGWMSI* |
| Ga0079301_11069352 | 3300006639 | Deep Subsurface | MCANHDAMTHNINWAYQNKLREQWLLDNPNAQYIGWMSI* |
| Ga0070749_102791044 | 3300006802 | Aqueous | MCDTHDELTHKIDWDYQNELRKQWLVDNPDAGYIGWMS |
| Ga0070749_102846921 | 3300006802 | Aqueous | MCDSHDQGEHEIDWAYQNELHKQWLADNPHVGYLGWMSI* |
| Ga0075464_101939812 | 3300006805 | Aqueous | MCDSHDQGEHEIDWAYQNKLHKQWLVDNPDAGYIGWMSI* |
| Ga0075464_101948613 | 3300006805 | Aqueous | MCANHDEMTHKINWAYQNKLREQWLLDNPNAQYIGWMSI* |
| Ga0075464_103303643 | 3300006805 | Aqueous | MCDSHNEGDHEVNWAYQNQLRKQGLIDHPEAEYEGWMSI* |
| Ga0075464_103550263 | 3300006805 | Aqueous | MCDSHDQGEHEMNWTYQNQLRKQWITNNPDAEYEGWMSI* |
| Ga0075464_104554961 | 3300006805 | Aqueous | MCANHNEMTHNINWAYQNKLREQWLIDNPNAQYIGWMSI* |
| Ga0075464_104559633 | 3300006805 | Aqueous | MCANHDDITHEINWAYQNKLREQWLIDNPNAQYIGWMSI* |
| Ga0075464_107574161 | 3300006805 | Aqueous | MCDSHDQGEHEMNWTYQNQLREQWIIDNPEAEYEGWMSI* |
| Ga0075464_109744111 | 3300006805 | Aqueous | MCANHDKMTHEINWAYQNKLREEWLFDNPDAKYIGWMSI* |
| Ga0075464_110129592 | 3300006805 | Aqueous | MHKVWFMDVCRNGVSYMCNSHDDLTHQINWAYQNKLREQWLIDNPDAQYIGWMSI* |
| Ga0075459_10661522 | 3300006863 | Aqueous | MCDSHDQGEHEINWAYQNELHKQWLTDNPDAGYIGWMSI* |
| Ga0079302_11251261 | 3300007165 | Deep Subsurface | GVPYMCANHDAMTHNINWAYQNKLREQWLLDNPNAQYIGWMSI* |
| Ga0075458_100945903 | 3300007363 | Aqueous | MCDSHDQGEHEIDWAYQNQLRKQWLLDNPDAGYIGWMSI* |
| Ga0099847_11030863 | 3300007540 | Aqueous | HDQGEHEIDWAYQNELHKQWLADNPDAGYIGWMSI* |
| Ga0104986_101018 | 3300007734 | Freshwater | MCADHDEMTHQINWAYQNKLREQWLLDNPDSQYIGWMSI* |
| Ga0104986_173822 | 3300007734 | Freshwater | MRILDVRRSGVPYMCANHDEMTHQINWAYQNKLREQWLLNNPDAQYIGWMSI* |
| Ga0104988_105024 | 3300007735 | Freshwater | MDVSGQGVPYMCADHDERTHEINWIYQNQLREQWLLDNPNAQYEGWMSI* |
| Ga0114336_10232025 | 3300008261 | Freshwater, Plankton | MCDSHDQRTHEINWAYQNQLREQWIVDHPEAEYEGWMSI* |
| Ga0114336_10342314 | 3300008261 | Freshwater, Plankton | MCDSHDQGEHEMNWIYQNQLREQWITNNPDAEYEGWMSI* |
| Ga0114336_11006063 | 3300008261 | Freshwater, Plankton | MCDSHDQGEHEMNWTYQNQLREQWIVDNPEAEYKGWMSI* |
| Ga0114363_101013114 | 3300008266 | Freshwater, Plankton | MCADHDEITHQINWAYQNQLRKQWLLDNPDAQYIGWMSI* |
| Ga0114363_11921232 | 3300008266 | Freshwater, Plankton | MCDSHNEGDHEMNWQYQNQLRKQWLIDHPEAEYEGWMSI* |
| Ga0114363_12233192 | 3300008266 | Freshwater, Plankton | HDQKEHEIDWAYQNELHKQWLIDNPDAGYIGWMSI* |
| Ga0114876_11762062 | 3300008448 | Freshwater Lake | MCDSHDQGEHEMNWTYQNQLREQWIINNPNAEYEGWMSI* |
| Ga0114880_10581514 | 3300008450 | Freshwater Lake | MCDSHDQGEHEIDWVYQNQLRKQWLLDNPDAGYIGWMSI* |
| Ga0114880_11324941 | 3300008450 | Freshwater Lake | MCDSHDQGEHEIDWAYQNELHKQWLVDNPDAGYIGWMSI* |
| Ga0114977_101142391 | 3300009158 | Freshwater Lake | MCANHDEMTHTINWAYQNKLREQWLLDNPDAKYIGWMSI* |
| Ga0114978_100521107 | 3300009159 | Freshwater Lake | MCSDKNHDHSIDWAYQNELRKQWLLDNPDATYGGWMSI* |
| Ga0114978_101303022 | 3300009159 | Freshwater Lake | MCVNHDEMTHQINWAYQNELRKQWLLDNPDAQYIGWMSI* |
| Ga0114981_100155745 | 3300009160 | Freshwater Lake | MCNSHDDLTHEINWITQNKLREKWLLDNPDAQYIGWMSI* |
| Ga0114975_1001252614 | 3300009164 | Freshwater Lake | MCANHDEMTHTINWAYQNKLREQWLLDNPDAQYIGWMSI* |
| Ga0114983_10337902 | 3300009194 | Deep Subsurface | MCDSHDQTTHEINWGYQNQLREQWLKDNPDLEYEGWMSI* |
| Ga0129333_1000929218 | 3300010354 | Freshwater To Marine Saline Gradient | MDVCGNGVPYMCDSHDELTHEINWAYQNELHKQWLADNPDAGYIGWMSI* |
| Ga0129333_112289581 | 3300010354 | Freshwater To Marine Saline Gradient | NEGDHEMNWAYQNQLRKQWLIDHPEAEYEGWMSI* |
| Ga0129324_103731222 | 3300010368 | Freshwater To Marine Saline Gradient | MCDSHDHGDHDINWAYQNELHKQWLADNPDAGYIGWMSI* |
| Ga0129336_105976242 | 3300010370 | Freshwater To Marine Saline Gradient | MCDSHNEGDHEMNWAYQNQLRKQWLIDHPKAEYEGWMSI* |
| Ga0157625_12319902 | 3300012729 | Freshwater | MCANHDEMTHQINWAYQNELRKQWLLDNPDAQYIGWMSI* |
| Ga0164293_1000034414 | 3300013004 | Freshwater | VAEDSDHEMDWAYQNQLREQWLKDNPDSEYRGWFSI* |
| Ga0164293_103210753 | 3300013004 | Freshwater | MCDSHDQGEHEINWAYQNELHKQWLADNPDAGYIGWMSI* |
| Ga0177922_111138711 | 3300013372 | Freshwater | MRVLDVRRSGVPYMCANHDEMTHTINWAYQNTLREQWLLDNPNAQYIGWMSI* |
| Ga0181347_10296182 | 3300017722 | Freshwater Lake | MCANHDKMTHEINWAYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0181347_11580521 | 3300017722 | Freshwater Lake | TGAAMHKVWFMDVRRNGVSYMCNSHDDLTHEINWTYQNKLREQWLIDNPDAQYIGWMSI |
| Ga0181344_11089151 | 3300017754 | Freshwater Lake | MCDSHDQKEHEMNWTYQNQLREQWIIDNPESEYEGWMSI |
| Ga0181344_11581712 | 3300017754 | Freshwater Lake | MCADHDEMTHQINWAYQNQLRKQWLLDNPDTQYIGWMSI |
| Ga0181344_11748832 | 3300017754 | Freshwater Lake | LDVCGQGVLYMCNSHDKRTHEIDWVYQNKLHKQWLLDNPDAQYIGWMSI |
| Ga0181355_10791081 | 3300017785 | Freshwater Lake | CANHDEMTHEINWVYQNKLREQWMLDNPDAQYIGWMSI |
| Ga0207193_11002023 | 3300020048 | Freshwater Lake Sediment | MCDSHDQRTHEINWVYQNQLREQWLIDNPEAEYEGWMSI |
| Ga0194110_104890352 | 3300020084 | Freshwater Lake | MCDSHDELTHQIDWAYQNQLRAQWLIDNPDAEYEGWMSI |
| Ga0211729_104719049 | 3300020172 | Freshwater | MCDSHDKRTHEIDWVYQNKLHEQWLLDNPDAQYIGWMSI |
| Ga0211729_108387871 | 3300020172 | Freshwater | VRRSGVPYMCANHDEMTHNINWAYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0208050_10021522 | 3300020498 | Freshwater | MCANHDEMTHQIDWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0208091_10002842 | 3300020506 | Freshwater | MCANHDEMTHQINWAYQNKLRKQWLLDNPDAQYIGWMSI |
| Ga0208232_10145023 | 3300020527 | Freshwater | MCANHDEMTHIINWAYQNKLREQWLLDNPDAEYIGWMSI |
| Ga0208487_10014032 | 3300020531 | Freshwater | MCADDDEMTHQINWAYQNQLRKQWLLDNPDSQYIGWMSI |
| Ga0208364_10259882 | 3300020533 | Freshwater | MDVCRNGVPYMCDSHDELTHQIDWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0208722_10379511 | 3300020537 | Freshwater | MCADHDEMTHQINWAYQNELRKQWLLDNPDSQYIGWMSI |
| Ga0208229_10002166 | 3300020569 | Freshwater | MCANHDEMTHQINWAYQNELRKQWLLDHPDAQYIGWMSI |
| Ga0208723_10033959 | 3300020571 | Freshwater | MCANHDEMTHQINWAYQNELRKQWLSDNPHAQYIGWMSI |
| Ga0208485_10045954 | 3300020573 | Freshwater | MCDSHDEGTHQIDWAYQNELRKQWLIDNPDSQYIGWMSI |
| Ga0222714_100213073 | 3300021961 | Estuarine Water | MCDSHDQGEHEINWTYQNQLREQWITDNPEAEYEGWMSI |
| Ga0222713_100348993 | 3300021962 | Estuarine Water | MCANHDEMTHEINWAYQNKLREQWLLDNPDSQYIGWMSI |
| Ga0222712_100516577 | 3300021963 | Estuarine Water | MCADHDEMTHQINWAYQNKLREQWLLDNPDSQYIGWMSI |
| Ga0181353_10579902 | 3300022179 | Freshwater Lake | MCNSHDQGEHEINWTYQNQLREQWIVDHPEAEYEGWMSI |
| Ga0214917_100056255 | 3300022752 | Freshwater | MCDSHDQGTHQIDWDYQNELRKQWLLDNPDSNYQGWMSI |
| Ga0214917_100392944 | 3300022752 | Freshwater | MCDSHDQGTHQIDWAYQNELRKQWLLNNPDSDYEGWMSI |
| Ga0214923_1000532011 | 3300023179 | Freshwater | MCDSHDQGEHEINWAYQNELHKEWLADNPDAKYIGWMSI |
| Ga0208147_11479312 | 3300025635 | Aqueous | MCDSHDQGEHEIDWAYQNQLRKQWLLDNPDAGYIGWMSI |
| Ga0208005_10645624 | 3300025848 | Aqueous | MCDSHDQGEHEIDWAYQNELHKQWLADNPDAGYIGW |
| Ga0255086_10623041 | 3300027486 | Freshwater | VLDVCRSGVPYMCANHDQMTHTINWTYQNKLREQWLIDNPDAQYIGWMSI |
| Ga0208974_10005619 | 3300027608 | Freshwater Lentic | MRVLDVRRSGVPYMCANHDEMTHTINWAYQNKLRAQWLLDNPDAQYIGWMSI |
| Ga0209297_100314019 | 3300027733 | Freshwater Lake | MCANHDEMTHTINWAYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0209087_100292019 | 3300027734 | Freshwater Lake | MCANHDEMTHTINWAYQNKLREQWLLDNPDAKYIGWMSI |
| Ga0209087_10033043 | 3300027734 | Freshwater Lake | MCANHDEMTHNINWAYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0209296_10030033 | 3300027759 | Freshwater Lake | MRVLDVRRSGVPYMCANHDEMTHNINWIYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0209500_100902702 | 3300027782 | Freshwater Lake | MCVNHDEMTHQINWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0209253_108899331 | 3300027900 | Freshwater Lake Sediment | MCDSHDQRTHEINWGHQNQLRKQWLLDNPEAEYEG |
| Ga0209298_1000149518 | 3300027973 | Freshwater Lake | MCNSHDDLTHEINWITQNKLREKWLLDNPDAQYIGWMSI |
| Ga0209298_103377652 | 3300027973 | Freshwater Lake | MCNSHDDLTHQINWAYQNKLREQWVLDNPDAQYIG |
| Ga0247723_100201924 | 3300028025 | Deep Subsurface Sediment | MCNSHDDLTHEINWADQNKLREQWLIDNPDAQYIGWMSI |
| Ga0247723_10082904 | 3300028025 | Deep Subsurface Sediment | MCDSHDQGEHEMNWIYQNHLREQWIVDHPEAEYEGWMSI |
| Ga0247723_10169577 | 3300028025 | Deep Subsurface Sediment | MCDSHDQRTHEINWGHQNQLREQWLLDNPEAEYEGWMSI |
| Ga0247723_10337463 | 3300028025 | Deep Subsurface Sediment | MCADHDEMTHQINWAYQNELRKQWLLDNPDAKYIGWMSI |
| Ga0247723_10566182 | 3300028025 | Deep Subsurface Sediment | MCDSHNEGDHEMNWQYQNQLRKQWLIDHPEAEYEGWMSI |
| Ga0315907_105836722 | 3300031758 | Freshwater | MCDSHDQGEHEIDWAYQNQLHKQWLADNPDAGYIGWMSI |
| Ga0315899_108542582 | 3300031784 | Freshwater | MCDSHDQGEHEMNWIYQNQLREQWITNNPDAEYEGWMSI |
| Ga0315900_100446472 | 3300031787 | Freshwater | MCADHDEITHQINWAYQNQLRKQWLLDNPDAQYIGWMSI |
| Ga0315909_1000342114 | 3300031857 | Freshwater | MCANHDEMTHNINWAYQNKLREQWLLDNPNAQYIGWMSI |
| Ga0315904_112789232 | 3300031951 | Freshwater | MCDSHDQGEHEMNWTYQNQLREQWIIDNPDAEYEGWMSI |
| Ga0315901_102066563 | 3300031963 | Freshwater | MCDSHDQRTHEINWAYQNQLREQWIVDHPEAEYEGWMSI |
| Ga0315903_100636367 | 3300032116 | Freshwater | MCVDHDEMTHQINWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0334978_0477901_349_468 | 3300033979 | Freshwater | MCANHDEMTHTINWAYQNKLREQWLIDNPDAQYIGWMSI |
| Ga0334982_0038838_1862_1981 | 3300033981 | Freshwater | MCADHDEMTHQIDWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0334982_0262448_467_586 | 3300033981 | Freshwater | MCANHDEMTHQINWDYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0334994_0035779_2922_3041 | 3300033993 | Freshwater | MCADHDEMTHEINWAYQNKLRKQWLLDNSDAQYIGWMSI |
| Ga0334979_0004330_124_243 | 3300033996 | Freshwater | MCANHDEMTHQINWAYQNELRKQWLLNNPDAQYIGWMSI |
| Ga0334979_0009056_475_594 | 3300033996 | Freshwater | MCADHDEMTHEINWAYQNQLHKQWLLDNPDAQYIGWMSI |
| Ga0334979_0024808_3176_3334 | 3300033996 | Freshwater | MRILDVCRQGVPHMCADHDEMTHQINWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0334979_0196848_938_1057 | 3300033996 | Freshwater | MCDSHDQRTHEINWDHQNQLREQWLKDNPEAEYEGWMSI |
| Ga0334986_0023080_3410_3529 | 3300034012 | Freshwater | MCADHDEMTHQINWAYQNQLREQWLLDNPDAKYIGWMSI |
| Ga0334986_0144830_405_524 | 3300034012 | Freshwater | MCANHDEMTHQINWAYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0334986_0275834_408_527 | 3300034012 | Freshwater | MCNSHDDLTHEINWIYQNKLREQWLIDNPDAQYIGWMSI |
| Ga0334998_0417975_169_288 | 3300034019 | Freshwater | MCADHDEMTHQINWAYQNELRKQWLLNNPDAQYIGWMSI |
| Ga0335002_0173531_2_109 | 3300034020 | Freshwater | MCANHDEMTHQINWAYQNELRKQWLLDNPDAQYIGW |
| Ga0334983_0479650_317_436 | 3300034060 | Freshwater | MCANHDEMTHQINWVYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0334987_0005449_725_844 | 3300034061 | Freshwater | MCDSHDQGEHEIDWAYQNKLHKQWLADNPDAGYIGWMSI |
| Ga0334987_0227321_395_514 | 3300034061 | Freshwater | MCADHDEMTHQVNWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0334987_0642447_458_577 | 3300034061 | Freshwater | MCADHDEMTHQINWVYQNELRKQWLLDNPDAKYIGWMSI |
| Ga0334995_0706782_404_523 | 3300034062 | Freshwater | MCADHDEMTHQINWAYQNELRRQWLLDNPDAQYMGWMSI |
| Ga0335020_0088298_1248_1367 | 3300034082 | Freshwater | MCANHDEMTHEINWAYQNKLREEWLLDNPDAQYIGWMSI |
| Ga0335027_0069826_1927_2046 | 3300034101 | Freshwater | MCANHDEMTHQIDWAYQNQLRKQWLLDNPDAQYIGWMSI |
| Ga0335031_0463084_94_243 | 3300034104 | Freshwater | MDVSRQGVPYMCADHDEMTHQIDWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0335031_0632492_495_626 | 3300034104 | Freshwater | GVPYMCANHDEMTHQINWAYQNKLRKQWLLDNPDAQYIGWMSI |
| Ga0335036_0338681_609_728 | 3300034106 | Freshwater | MCNSHDDLTHEINWVYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0335036_0740690_318_476 | 3300034106 | Freshwater | MWIMDVCRNGVPYMCDSHDELTHQINWAYQNELRSQWLLDNPDAQYIGWMSI |
| Ga0335066_0482554_507_659 | 3300034112 | Freshwater | IMDVCRQGVFYMCDSHDEGTHQINWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0335066_0700199_402_509 | 3300034112 | Freshwater | MCDSHDEGTHQINWAYQNELRKQWLLDNPDAQYIGW |
| Ga0335053_0652623_452_598 | 3300034118 | Freshwater | DVCRQGVFYMCDSHDEGTHQIDWVYQNELRSQWLLDNPDAQYIGWMSI |
| Ga0335056_0335931_2_133 | 3300034120 | Freshwater | GVPYMCANHNEMTHQINWAYQNELRKQWLLDNPDAQYIGWMSI |
| Ga0335056_0404384_228_347 | 3300034120 | Freshwater | MCDSHDQREHEIDWAYQNQLRKQWLLDNPDAGYIGWMSI |
| Ga0335016_0417804_85_234 | 3300034166 | Freshwater | MDVCRNGVPYMCNSHDDLTHEINWVYQNKLREQWLLDNPDAQYIGWMSI |
| Ga0335007_0637599_180_299 | 3300034283 | Freshwater | MCDSHDKGTHEIDWAYQNKLHKQWLIDNPDAKYIGWMSI |
| ⦗Top⦘ |