NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037653

Metagenome / Metatranscriptome Family F037653

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037653
Family Type Metagenome / Metatranscriptome
Number of Sequences 167
Average Sequence Length 37 residues
Representative Sequence LSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF
Number of Associated Samples 124
Number of Associated Scaffolds 167

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.80 %
% of genes near scaffold ends (potentially truncated) 95.21 %
% of genes from short scaffolds (< 2000 bps) 68.86 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.066 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.174 % of family members)
Environment Ontology (ENVO) Unclassified
(26.347 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.102 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.44%    β-sheet: 0.00%    Coil/Unstructured: 76.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 167 Family Scaffolds
PF07238PilZ 1.80
PF01548DEDD_Tnp_IS110 1.80
PF02371Transposase_20 1.20
PF13426PAS_9 1.20
PF00072Response_reg 1.20
PF14294DUF4372 1.20
PF03069FmdA_AmdA 1.20
PF00383dCMP_cyt_deam_1 1.20
PF13751DDE_Tnp_1_6 1.20
PF00196GerE 1.20
PF00239Resolvase 0.60
PF13181TPR_8 0.60
PF06964Alpha-L-AF_C 0.60
PF13424TPR_12 0.60
PF07690MFS_1 0.60
PF12663DUF3788 0.60
PF01391Collagen 0.60
PF09118GO-like_E_set 0.60
PF13620CarboxypepD_reg 0.60
PF00106adh_short 0.60
PF13692Glyco_trans_1_4 0.60
PF13401AAA_22 0.60
PF01566Nramp 0.60
PF13360PQQ_2 0.60
PF02954HTH_8 0.60
PF04972BON 0.60
PF11154DUF2934 0.60
PF09836DUF2063 0.60
PF04986Y2_Tnp 0.60
PF13817DDE_Tnp_IS66_C 0.60
PF00665rve 0.60
PF03073TspO_MBR 0.60
PF13524Glyco_trans_1_2 0.60
PF02896PEP-utilizers_C 0.60
PF01261AP_endonuc_2 0.60
PF01695IstB_IS21 0.60
PF00589Phage_integrase 0.60
PF00356LacI 0.60
PF028262-Hacid_dh_C 0.60
PF03237Terminase_6N 0.60
PF10415FumaraseC_C 0.60
PF13701DDE_Tnp_1_4 0.60
PF13180PDZ_2 0.60
PF13589HATPase_c_3 0.60
PF05598DUF772 0.60
PF08013GatZ_KbaZ-like 0.60
PF13376OmdA 0.60
PF12802MarR_2 0.60
PF05593RHS_repeat 0.60
PF08327AHSA1 0.60
PF13193AMP-binding_C 0.60
PF00857Isochorismatase 0.60
PF07508Recombinase 0.60
PF04326AlbA_2 0.60
PF09994DUF2235 0.60
PF02518HATPase_c 0.60
PF01833TIG 0.60
PF04389Peptidase_M28 0.60
PF02666PS_Dcarbxylase 0.60
PF01915Glyco_hydro_3_C 0.60
PF01165Ribosomal_S21 0.60
PF11741AMIN 0.60
PF00145DNA_methylase 0.60
PF13624SurA_N_3 0.60
PF02646RmuC 0.60
PF14659Phage_int_SAM_3 0.60
PF00578AhpC-TSA 0.60
PF13439Glyco_transf_4 0.60
PF13561adh_short_C2 0.60
PF00089Trypsin 0.60
PF02901PFL-like 0.60
PF02163Peptidase_M50 0.60
PF00440TetR_N 0.60
PF07228SpoIIE 0.60
PF13462Thioredoxin_4 0.60
PF14403CP_ATPgrasp_2 0.60
PF06202GDE_C 0.60
PF13519VWA_2 0.60
PF02482Ribosomal_S30AE 0.60
PF03481Sua5_C 0.60
PF05569Peptidase_M56 0.60
PF14534DUF4440 0.60
PF13606Ank_3 0.60
PF13517FG-GAP_3 0.60
PF02566OsmC 0.60
PF03693ParD_antitoxin 0.60
PF09579Spore_YtfJ 0.60
PF00561Abhydrolase_1 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 167 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 2.99
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 1.20
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 1.20
COG4584TransposaseMobilome: prophages, transposons [X] 0.60
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.60
COG4573Tagatose-1,6-bisphosphate aldolase non-catalytic subunit AgaZ/GatZCarbohydrate transport and metabolism [G] 0.60
COG3609Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domainTranscription [K] 0.60
COG3534Alpha-L-arabinofuranosidaseCarbohydrate transport and metabolism [G] 0.60
COG3476Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog)Signal transduction mechanisms [T] 0.60
COG3408Glycogen debranching enzyme (alpha-1,6-glucosidase)Carbohydrate transport and metabolism [G] 0.60
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.60
COG3209Uncharacterized conserved protein RhaS, contains 28 RHS repeatsGeneral function prediction only [R] 0.60
COG2865Predicted transcriptional regulator, contains HTH domainTranscription [K] 0.60
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.60
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.60
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.60
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.60
COG1882Pyruvate-formate lyaseEnergy production and conversion [C] 0.60
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.60
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.60
COG1544Ribosome-associated translation inhibitor RaiATranslation, ribosomal structure and biogenesis [J] 0.60
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.60
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.60
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.60
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.60
COG1322DNA anti-recombination protein (rearrangement mutator) RmuCReplication, recombination and repair [L] 0.60
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.60
COG0688Phosphatidylserine decarboxylaseLipid transport and metabolism [I] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.26 %
UnclassifiedrootN/A31.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10840312All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300004152|Ga0062386_101661460All Organisms → cellular organisms → Bacteria → Proteobacteria533Open in IMG/M
3300004478|Ga0068972_1500612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300005174|Ga0066680_10853998All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005467|Ga0070706_101134010All Organisms → cellular organisms → Bacteria → Proteobacteria719Open in IMG/M
3300005540|Ga0066697_10393301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium805Open in IMG/M
3300005555|Ga0066692_10722139Not Available616Open in IMG/M
3300005598|Ga0066706_10368445All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter denitrificans1141Open in IMG/M
3300006046|Ga0066652_100199691All Organisms → cellular organisms → Bacteria1719Open in IMG/M
3300006055|Ga0097691_1022497All Organisms → cellular organisms → Bacteria2679Open in IMG/M
3300006162|Ga0075030_101549504All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006795|Ga0075520_1310111All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300006795|Ga0075520_1327158All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300006893|Ga0073928_10002226All Organisms → cellular organisms → Bacteria34231Open in IMG/M
3300006893|Ga0073928_10023368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 1466235Open in IMG/M
3300006893|Ga0073928_10687994All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300007265|Ga0099794_10199534All Organisms → cellular organisms → Bacteria → Acidobacteria1024Open in IMG/M
3300009012|Ga0066710_100400780All Organisms → cellular organisms → Bacteria2045Open in IMG/M
3300009029|Ga0066793_10028587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae3087Open in IMG/M
3300009029|Ga0066793_10046523Not Available2450Open in IMG/M
3300009029|Ga0066793_10062241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2128Open in IMG/M
3300009029|Ga0066793_10470017Not Available720Open in IMG/M
3300009029|Ga0066793_10862594All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009090|Ga0099827_10124398All Organisms → cellular organisms → Bacteria2081Open in IMG/M
3300009137|Ga0066709_100477075Not Available1751Open in IMG/M
3300009137|Ga0066709_104249928Not Available522Open in IMG/M
3300009518|Ga0116128_1002754All Organisms → cellular organisms → Bacteria7168Open in IMG/M
3300009518|Ga0116128_1073286Not Available1042Open in IMG/M
3300009518|Ga0116128_1203011Not Available556Open in IMG/M
3300009519|Ga0116108_1019911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2313Open in IMG/M
3300009519|Ga0116108_1023495Not Available2086Open in IMG/M
3300009521|Ga0116222_1455711Not Available558Open in IMG/M
3300009616|Ga0116111_1101821Not Available725Open in IMG/M
3300009618|Ga0116127_1095104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae788Open in IMG/M
3300009630|Ga0116114_1002200All Organisms → cellular organisms → Bacteria9042Open in IMG/M
3300009631|Ga0116115_1009044All Organisms → cellular organisms → Bacteria → Acidobacteria3125Open in IMG/M
3300009633|Ga0116129_1003087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8098Open in IMG/M
3300009643|Ga0116110_1078483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata → Desulfosarcina ovata subsp. ovata1144Open in IMG/M
3300009643|Ga0116110_1223045All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009644|Ga0116121_1314921Not Available506Open in IMG/M
3300010329|Ga0134111_10390316Not Available594Open in IMG/M
3300010339|Ga0074046_10002019All Organisms → cellular organisms → Bacteria → Acidobacteria17808Open in IMG/M
3300010339|Ga0074046_10012215Not Available6304Open in IMG/M
3300010339|Ga0074046_10255642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1086Open in IMG/M
3300010339|Ga0074046_10387726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium845Open in IMG/M
3300010360|Ga0126372_13239724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300010379|Ga0136449_100067446All Organisms → cellular organisms → Bacteria7731Open in IMG/M
3300010379|Ga0136449_101075122All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300011084|Ga0138562_1165125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300011269|Ga0137392_10477517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71035Open in IMG/M
3300011271|Ga0137393_11026219All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300012199|Ga0137383_10235339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1342Open in IMG/M
3300012202|Ga0137363_10000732All Organisms → cellular organisms → Bacteria18311Open in IMG/M
3300012202|Ga0137363_10002275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia11380Open in IMG/M
3300012204|Ga0137374_10115007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2491Open in IMG/M
3300012209|Ga0137379_10619389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium989Open in IMG/M
3300012210|Ga0137378_11693167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300012211|Ga0137377_10403975Not Available1304Open in IMG/M
3300012349|Ga0137387_10806808Not Available679Open in IMG/M
3300012357|Ga0137384_10146293Not Available1978Open in IMG/M
3300012359|Ga0137385_11174469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae629Open in IMG/M
3300012917|Ga0137395_10668325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117751Open in IMG/M
3300012927|Ga0137416_10142919Not Available1862Open in IMG/M
3300012929|Ga0137404_10275013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1453Open in IMG/M
3300014489|Ga0182018_10022340All Organisms → cellular organisms → Bacteria → Acidobacteria4146Open in IMG/M
3300014489|Ga0182018_10183012All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cronobacter → Cronobacter sakazakii → Cronobacter sakazakii 7011180Open in IMG/M
3300014489|Ga0182018_10309246Not Available858Open in IMG/M
3300014495|Ga0182015_10000030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae175198Open in IMG/M
3300014495|Ga0182015_10114583All Organisms → Viruses → Predicted Viral1858Open in IMG/M
3300014495|Ga0182015_10297937All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_54_91055Open in IMG/M
3300014501|Ga0182024_10115216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3864Open in IMG/M
3300014501|Ga0182024_10562626Not Available1436Open in IMG/M
3300014501|Ga0182024_11564070Not Available749Open in IMG/M
3300014501|Ga0182024_11879373Not Available667Open in IMG/M
3300014501|Ga0182024_11966694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300014501|Ga0182024_12420998Not Available568Open in IMG/M
3300014838|Ga0182030_10218141All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300014839|Ga0182027_10484782All Organisms → cellular organisms → Bacteria → Acidobacteria1353Open in IMG/M
3300016357|Ga0182032_10035356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3101Open in IMG/M
3300016404|Ga0182037_10235273Not Available1441Open in IMG/M
3300016445|Ga0182038_10049125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2804Open in IMG/M
3300016750|Ga0181505_10066870Not Available551Open in IMG/M
3300017938|Ga0187854_10011695All Organisms → cellular organisms → Bacteria5407Open in IMG/M
3300017938|Ga0187854_10244242All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium781Open in IMG/M
3300017946|Ga0187879_10003050All Organisms → cellular organisms → Bacteria11287Open in IMG/M
3300017955|Ga0187817_10129895Not Available1596Open in IMG/M
3300017955|Ga0187817_10268023Not Available1088Open in IMG/M
3300017955|Ga0187817_10368623Not Available916Open in IMG/M
3300017955|Ga0187817_10938574Not Available554Open in IMG/M
3300017955|Ga0187817_11044954Not Available524Open in IMG/M
3300018003|Ga0187876_1006417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6928Open in IMG/M
3300018009|Ga0187884_10105090All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300018012|Ga0187810_10153069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium926Open in IMG/M
3300018013|Ga0187873_1020712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3377Open in IMG/M
3300018022|Ga0187864_10015819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4828Open in IMG/M
3300018022|Ga0187864_10186712All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300018030|Ga0187869_10141611All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300018057|Ga0187858_10586344Not Available674Open in IMG/M
3300018086|Ga0187769_10014344All Organisms → cellular organisms → Bacteria5135Open in IMG/M
3300018482|Ga0066669_10440420All Organisms → cellular organisms → Bacteria → Acidobacteria1116Open in IMG/M
3300018482|Ga0066669_10869392Not Available804Open in IMG/M
3300019887|Ga0193729_1260797Not Available541Open in IMG/M
3300020170|Ga0179594_10299049Not Available609Open in IMG/M
3300020199|Ga0179592_10379683Not Available619Open in IMG/M
3300021086|Ga0179596_10306955Not Available792Open in IMG/M
3300021180|Ga0210396_10899992Not Available754Open in IMG/M
3300021401|Ga0210393_10446961All Organisms → cellular organisms → Bacteria → Acidobacteria1055Open in IMG/M
3300021407|Ga0210383_10127521All Organisms → cellular organisms → Bacteria2154Open in IMG/M
3300021474|Ga0210390_11607610Not Available511Open in IMG/M
3300022524|Ga0224534_1005164All Organisms → cellular organisms → Bacteria → Acidobacteria4908Open in IMG/M
3300022557|Ga0212123_10003458All Organisms → cellular organisms → Bacteria → Acidobacteria33027Open in IMG/M
3300022557|Ga0212123_10026198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6232Open in IMG/M
3300022557|Ga0212123_10121911All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2071Open in IMG/M
3300023090|Ga0224558_1009162All Organisms → cellular organisms → Bacteria6269Open in IMG/M
3300023259|Ga0224551_1088932All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300024271|Ga0224564_1047050All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300025432|Ga0208821_1009118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2544Open in IMG/M
3300025459|Ga0208689_1003335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae7155Open in IMG/M
3300025612|Ga0208691_1000668All Organisms → cellular organisms → Bacteria12535Open in IMG/M
3300025612|Ga0208691_1042408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1039Open in IMG/M
3300025650|Ga0209385_1131942Not Available765Open in IMG/M
3300025878|Ga0209584_10023235All Organisms → cellular organisms → Bacteria2109Open in IMG/M
3300025878|Ga0209584_10423735Not Available514Open in IMG/M
3300025888|Ga0209540_10339330Not Available840Open in IMG/M
3300025939|Ga0207665_10125665All Organisms → cellular organisms → Bacteria → Proteobacteria1816Open in IMG/M
3300026223|Ga0209840_1059215All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium850Open in IMG/M
3300026273|Ga0209881_1083128Not Available794Open in IMG/M
3300026296|Ga0209235_1113078Not Available1152Open in IMG/M
3300026304|Ga0209240_1058245Not Available1448Open in IMG/M
3300026304|Ga0209240_1151923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae723Open in IMG/M
3300026323|Ga0209472_1268703Not Available543Open in IMG/M
3300026481|Ga0257155_1090690Not Available502Open in IMG/M
3300027011|Ga0207740_1001089All Organisms → cellular organisms → Bacteria4769Open in IMG/M
3300027011|Ga0207740_1019989Not Available891Open in IMG/M
3300027575|Ga0209525_1033170All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300027652|Ga0209007_1028980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1422Open in IMG/M
3300027657|Ga0256865_1184706Not Available552Open in IMG/M
3300027812|Ga0209656_10074687All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1838Open in IMG/M
3300027846|Ga0209180_10392261All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300027854|Ga0209517_10164305Not Available1407Open in IMG/M
3300027875|Ga0209283_10080737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2107Open in IMG/M
3300027894|Ga0209068_10032537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2589Open in IMG/M
3300027894|Ga0209068_10043485All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2264Open in IMG/M
3300027895|Ga0209624_10100578Not Available1888Open in IMG/M
3300028780|Ga0302225_10588595All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300029889|Ga0246001_1034517Not Available1247Open in IMG/M
3300030007|Ga0311338_10831968Not Available916Open in IMG/M
3300030007|Ga0311338_11121511All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300030058|Ga0302179_10381381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300030114|Ga0311333_10139600All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae1843Open in IMG/M
3300031234|Ga0302325_10244378All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3001Open in IMG/M
3300031236|Ga0302324_101745677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales794Open in IMG/M
3300031668|Ga0318542_10032680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2255Open in IMG/M
3300031708|Ga0310686_110507265All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1229Open in IMG/M
3300031753|Ga0307477_10000148All Organisms → cellular organisms → Bacteria98532Open in IMG/M
3300031754|Ga0307475_11112222Not Available618Open in IMG/M
3300031879|Ga0306919_11264948Not Available559Open in IMG/M
3300031902|Ga0302322_101463653All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300031941|Ga0310912_10506264All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum → Ralstonia solanacearum UW551941Open in IMG/M
3300032001|Ga0306922_12199716All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300032044|Ga0318558_10100759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1352Open in IMG/M
3300032160|Ga0311301_11342233All Organisms → cellular organisms → Bacteria → Acidobacteria899Open in IMG/M
3300032782|Ga0335082_10278096All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300032829|Ga0335070_10034847All Organisms → cellular organisms → Bacteria5678Open in IMG/M
3300032829|Ga0335070_10332358All Organisms → cellular organisms → Bacteria → Acidobacteria1466Open in IMG/M
3300032893|Ga0335069_10006888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae16465Open in IMG/M
3300032893|Ga0335069_10077981All Organisms → cellular organisms → Bacteria4241Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland10.18%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.79%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.19%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil4.19%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.59%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring3.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.59%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa3.59%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost3.59%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.40%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.40%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.99%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil2.99%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.80%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.20%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.20%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.60%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.60%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.60%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.60%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004478Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011084Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300027011Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027657Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeqEnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1084031213300001593Forest SoilSVTLFEKTPILCALQALDADADFAENVNQLILFDL*
Ga0062386_10166146013300004152Bog Forest SoilILQILSLTLFEKTPILCALQGIDEDANFTENLNQLILFDF*
Ga0068972_150061223300004478Peatlands SoilYQILQILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF*
Ga0066680_1085399823300005174SoilLQILSVTLFEKTPILCALQAIDVEANFAENVNQLILFDF*
Ga0070706_10113401023300005467Corn, Switchgrass And Miscanthus RhizosphereTLQILSVTLFEKTPILCALQVPHADAEFADNVNQLILFDI*
Ga0066697_1039330123300005540SoilVTLFEKTPILCALQAIGVEANFAENVNQLILFDF*
Ga0066692_1072213913300005555SoilVTLFEKTPILCALQAIDVEANFAENVNQLILFDF*
Ga0066706_1036844513300005598SoilVTLFEKTPILCALQAPEADAEFAENVNQLILFDI*
Ga0066652_10019969153300006046SoilQILSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI*
Ga0097691_102249763300006055Arctic Peat SoilSLTLFEKTPILCVLQSIEEDANFAENANQLILFDF*
Ga0075030_10154950413300006162WatershedsLTLFEKTPILCALQAIDRDANFVDNPNQLILFDF*
Ga0075520_131011123300006795Arctic Peat SoilSLTLFEKTPILCALQGIDEDTNLAENANQLILFDF*
Ga0075520_132715823300006795Arctic Peat SoilYQILQILSLTLFEKTPILCALQGIDEDANFTENVNQLILFEF*
Ga0073928_1000222643300006893Iron-Sulfur Acid SpringVKTQIWILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF*
Ga0073928_1002336873300006893Iron-Sulfur Acid SpringLTLFEKTPILCVLQAIDQDANFAENVNQLILFDF*
Ga0073928_1068799433300006893Iron-Sulfur Acid SpringSVTLFEKAPILCALQAPEADAEFAENVNQLILFDI*
Ga0099794_1019953423300007265Vadose Zone SoilVTLFEKTPILCALQAPDADAEFAENVNQLILFDI*
Ga0066710_10040078033300009012Grasslands SoilSVTLFEKTPILCALQALDAGADFAENVNQLILFDL
Ga0066793_1002858713300009029Prmafrost SoilSLTLFEKTPILCALQAIEEDANFTENANQLILFDF*
Ga0066793_1004652323300009029Prmafrost SoilSLTLFEKTPILCALQGIEEDANFTANANQLILFDF*
Ga0066793_1006224123300009029Prmafrost SoilLQILSLTLFEKTPILCALQSIDLDSNFTENANQLILFDF*
Ga0066793_1047001713300009029Prmafrost SoilLQILSLTLFEKTPILCALQAIEENANFIENANQLILFDF*
Ga0066793_1086259413300009029Prmafrost SoilTLQILSVTLFEKTPILRALRALDAGANFAENVNQLILFDF*
Ga0099827_1012439823300009090Vadose Zone SoilSVTLFEKTPILCALQAIDMEANFGENVNQLILFDF*
Ga0066709_10047707533300009137Grasslands SoilSVTLFEKTPILCALQAIGVEANFAENVNQLILFDF*
Ga0066709_10424992813300009137Grasslands SoilSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI*
Ga0116128_100275413300009518PeatlandILSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL*
Ga0116128_107328613300009518PeatlandSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL*
Ga0116128_120301113300009518PeatlandSVTLFEKTPILCALQVPEAGAEFAETVNQLILFDI*
Ga0116108_101991113300009519PeatlandVTLFEKTPILYALQPLEVGADFAENVNQLILFDL*
Ga0116108_102349533300009519PeatlandLSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI*
Ga0116222_145571113300009521Peatlands SoilLQILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF*
Ga0116111_110182123300009616PeatlandSLTLFEKTPILCALQPIDPDANFAEHANQLILFDF*
Ga0116127_109510433300009618PeatlandILSLTLFEKTPILCALQAIDQDANSPQNANQLILFDLLTGQQ*
Ga0116114_1002200163300009630PeatlandSVTLFEKTLILCALQAPEADAEFAENVNQLILFDI*
Ga0116115_100904453300009631PeatlandTLFEKTPILCALQAIDQDANSPQNANQLILFDLLTGQQ*
Ga0116129_1003087103300009633PeatlandSVTLFEKTPILCALQASDAEAEFTENVNQLILFDI*
Ga0116110_107848313300009643PeatlandSLTLFEKTPILCALQAIDRDANFAENANQLILFDF*
Ga0116110_122304513300009643PeatlandILQILSLTLFEKTPILCALQAIDRDANFAENANQLILFDF*
Ga0116121_131492133300009644PeatlandVTLFEKTPILCALQVPEAGAEFAETVNQLILFDI*
Ga0134111_1039031613300010329Grasslands SoilYQILQILSLTLFEKTPILCALRPIDQDASSENVNQLILFEF*
Ga0074046_10002019183300010339Bog Forest SoilILQILSVSLFEKTPILCALQAIDEDGNSTDNVNQLILFDF*
Ga0074046_1001221553300010339Bog Forest SoilSVSLFEKTPILCALQSIDQDSNFTENANQLILFDF*
Ga0074046_1025564213300010339Bog Forest SoilQILQILSVSLFEKTPILCALQAIDEDGNSTDNVNQLILFDS*
Ga0074046_1038772613300010339Bog Forest SoilSVTLFEKTPILCALQTPEADAEFAESVNQLILFDI*
Ga0126372_1323972423300010360Tropical Forest SoilSLTLFEKTPISCALQAIDTDANFAENANQLILFEF*
Ga0136449_100067446103300010379Peatlands SoilSVTLFEKTPILCALQAFDTDADFAENVNQLILFDL*
Ga0136449_10107512213300010379Peatlands SoilQILQILSLTLFEKTPILCALQAIDRDANFTENVNQLILFNF*
Ga0138562_116512513300011084Peatlands SoilLTLFEKTPILCALQAIDQDANFAENVNQLILFDF*
Ga0137392_1047751723300011269Vadose Zone SoilSVTLFEKTPILCALQAIDVEANFAENVNQLILFDF*
Ga0137393_1102621913300011271Vadose Zone SoilILSVTLFEKRPILCALQAIGVEANFAENVNHLILFDF*
Ga0137383_1023533913300012199Vadose Zone SoilSLYQILQSLSLTLIEKTPILCVLQAIDQNANCAENANQLILFDF*
Ga0137363_10000732233300012202Vadose Zone SoilSITLFEKTPILCALQTIDPDANFAESANQLILFDF*
Ga0137363_1000227513300012202Vadose Zone SoilITLFEKTPILCALQTIDPDANFAESANQLILFDF*
Ga0137374_1011500753300012204Vadose Zone SoilSLTLFEKTPILCVLQAIDQNANFAENANQLILFDF*
Ga0137379_1061938923300012209Vadose Zone SoilSVTLFEKTPILCALQTPEADAEFAENVNQLILFDI*
Ga0137378_1169316723300012210Vadose Zone SoilLQILSLTLFEKTPILCVLQAIDQNANFAENANQLILFHF*
Ga0137377_1040397523300012211Vadose Zone SoilLSVTLFEKTPILCALQAIDMEANFGENVNQLILFDF*
Ga0137387_1080680813300012349Vadose Zone SoilMNVLSVTLFEKTPISCALQAIDVEANFAENVNQLILFDF*
Ga0137384_1014629333300012357Vadose Zone SoilYQALQILSVTLFEKTPILCALQTPEADAEFAENVNQLILFDI*
Ga0137385_1117446913300012359Vadose Zone SoilILSLTLFEKTPILCALQAIDQDANLAENANQLILFDF*
Ga0137395_1066832523300012917Vadose Zone SoilSVTLFEKTPILCALQALDTGADFTENVNQLILFDL*
Ga0137416_1014291923300012927Vadose Zone SoilSVTLFEKTPISCALQALDVGADFAENVNQLILFDL*
Ga0137404_1027501343300012929Vadose Zone SoilQILQILSLTLFEKTPILCVLQAIDQNANFAENANQLILFDF*
Ga0182018_1002234083300014489PalsaSVTLFEKTPILCALQAPDADAEFAENVNQLILFDI*
Ga0182018_1018301213300014489PalsaILSVTLFEKTPILCALQAPDADAEFAENVNQLILFDI*
Ga0182018_1030924623300014489PalsaLSITLFEKTPILCALQAIDVEANFAENVNQLILFDF*
Ga0182015_100000301643300014495PalsaSVTLFEKTTILCALQTPEADAEFAESVNQLILFDI*
Ga0182015_1011458343300014495PalsaSVTLFEKIPILCALQAPDADAEFTENVNQLILFDI*
Ga0182015_1029793733300014495PalsaSITLFEKTPILCALQAIDVEANFAENVNQLILFDF*
Ga0182024_1011521643300014501PermafrostSLTLFEKTPILYALQAIDADANFAENVNQLILFDF*
Ga0182024_1056262613300014501PermafrostSLTLFERTPILCALQPIEPDANSAENVKQLILFDF*
Ga0182024_1156407013300014501PermafrostILSVTLFEKTPILCALQAPDADAEFTENVNQLILFDI*
Ga0182024_1187937313300014501PermafrostLTLFEKTPILCALQAIDPDANFAENVNQLILFNF*
Ga0182024_1196669423300014501PermafrostSLTLFEKTPILCALQAIDPDANFAENVNQLILFNF*
Ga0182024_1242099823300014501PermafrostSVTLFEKTPISCALQAIDVEANFAENVNQLILFDF*
Ga0182030_1021814113300014838BogLSLTLFEKTPILRALQTFDVDKDLAENHNQLILFDF*
Ga0182027_1048478213300014839FenSLTLFEKTPILCALQTIDLDANFTENVNQLILFEF*
Ga0182032_1003535683300016357SoilMADTIPQILSLTVFKKTPISCALQAIDEDANFTQNVNQLILFEF
Ga0182037_1023527323300016404SoilSVSLFEKTPISCALQAIDEDANFAKNVNQLILFDF
Ga0182038_1004912563300016445SoilMADTILQILSLTVFKKTPISCALQAIDEDANFTENVNQLILFEF
Ga0181505_1006687023300016750PeatlandASLSNQILQILSPTLFEKTPILCALQTDDAHSNFTHDANQLILFNF
Ga0187854_10011695113300017938PeatlandSVTLFEKTLILCALQAPEADAEFAENVNQLILFDI
Ga0187854_1024424223300017938PeatlandLSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI
Ga0187879_1000305013300017946PeatlandSVTLFEKTPILCALQVPEAGAEFAETVNQLILFDI
Ga0187817_1012989523300017955Freshwater SedimentSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF
Ga0187817_1026802333300017955Freshwater SedimentLQILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF
Ga0187817_1036862313300017955Freshwater SedimentLSLTLFEKTPILCALQAIDQDANFAENANQLILFDF
Ga0187817_1093857423300017955Freshwater SedimentSLTLFEKTPILCALQAIDPDANFAENVNQLILFDF
Ga0187817_1104495423300017955Freshwater SedimentSLTLFEKTPILCALQAIDQDANFAQNVNQLILFDF
Ga0187876_1006417103300018003PeatlandSVSLFEKTPILCTLQAIGGDANFAENVNQLILFDF
Ga0187884_1010509043300018009PeatlandLSVTLFEKTPILCALQAPESDAKFAENVNQLILFDI
Ga0187810_1015306933300018012Freshwater SedimentQIFSLTLFEKTPILCALEAIDADANFSENVNQLILFNF
Ga0187873_102071213300018013PeatlandILSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL
Ga0187864_1001581913300018022PeatlandILQILSLTLFEKTPILCALQAIDRDANFAENANQLILFDF
Ga0187864_1018671213300018022PeatlandSLTLFEKTPILCALQAIDRDANFAENANQLILFDF
Ga0187869_1014161123300018030PeatlandYQTLQILSVTLFEKIPILCALQTREADAEFVESVNRLILFDI
Ga0187858_1058634423300018057PeatlandILQILSLTLFEKTPILCALQAIDRDANFAENANHLILFYF
Ga0187769_1001434413300018086Tropical PeatlandLEILSVSLFEKTPILCALQAIDADANFTENANQLILFQLLTEQQ
Ga0066669_1044042023300018482Grasslands SoilLQILSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI
Ga0066669_1086939213300018482Grasslands SoilSLTLFEKTPILCALRPIDQDASSTENVNQLILFEF
Ga0193729_126079713300019887SoilLSLTLFEKTPILCALQAIDQDANFPENVNQLILFDF
Ga0179594_1029904923300020170Vadose Zone SoilLSLTLFEKTPILCTLQTIDEGANFAKNLNQLILFEF
Ga0179592_1037968323300020199Vadose Zone SoilLSLTLFEKTPILCALQAIDPDANFAENANQLILFDF
Ga0179596_1030695513300021086Vadose Zone SoilLSVTLFEKTPILCALQTPEADAEFAENVNQLILFDI
Ga0210396_1089999223300021180SoilLSLTLFEKTPILCALQAPEADAEFAENVNQLILFDI
Ga0210393_1044696113300021401SoilSVTLFEKTPILCALDAPDADAEFTENVNQLILFDI
Ga0210383_1012752133300021407SoilLSVTLFEKTPILCALQAPDADAEFAENVNQLILFDI
Ga0210390_1160761023300021474SoilILSVPLFEKTPILCALQAPDAEAEFSEKVNQLILFDI
Ga0224534_100516453300022524SoilLSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL
Ga0212123_1000345833300022557Iron-Sulfur Acid SpringVKTQIWILSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF
Ga0212123_1002619813300022557Iron-Sulfur Acid SpringSLTLFEKTPILCVLQAIDQDANFAENVNQLILFDF
Ga0212123_1012191123300022557Iron-Sulfur Acid SpringSVTLFEKAPILCALQAPEADAEFAENVNQLILFDI
Ga0224558_100916273300023090SoilLSLTLFEKTPILCALQAIDRDANFAENANQLILFDF
Ga0224551_108893213300023259SoilLSITLFEKTPILCALQAIDVEANFAENVNQLILFDF
Ga0224564_104705013300024271SoilLSVTLFEKTPILCALQTPEADAEFAESVNQLILFDI
Ga0208821_100911813300025432PeatlandQILSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL
Ga0208689_100333583300025459PeatlandSVTLFEKTPILYALQPLEVGADFAENVNQLILFDL
Ga0208691_100066813300025612PeatlandYQALQILSVTLFEKTLILCALQAPEADAEFAENVNQLILFDI
Ga0208691_104240833300025612PeatlandILSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI
Ga0209385_113194213300025650Arctic Peat SoilLSLTLFEKTPILCALQGIDEDTNLAENANQLILFDF
Ga0209584_1002323533300025878Arctic Peat SoilLSLTLFEKTPILCVLQGIDEDTNLAENANQLILFDF
Ga0209584_1042373523300025878Arctic Peat SoilLSLTLFEKTPILCALQSIEEDASFAENANQLILFDF
Ga0209540_1033933033300025888Arctic Peat SoilLSLTLFEKTPILCALQAIDQDAHFAENVNQLILFDF
Ga0207665_1012566513300025939Corn, Switchgrass And Miscanthus RhizosphereLQILSVTLFEKTPILCALQTPEADAEFAESVNQLILFDI
Ga0209840_105921523300026223SoilLSLTLFEKTPILCALQGIEEDANFTANANQLILFDF
Ga0209881_108312813300026273SoilTSTRLFEKTPILCALQALDADANFTENVNQLILFNS
Ga0209235_111307823300026296Grasslands SoilLSVTLFEKTPILCALQAIGVEANFAENVNQLILFDF
Ga0209240_105824533300026304Grasslands SoilILSLTLFEKTPILCVLQAIDQNANFAENANQLILFDF
Ga0209240_115192313300026304Grasslands SoilLSLTLFEKTPILCVLQAIDQNANFAENANQLILFDF
Ga0209472_126870323300026323SoilLSLTLFEKTPILCALRPIDQDASSTENVNQLILFEF
Ga0257155_109069013300026481SoilLSVTLFEKTPILCALQAPDADAEFTENVNQLILFDI
Ga0207740_100108973300027011Tropical Forest SoilILSVSLFEKTPISCALQAIDEDANFAKNVNQLIFFDF
Ga0207740_101998913300027011Tropical Forest SoilILSVSLFEKTPISCALQAIDEDANFAKNVNQLILFDF
Ga0209525_103317013300027575Forest SoilQILSVTLFEKTPILCALQTSEADVEFAESVNQLILFDI
Ga0209007_102898043300027652Forest SoilYQTLQILSVTLFEKTPILCALQASDAEAEFTKNVNQLILFDI
Ga0256865_118470613300027657SoilLSLTLFEKTPILCALQAIDADANFTENVNQLILFNF
Ga0209656_1007468743300027812Bog Forest SoilLSLTLFEKAPILCALQGIEEDASFTGNANQLILFDF
Ga0209180_1039226123300027846Vadose Zone SoilLSVTLFEKTPILCALQAIDVEANFAENVNQLILFDF
Ga0209517_1016430513300027854Peatlands SoilLSVTLFEKTPILCALQAFDTDADFAENVNQLILFDL
Ga0209283_1008073733300027875Vadose Zone SoilLQVLSVTLFEKTPISYALQTIDPDANFATNVNQLILFEF
Ga0209068_1003253753300027894WatershedsSLTLFEKTPILCALQMIDPKANFAKNVNQLILFDF
Ga0209068_1004348533300027894WatershedsSVTLFEKTPILCALQAPDAGANFAENVNQLILFDL
Ga0209624_1010057823300027895Forest SoilLSVTLFEKTPILCALQVPEADAEFAENVNQLILFDI
Ga0302225_1058859533300028780PalsaILSVTLFEKTPILCALQPLHAGADLAENVNQLILFDL
Ga0246001_103451713300029889PeatSVTLFEKTPILCALQAPEADAEFAENVNQLILFDI
Ga0311338_1083196813300030007PalsaLQTLSVTLFEKTPISCALQAIDMEADFSENINQLILFDF
Ga0311338_1112151113300030007PalsaSVTLFEKTPISCALQASDVEADFTENVNQLILFDF
Ga0302179_1038138113300030058PalsaYQALQILSVTHFEKTALLSALQDPEAGAELAENVNQLILFDI
Ga0311333_1013960023300030114FenSITLFEKTPILCALQTIEEDANLAEDANQLILFDF
Ga0302325_1024437813300031234PalsaILSVTLFEKTPISCALQASDVEADFTENVNQLILFDF
Ga0302324_10174567713300031236PalsaLSLTLFEKTPILCALQAIDEDANFVENVNQLILFEF
Ga0318542_1003268013300031668SoilLTDVQPHLFSMADTIPQILSLTVFKKTPISCALQAIDEDANFTENVNQLILFEF
Ga0310686_11050726533300031708SoilLVPLSLTLFEKTPILCALQAIERDADIAEDVNQLMLFDF
Ga0307477_10000148413300031753Hardwood Forest SoilLEDPETLSVTLFEKTPILCALQTPEADAEFAESVNQLIRFDI
Ga0307475_1111222223300031754Hardwood Forest SoilADSPILSITLFEKTPILCALQAINQDASFAESANQLILFDF
Ga0306919_1126494823300031879SoilMADTIPQILSLTVFKKTPISCALQAIDEDANFTENVNQLILFEF
Ga0302322_10146365313300031902FenLSLTLFEKTPILCALQSLEQDANFTENANQLILFDF
Ga0310912_1050626413300031941SoilLSVSLFEKTPISCALQAIDEDANFAKNVNQLILFDF
Ga0306922_1219971613300032001SoilQILSVTLFEKTPILCALQTPEADAEFAESVNQLILFDI
Ga0318558_1010075923300032044SoilLSLTLFEKTPISCALQVSDEGPNFTDNVNQLILFEF
Ga0311301_1134223313300032160Peatlands SoilLSLTLFEKTPILCALQAIDQDANFAENVNQLILFDF
Ga0335082_1027809633300032782SoilLSLTLFEKTPISCALRAIDRQANFAENANQLILFEF
Ga0335070_1003484793300032829SoilLSLTLFEKTPILCALQAIDPDANFSENANQLILFEF
Ga0335070_1033235823300032829SoilSLTLFEKTPISCALRAIDRQANFAENANQLILFDF
Ga0335069_10006888163300032893SoilVLSLTLFEKTPISCALRAIDRQANFAENANQLILFEF
Ga0335069_1007798113300032893SoilILQVLSLTLFEKTPILCALQSVDPDFHLTENANQLILFEF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.