| Basic Information | |
|---|---|
| Family ID | F037635 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 167 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.42 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (41.317 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (31.736 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.461 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (76.048 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 38.24% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF03819 | MazG | 22.16 |
| PF13392 | HNH_3 | 2.99 |
| PF10124 | Mu-like_gpT | 2.99 |
| PF04404 | ERF | 2.40 |
| PF09588 | YqaJ | 1.20 |
| PF06378 | DUF1071 | 1.20 |
| PF05367 | Phage_endo_I | 0.60 |
| PF01367 | 5_3_exonuc | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.87 % |
| Unclassified | root | N/A | 34.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109048952 | Not Available | 577 | Open in IMG/M |
| 3300002408|B570J29032_109691855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300003277|JGI25908J49247_10024314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1776 | Open in IMG/M |
| 3300004240|Ga0007787_10554760 | Not Available | 575 | Open in IMG/M |
| 3300005581|Ga0049081_10287906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 568 | Open in IMG/M |
| 3300005581|Ga0049081_10330308 | Not Available | 520 | Open in IMG/M |
| 3300005582|Ga0049080_10076480 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300005582|Ga0049080_10207442 | Not Available | 646 | Open in IMG/M |
| 3300005582|Ga0049080_10237149 | Not Available | 597 | Open in IMG/M |
| 3300005584|Ga0049082_10112670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300005943|Ga0073926_10065164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300006802|Ga0070749_10192381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
| 3300006805|Ga0075464_10125274 | All Organisms → Viruses → Predicted Viral | 1495 | Open in IMG/M |
| 3300006805|Ga0075464_10405890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300006805|Ga0075464_10682347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 635 | Open in IMG/M |
| 3300006875|Ga0075473_10364223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300006917|Ga0075472_10132801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1219 | Open in IMG/M |
| 3300007363|Ga0075458_10035826 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300007538|Ga0099851_1305982 | Not Available | 560 | Open in IMG/M |
| 3300007542|Ga0099846_1179688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300007622|Ga0102863_1233505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300007708|Ga0102859_1163729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300007973|Ga0105746_1137838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300007973|Ga0105746_1309229 | Not Available | 549 | Open in IMG/M |
| 3300008113|Ga0114346_1199933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300008113|Ga0114346_1265837 | Not Available | 623 | Open in IMG/M |
| 3300008119|Ga0114354_1251132 | Not Available | 566 | Open in IMG/M |
| 3300008121|Ga0114356_1224382 | All Organisms → Viruses → Predicted Viral | 1364 | Open in IMG/M |
| 3300008259|Ga0114841_1081153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1468 | Open in IMG/M |
| 3300008259|Ga0114841_1237896 | Not Available | 610 | Open in IMG/M |
| 3300008261|Ga0114336_1331765 | Not Available | 555 | Open in IMG/M |
| 3300008267|Ga0114364_1035914 | All Organisms → Viruses → Predicted Viral | 2329 | Open in IMG/M |
| 3300008448|Ga0114876_1115791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300008962|Ga0104242_1043483 | Not Available | 761 | Open in IMG/M |
| 3300009051|Ga0102864_1213183 | Not Available | 526 | Open in IMG/M |
| 3300009068|Ga0114973_10100213 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300009068|Ga0114973_10499016 | Not Available | 630 | Open in IMG/M |
| 3300009068|Ga0114973_10692481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300009079|Ga0102814_10517828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300009151|Ga0114962_10239158 | Not Available | 1040 | Open in IMG/M |
| 3300009152|Ga0114980_10016841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4600 | Open in IMG/M |
| 3300009152|Ga0114980_10661782 | Not Available | 587 | Open in IMG/M |
| 3300009155|Ga0114968_10230318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300009155|Ga0114968_10520324 | Not Available | 637 | Open in IMG/M |
| 3300009158|Ga0114977_10368488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300009158|Ga0114977_10472934 | Not Available | 689 | Open in IMG/M |
| 3300009160|Ga0114981_10465862 | Not Available | 677 | Open in IMG/M |
| 3300009161|Ga0114966_10496512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300009164|Ga0114975_10018795 | Not Available | 4205 | Open in IMG/M |
| 3300009164|Ga0114975_10521386 | Not Available | 639 | Open in IMG/M |
| 3300009164|Ga0114975_10717251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300009169|Ga0105097_10477466 | Not Available | 696 | Open in IMG/M |
| 3300009180|Ga0114979_10067802 | All Organisms → Viruses → Predicted Viral | 2223 | Open in IMG/M |
| 3300009180|Ga0114979_10454977 | Not Available | 744 | Open in IMG/M |
| 3300009182|Ga0114959_10544534 | Not Available | 557 | Open in IMG/M |
| 3300009182|Ga0114959_10560286 | Not Available | 548 | Open in IMG/M |
| 3300009182|Ga0114959_10582756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300009183|Ga0114974_10278241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
| 3300009183|Ga0114974_10378891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300009183|Ga0114974_10458716 | Not Available | 721 | Open in IMG/M |
| 3300009184|Ga0114976_10007419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6818 | Open in IMG/M |
| 3300009194|Ga0114983_1141533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300009419|Ga0114982_1136529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300009419|Ga0114982_1283373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 519 | Open in IMG/M |
| 3300010158|Ga0114960_10168113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300010160|Ga0114967_10300086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300010334|Ga0136644_10164749 | Not Available | 1341 | Open in IMG/M |
| 3300010334|Ga0136644_10298606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
| 3300010334|Ga0136644_10626803 | Not Available | 589 | Open in IMG/M |
| 3300010885|Ga0133913_10657939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2746 | Open in IMG/M |
| 3300010885|Ga0133913_11969553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1453 | Open in IMG/M |
| 3300011184|Ga0136709_1041284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300011268|Ga0151620_1257664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300012264|Ga0136715_1037526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300012666|Ga0157498_1043452 | Not Available | 690 | Open in IMG/M |
| 3300012779|Ga0138284_1113228 | All Organisms → Viruses → Predicted Viral | 1990 | Open in IMG/M |
| 3300013004|Ga0164293_10821943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 588 | Open in IMG/M |
| 3300013004|Ga0164293_10843049 | Not Available | 579 | Open in IMG/M |
| 3300013372|Ga0177922_10359816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300013372|Ga0177922_11219161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300017701|Ga0181364_1070278 | Not Available | 536 | Open in IMG/M |
| 3300017716|Ga0181350_1095916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300017716|Ga0181350_1107366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300017716|Ga0181350_1134149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300017716|Ga0181350_1149338 | Not Available | 546 | Open in IMG/M |
| 3300017722|Ga0181347_1193927 | Not Available | 537 | Open in IMG/M |
| 3300017723|Ga0181362_1043676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300017736|Ga0181365_1051102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300017736|Ga0181365_1134083 | Not Available | 591 | Open in IMG/M |
| 3300017747|Ga0181352_1163371 | Not Available | 584 | Open in IMG/M |
| 3300017754|Ga0181344_1114621 | Not Available | 778 | Open in IMG/M |
| 3300017761|Ga0181356_1198732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 595 | Open in IMG/M |
| 3300017766|Ga0181343_1226454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300017766|Ga0181343_1231965 | Not Available | 501 | Open in IMG/M |
| 3300017774|Ga0181358_1023289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2459 | Open in IMG/M |
| 3300017774|Ga0181358_1203137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 647 | Open in IMG/M |
| 3300017778|Ga0181349_1040325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1853 | Open in IMG/M |
| 3300017778|Ga0181349_1186989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300017780|Ga0181346_1193061 | Not Available | 739 | Open in IMG/M |
| 3300017780|Ga0181346_1196470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300017780|Ga0181346_1228572 | Not Available | 659 | Open in IMG/M |
| 3300017780|Ga0181346_1275110 | Not Available | 579 | Open in IMG/M |
| 3300017784|Ga0181348_1070776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
| 3300017784|Ga0181348_1083418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1265 | Open in IMG/M |
| 3300017784|Ga0181348_1143334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300017785|Ga0181355_1193986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300017785|Ga0181355_1367185 | Not Available | 526 | Open in IMG/M |
| 3300019784|Ga0181359_1095163 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300019784|Ga0181359_1236335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300021963|Ga0222712_10045511 | All Organisms → Viruses → Predicted Viral | 3322 | Open in IMG/M |
| 3300021963|Ga0222712_10639904 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300022179|Ga0181353_1107565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300022179|Ga0181353_1161846 | Not Available | 509 | Open in IMG/M |
| 3300022190|Ga0181354_1152248 | Not Available | 723 | Open in IMG/M |
| 3300022190|Ga0181354_1179849 | Not Available | 643 | Open in IMG/M |
| 3300022407|Ga0181351_1042818 | All Organisms → Viruses → Predicted Viral | 1908 | Open in IMG/M |
| 3300022407|Ga0181351_1137439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
| 3300022407|Ga0181351_1160047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300022407|Ga0181351_1211760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300022407|Ga0181351_1258839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 536 | Open in IMG/M |
| 3300022752|Ga0214917_10418777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300025075|Ga0209615_103298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300025896|Ga0208916_10068432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1475 | Open in IMG/M |
| 3300025896|Ga0208916_10124047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1102 | Open in IMG/M |
| 3300025896|Ga0208916_10240747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300027293|Ga0255132_1016232 | All Organisms → Viruses → Predicted Viral | 1917 | Open in IMG/M |
| 3300027608|Ga0208974_1018880 | All Organisms → Viruses → Predicted Viral | 2160 | Open in IMG/M |
| 3300027656|Ga0209357_1030188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
| 3300027659|Ga0208975_1017813 | All Organisms → Viruses → Predicted Viral | 2360 | Open in IMG/M |
| 3300027708|Ga0209188_1055603 | Not Available | 1736 | Open in IMG/M |
| 3300027732|Ga0209442_1098025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
| 3300027734|Ga0209087_1005745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6637 | Open in IMG/M |
| 3300027736|Ga0209190_1254671 | Not Available | 692 | Open in IMG/M |
| 3300027747|Ga0209189_1064797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
| 3300027754|Ga0209596_1291317 | Not Available | 652 | Open in IMG/M |
| 3300027759|Ga0209296_1141937 | Not Available | 1090 | Open in IMG/M |
| 3300027772|Ga0209768_10444404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions | 504 | Open in IMG/M |
| 3300027777|Ga0209829_10104068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
| 3300027785|Ga0209246_10120684 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| 3300027785|Ga0209246_10184538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300027785|Ga0209246_10224735 | Not Available | 730 | Open in IMG/M |
| 3300027785|Ga0209246_10233542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300027798|Ga0209353_10045596 | All Organisms → Viruses → Predicted Viral | 2019 | Open in IMG/M |
| 3300027798|Ga0209353_10148700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
| 3300027798|Ga0209353_10268761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300027798|Ga0209353_10392578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300027805|Ga0209229_10031996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2308 | Open in IMG/M |
| 3300027808|Ga0209354_10005379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5215 | Open in IMG/M |
| 3300027808|Ga0209354_10370785 | Not Available | 561 | Open in IMG/M |
| 3300027969|Ga0209191_1038765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2240 | Open in IMG/M |
| 3300027971|Ga0209401_1022325 | Not Available | 3191 | Open in IMG/M |
| 3300028025|Ga0247723_1031400 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
| 3300028027|Ga0247722_10175600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300028393|Ga0304728_1121061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300028393|Ga0304728_1261741 | Not Available | 574 | Open in IMG/M |
| 3300031758|Ga0315907_10797887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 705 | Open in IMG/M |
| 3300031787|Ga0315900_10372915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
| 3300031787|Ga0315900_10871705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300031951|Ga0315904_11441676 | Not Available | 511 | Open in IMG/M |
| 3300032092|Ga0315905_10484569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
| 3300032092|Ga0315905_11284762 | Not Available | 590 | Open in IMG/M |
| 3300032093|Ga0315902_11169426 | Not Available | 556 | Open in IMG/M |
| 3300032116|Ga0315903_10592657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300034093|Ga0335012_0376525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300034093|Ga0335012_0422693 | Not Available | 647 | Open in IMG/M |
| 3300034106|Ga0335036_0454602 | Not Available | 809 | Open in IMG/M |
| 3300034356|Ga0335048_0414471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli | 665 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 31.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 25.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.19% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.79% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.19% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.80% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.20% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.20% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.20% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.20% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.60% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.60% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.60% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008121 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012264 | Freshwater sediment bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - Sed-PBS metaG | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1090489521 | 3300002408 | Freshwater | VLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| B570J29032_1096918551 | 3300002408 | Freshwater | AVLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF* |
| JGI25908J49247_100243147 | 3300003277 | Freshwater Lake | RSGFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF* |
| Ga0007787_105547603 | 3300004240 | Freshwater Lake | EINPSNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGEF* |
| Ga0049081_102879063 | 3300005581 | Freshwater Lentic | FTYAEINPNNHRSGFAVLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF* |
| Ga0049081_103303081 | 3300005581 | Freshwater Lentic | LNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0049080_100764801 | 3300005582 | Freshwater Lentic | HRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0049080_102074421 | 3300005582 | Freshwater Lentic | YAEINPANHRSGFAVLNFFNSRLLWPELVHKFDENQIEFRGEVIDVGAF* |
| Ga0049080_102371494 | 3300005582 | Freshwater Lentic | AEINPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0049082_101126701 | 3300005584 | Freshwater Lentic | FAVLNFFNGQLLWPELVHKFDENQIQFRGEVIDVGAF* |
| Ga0073926_100651641 | 3300005943 | Sand | VLNFFNGQLLWPELVHKFDEDMVQFRGEVVDVGAF* |
| Ga0070749_101923816 | 3300006802 | Aqueous | VLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF* |
| Ga0075464_101252741 | 3300006805 | Aqueous | NHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0075464_104058901 | 3300006805 | Aqueous | NNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0075464_106823471 | 3300006805 | Aqueous | PSNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0075473_103642233 | 3300006875 | Aqueous | FAVLNFFNGKLLWPEVVHKFDEDQIEFRGEVIDVGEF* |
| Ga0075472_101328015 | 3300006917 | Aqueous | PNNHRSGFAVLNFFNGKLLWPEVVHKFDEDQIEFRGEVIDVGEF* |
| Ga0075458_100358261 | 3300007363 | Aqueous | HRSGFAVLNFFNGKLLWPELVHKFDDGLIEFRGEVIDVSAL* |
| Ga0099851_13059821 | 3300007538 | Aqueous | NPSNHRSGFAVLNFFNGELLLPELVQKFDEDQIQFRGEVIDVGAF* |
| Ga0099846_11796884 | 3300007542 | Aqueous | LNFFNGHLLLPELVQKFDENQVQFRGEVIDVGAF* |
| Ga0102863_12335051 | 3300007622 | Estuarine | SGFAVLNFFNGELLLPELVQKFNEDQIQFRGEVIDVGAF* |
| Ga0102859_11637292 | 3300007708 | Estuarine | ELNPNNHRSGFAVLNFFNGQLLWPELVHKFNDENMIQFRGEVIDVGAF* |
| Ga0105746_11378381 | 3300007973 | Estuary Water | LNPSNHRSGFAVLNFFNGKLLWPELVHKFDEDMVEFRGEVIDVGAF* |
| Ga0105746_13092293 | 3300007973 | Estuary Water | NNHRSGFAVLNFFNGELLWPEIVAKHSEDHIQFRGDVIDVSAF* |
| Ga0114346_11999331 | 3300008113 | Freshwater, Plankton | VLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF* |
| Ga0114346_12658374 | 3300008113 | Freshwater, Plankton | LNFFNGELLWPEIVAKHSEDHIQFRGGVIDVSAF* |
| Ga0114354_12511324 | 3300008119 | Freshwater, Plankton | PSNHRSGFAVLNFFNGKLLWPELVHKFDEDQIEFRGEVIDVGAF* |
| Ga0114356_12243821 | 3300008121 | Freshwater, Plankton | AVLNFFNGQLLWPELVHKFDENQIQFRGEVIDVGAF* |
| Ga0114841_10811531 | 3300008259 | Freshwater, Plankton | FAVLNFFNGKLLWPELVHKFDEDQIEFRGEVIDVGAF* |
| Ga0114841_12378962 | 3300008259 | Freshwater, Plankton | YAEINPSNHRSGFAVLNFFNGQLLWPELVHKFDENQIQFRGEVIDVGAF* |
| Ga0114336_13317654 | 3300008261 | Freshwater, Plankton | HRSGFAVLNFFNGKLLWPELVHKFDEDQIEFRGEVIDVGAF* |
| Ga0114364_10359147 | 3300008267 | Freshwater, Plankton | VLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF* |
| Ga0114876_11157915 | 3300008448 | Freshwater Lake | EINPSNHRSGFAVLNFFNGELLLPELVQKFDEDQIQFRGEVIDVGAF* |
| Ga0104242_10434831 | 3300008962 | Freshwater | SGFAVLNFFNGRLLWPELVHKFGEGLIEFRGSVYDVSEF* |
| Ga0102864_12131831 | 3300009051 | Estuarine | RSGFAVLNFLNGQLLWPELVNKFDEDMIQFRGEVIDVSEF* |
| Ga0114973_101002131 | 3300009068 | Freshwater Lake | VLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVSAF* |
| Ga0114973_104990162 | 3300009068 | Freshwater Lake | PNNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0114973_106924811 | 3300009068 | Freshwater Lake | INPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF* |
| Ga0102814_105178284 | 3300009079 | Estuarine | FAVLNFFNGQLLWPELVHKFEEDMVQFRGEVVDVGAF* |
| Ga0114962_102391581 | 3300009151 | Freshwater Lake | HRSGFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVLDVSEF* |
| Ga0114980_100168411 | 3300009152 | Freshwater Lake | NHRSGFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVVDVSQF* |
| Ga0114980_106617821 | 3300009152 | Freshwater Lake | LTFFNGELLWPELVHSFDEGHIQFRGEVIDVSEF* |
| Ga0114968_102303185 | 3300009155 | Freshwater Lake | GFAVLNFFNGELLWPEIVAKHSEDHIQFRGDVIDVSAF* |
| Ga0114968_105203243 | 3300009155 | Freshwater Lake | VLNFFNGRLLWPELVHKFDEDQIEFRGEVIDVGAF* |
| Ga0114977_103684881 | 3300009158 | Freshwater Lake | HRSGFAVLTFFNGELLWPELVHAFSEDHIQFRGEVIDVSAF* |
| Ga0114977_104729341 | 3300009158 | Freshwater Lake | RSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF* |
| Ga0114981_104658621 | 3300009160 | Freshwater Lake | FAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVSAF* |
| Ga0114966_104965122 | 3300009161 | Freshwater Lake | SGFAVLNFFNGELLWPEIVAKHSEDHIQFRGDVIDVSAF* |
| Ga0114975_100187951 | 3300009164 | Freshwater Lake | SGFAVLTFFNGELLWPELVHAFSEDCIQFRGEVIDVSAF* |
| Ga0114975_105213861 | 3300009164 | Freshwater Lake | AELNPSNHRSGFAVLTFFNGELLWPELVHSFSEGHIQFRGEVIDVSEF* |
| Ga0114975_107172513 | 3300009164 | Freshwater Lake | HRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGEF* |
| Ga0105097_104774662 | 3300009169 | Freshwater Sediment | RFAVLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF* |
| Ga0114979_100678021 | 3300009180 | Freshwater Lake | SGFAVLTFFNGELLWPELVHSFSEGHIQFRGEVIDVSEF* |
| Ga0114979_104549771 | 3300009180 | Freshwater Lake | INPSNHRSGFAVLNFFNGQLLWPELVHKFDEDQIEFRGEVIDVGAF* |
| Ga0114959_105445342 | 3300009182 | Freshwater Lake | FAVLTFFNGELLWPELVHAFSEDHIQFRGEVIDVSAF* |
| Ga0114959_105602862 | 3300009182 | Freshwater Lake | LTFFNGELLWPELVHAFSEDCIQFRGEVIDVSAF* |
| Ga0114959_105827561 | 3300009182 | Freshwater Lake | TFFNGELLWPELVHAFSPTEDYIQFRGEVIDVSQF* |
| Ga0114974_102782411 | 3300009183 | Freshwater Lake | ELNPSNHRSGFAVLNFFNGQLLWPELVHKFSEDHVEFRGEVIDVSAF* |
| Ga0114974_103788914 | 3300009183 | Freshwater Lake | HRSGFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF* |
| Ga0114974_104587163 | 3300009183 | Freshwater Lake | SGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0114976_100074191 | 3300009184 | Freshwater Lake | INPANHRSGFAVLNFFNGQLLWPELVHKFDENMVQFRGEVIDVGEF* |
| Ga0114983_11415333 | 3300009194 | Deep Subsurface | SGFAVLNFHNGKLLWPQLACKFDEGLIDFRGQIIDVSAF* |
| Ga0114982_11365293 | 3300009419 | Deep Subsurface | LNFFNGQLLWPELVHRFSEDHVEFRGEVIDVSAF* |
| Ga0114982_12833731 | 3300009419 | Deep Subsurface | AELNPSNHRSGFAVLNFFNGQLLCPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0114960_101681131 | 3300010158 | Freshwater Lake | AVLTFFNGELLWPELVHAFSPTEDYIQFRGEVIDVSQF* |
| Ga0114967_103000861 | 3300010160 | Freshwater Lake | RSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0136644_101647491 | 3300010334 | Freshwater Lake | RSGFAVLTFFNGELLWPELVHAFSEDCIQFRGEVIDVSAF* |
| Ga0136644_102986064 | 3300010334 | Freshwater Lake | VLTFFNGELLWPELVHAFSPTEDYIQFRGEVIDVSQF* |
| Ga0136644_106268031 | 3300010334 | Freshwater Lake | NHRSGFAVLTFFNGELLWPELVHAFSEDHIQFRGEVIDVSAF* |
| Ga0133913_1065793910 | 3300010885 | Freshwater Lake | FAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0133913_119695531 | 3300010885 | Freshwater Lake | GFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0136709_10412843 | 3300011184 | Freshwater | GFAVLNFFNGKLLWPELVHKFDEDQIEFRGEVIDVGAF* |
| Ga0151620_12576641 | 3300011268 | Freshwater | LNPSNHRSGFAVLNFFNGKLLWPELVHKFDEDLVEFRGEVIDVGAF* |
| Ga0136715_10375262 | 3300012264 | Freshwater Sediment | LNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF* |
| Ga0157498_10434523 | 3300012666 | Freshwater, Surface Ice | FAVLNFFNGQLLWPELAHKFDEDMIQFRGQIIDVGAF* |
| Ga0138284_11132281 | 3300012779 | Freshwater Lake | RSGFAVLNFFNGQLLWPELVHKFSEDHIEFRGEVIDVSEF* |
| Ga0164293_108219431 | 3300013004 | Freshwater | AEINPSNHRSGFAVLNFFNGQLLWPALVHKFDEDQIQFRGAVIDVGAF* |
| Ga0164293_108430491 | 3300013004 | Freshwater | GFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF* |
| Ga0177922_103598162 | 3300013372 | Freshwater | YAEINPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF* |
| Ga0177922_112191612 | 3300013372 | Freshwater | GFAVLNFFNGQLLWPELVHRFSEDHVEFRGEVIDVSAF* |
| Ga0181364_10702783 | 3300017701 | Freshwater Lake | VLNFFNGRLLWPELVHKFDEDLIEFRGEVIDVGAF |
| Ga0181350_10959161 | 3300017716 | Freshwater Lake | NPGNHRSGFAVLNFFNGRLLWPELVHKFNEDQIEFRGEVIDVGAF |
| Ga0181350_11073662 | 3300017716 | Freshwater Lake | HRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVSQF |
| Ga0181350_11341493 | 3300017716 | Freshwater Lake | FAVLNFFNGQLLWPELVHKFDEDMVQFRGEVVDVGAF |
| Ga0181350_11493382 | 3300017716 | Freshwater Lake | NHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAFXVPG |
| Ga0181347_11939271 | 3300017722 | Freshwater Lake | GFAVLNFFNGTLLWPELVHKFDEDMVEFRGEVIDVGEF |
| Ga0181362_10436761 | 3300017723 | Freshwater Lake | NHRSGFAVLNFFNGQLLWPELVHKFDENQIQFRGEVIDVGAF |
| Ga0181365_10511021 | 3300017736 | Freshwater Lake | AEINPANHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0181365_11340831 | 3300017736 | Freshwater Lake | NNHRSGFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF |
| Ga0181352_11633711 | 3300017747 | Freshwater Lake | HRSGFAVLNFFNGELLLPELVQKFDEDQIQFRGEVIDVGAF |
| Ga0181344_11146213 | 3300017754 | Freshwater Lake | NPSNHRSGFAVLNFFNGRLLWPELVHKFDEDQIEFRGEVIDVGAFXVLG |
| Ga0181356_11987322 | 3300017761 | Freshwater Lake | EINPNNHRSGFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF |
| Ga0181343_12264542 | 3300017766 | Freshwater Lake | VLNFFNGQLLLPELVQKFNEDEIQFRGEVIDVGAF |
| Ga0181343_12319652 | 3300017766 | Freshwater Lake | VLNFFNGELLWPEIVAKHSEDHIQFRGDVIDVSAF |
| Ga0181358_10232898 | 3300017774 | Freshwater Lake | AEINPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVVDVGAF |
| Ga0181358_12031373 | 3300017774 | Freshwater Lake | HRSGFAVLNFFNGQLLWPELVHKFDENMIEFRGEVIDVGAF |
| Ga0181349_10403251 | 3300017778 | Freshwater Lake | HRSGFAVLNFFNGRLLWPELVHKFDEDMIEFRGEVIDVGAF |
| Ga0181349_11869891 | 3300017778 | Freshwater Lake | NPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGDVIDVSAF |
| Ga0181346_11930613 | 3300017780 | Freshwater Lake | AVLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF |
| Ga0181346_11964701 | 3300017780 | Freshwater Lake | PANHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0181346_12285721 | 3300017780 | Freshwater Lake | GFAILTFFNGQLLWPELVHDFGNGCVEFRGEVIDVSGL |
| Ga0181346_12751103 | 3300017780 | Freshwater Lake | GFAVLNFFNGQLLWPELVHKFNDENMIQFRGEVIDVGAF |
| Ga0181348_10707761 | 3300017784 | Freshwater Lake | GFAILTFSNGQLLWPELVHDFGNGCVEFRGEVIDVSGL |
| Ga0181348_10834181 | 3300017784 | Freshwater Lake | EINPNNHRLGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0181348_11433342 | 3300017784 | Freshwater Lake | EINPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0181355_11939864 | 3300017785 | Freshwater Lake | GFAVLNFYNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0181355_13671853 | 3300017785 | Freshwater Lake | EINPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0181359_10951635 | 3300019784 | Freshwater Lake | NHRSGFAVLNFFNGQLLWPELVHKFNDENMIQFRGEVIDVGAF |
| Ga0181359_12363351 | 3300019784 | Freshwater Lake | VLNFFNGQLLWPELVHKFDEDMIQFRGEVVDVGAF |
| Ga0222712_1004551110 | 3300021963 | Estuarine Water | NNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVSAF |
| Ga0222712_106399042 | 3300021963 | Estuarine Water | LNPSNHRSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0181353_11075651 | 3300022179 | Freshwater Lake | AEINPANHRSGFAVLNFFNGKLLWPELVHKFEEDHIEFRGEVIDVGAF |
| Ga0181353_11618464 | 3300022179 | Freshwater Lake | RSGFAVLTFYNGRLLWPELVHALAPGAIQFRGQVIDVSKL |
| Ga0181354_11522481 | 3300022190 | Freshwater Lake | NPSNHRSGFAVLNFFNGKLLWPELVHKFDEDLIEFRGEVIDVGAF |
| Ga0181354_11798493 | 3300022190 | Freshwater Lake | DFAVLNFFNGRLLWPELVHKFDEDQIEFRGEVIDVGAF |
| Ga0181351_10428181 | 3300022407 | Freshwater Lake | NPNNHRSGFAVLNFYNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0181351_11374394 | 3300022407 | Freshwater Lake | NNHRSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0181351_11600471 | 3300022407 | Freshwater Lake | SGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0181351_12117603 | 3300022407 | Freshwater Lake | NHRSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGDVIDVSAF |
| Ga0181351_12588392 | 3300022407 | Freshwater Lake | INPSNHRSGFAVLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF |
| Ga0214917_104187772 | 3300022752 | Freshwater | PNNHRSGFAVLNFFNGELLWPEIVAKHSEDHIQFRGDVIDVGAF |
| Ga0209615_1032985 | 3300025075 | Freshwater | VLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF |
| Ga0208916_100684327 | 3300025896 | Aqueous | VLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0208916_101240475 | 3300025896 | Aqueous | AVLNFFNGHLLLPELAQKFDEDQIMFRGEVIDVGAF |
| Ga0208916_102407473 | 3300025896 | Aqueous | RSGFAVLNFFNGQLLWPELVHRFSEDHVEFRGEVIDVSAF |
| Ga0255132_10162321 | 3300027293 | Freshwater | PSNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0208974_10188807 | 3300027608 | Freshwater Lentic | NNHRSGFAVLNFYNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0209357_10301887 | 3300027656 | Freshwater Lake | INPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0208975_10178131 | 3300027659 | Freshwater Lentic | FAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0209188_10556031 | 3300027708 | Freshwater Lake | AVLTFFNGELLWPELVHAFSEDCIQFRGEVIDVSAF |
| Ga0209442_10980251 | 3300027732 | Freshwater Lake | EINPANHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0209087_10057451 | 3300027734 | Freshwater Lake | INPANHRSGFAVLNFFNGQLLWPELVHKFDENMVQFRGEVIDVGEF |
| Ga0209190_12546711 | 3300027736 | Freshwater Lake | PNNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0209189_10647976 | 3300027747 | Freshwater Lake | LTFFNGELLWPELVHAFSPTEDYIQFRGEVIDVSQF |
| Ga0209596_12913173 | 3300027754 | Freshwater Lake | AEINPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0209296_11419374 | 3300027759 | Freshwater Lake | NPSNHRSGFAVLNFFNGRLLWPELVHKFDEDLVEFRGEVIDVGAF |
| Ga0209768_104444042 | 3300027772 | Freshwater Lake | AEINPNNHRSGFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF |
| Ga0209829_101040685 | 3300027777 | Freshwater Lake | NPNNHRSGFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0209246_101206841 | 3300027785 | Freshwater Lake | INPSNHRSGFAVLNFFNGELLLPELVQKFDEDQIQFRGEVIDVGAF |
| Ga0209246_101845384 | 3300027785 | Freshwater Lake | HRSGFAVLNFFNGQLLTPELVQKFDENQIQFRGEVIDVGAF |
| Ga0209246_102247351 | 3300027785 | Freshwater Lake | AVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0209246_102335421 | 3300027785 | Freshwater Lake | FAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0209353_100455967 | 3300027798 | Freshwater Lake | SGFAVLNFFNGQLLTPELVQKFDENQIQFRGEVIDVGAF |
| Ga0209353_101487001 | 3300027798 | Freshwater Lake | GFAVLNFFNGQLLWPELVHKFDEDMIQFRGEVIDVGAF |
| Ga0209353_102687612 | 3300027798 | Freshwater Lake | RSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0209353_103925781 | 3300027798 | Freshwater Lake | FTYAELNPNNHRSGFAVLNFFNGHLLLPEIAQKYSENLIQFRGEVIDVSAF |
| Ga0209229_100319966 | 3300027805 | Freshwater And Sediment | SGFAVLNFFNGQLLWPELVHKFDEDQIQFRGEVIDVGAF |
| Ga0209354_1000537914 | 3300027808 | Freshwater Lake | AEINPSNHRSGFAVLNFFNGQLLTPELVQKFDENQIQFRGEVIDVGAF |
| Ga0209354_103707851 | 3300027808 | Freshwater Lake | FAVLNFFNGQLLWPELVHKFNDENMIQFRGEVIDVGAF |
| Ga0209191_10387658 | 3300027969 | Freshwater Lake | NHRSGFAVLTFFNGELLWPELVHSFSEDHIQFRGEVIDVSAF |
| Ga0209401_10223251 | 3300027971 | Freshwater Lake | RSGFAVLNFFNGRLLWPELVHKFDENMVQFRGSVIDVSEL |
| Ga0247723_10314006 | 3300028025 | Deep Subsurface Sediment | SGFAVLNFFNGQLLWPELVHRFSEDHVEFRGEVIDVGAF |
| Ga0247722_101756004 | 3300028027 | Deep Subsurface Sediment | GFAVLNFFNGELLTPELVQKFDENQIQFRGEVIDVGAF |
| Ga0304728_11210614 | 3300028393 | Freshwater Lake | GFAVLTFFNGELLWPELIHAFSEGCIQFRGEVIDVSAF |
| Ga0304728_12617412 | 3300028393 | Freshwater Lake | AVLTFFNGELLWPELVHAFSEDHIQFRGEVIDVSAF |
| Ga0315907_107978871 | 3300031758 | Freshwater | FTYAELNPSNHRSGFAVLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF |
| Ga0315900_103729151 | 3300031787 | Freshwater | HRSGFAVLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF |
| Ga0315900_108717053 | 3300031787 | Freshwater | GFAVLNFFNGELLLPELVQKFDEDQIQFRGEVIDVGAF |
| Ga0315904_114416763 | 3300031951 | Freshwater | SNHRSGFAVLNFFNGHLLLPELAQKFDEDQIMFRGEVIDVGAF |
| Ga0315905_104845691 | 3300032092 | Freshwater | VLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF |
| Ga0315905_112847622 | 3300032092 | Freshwater | SGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0315902_111694261 | 3300032093 | Freshwater | NHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0315903_105926571 | 3300032116 | Freshwater | NHRSGFAVLNFFNGQLLWPELVHKFEENQIQFRGEVIDVGAF |
| Ga0335012_0376525_2_148 | 3300034093 | Freshwater | AELNPSNHRSGFAVLNFFNGQLLWPELVHKFDEDMVQFRGEVIDVGAF |
| Ga0335012_0422693_529_645 | 3300034093 | Freshwater | GFAVLNFFNGTLLWPELVHKFDEDQIEFRGCVYDVGAF |
| Ga0335036_0454602_2_133 | 3300034106 | Freshwater | NNHRSGFAVLNFFNGQLLWPELVHKFDENQIQFRGEVIDVGAF |
| Ga0335048_0414471_2_121 | 3300034356 | Freshwater | SGFAVLNFFNGQLLWPELVHKFDENQIEFRGEVIDVGAF |
| ⦗Top⦘ |