| Basic Information | |
|---|---|
| Family ID | F037396 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSAALTGFYLQR |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.57 % |
| % of genes near scaffold ends (potentially truncated) | 98.81 % |
| % of genes from short scaffolds (< 2000 bps) | 96.43 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.119 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.976 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.214 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.78% β-sheet: 2.78% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF01614 | IclR | 64.88 |
| PF09339 | HTH_IclR | 25.00 |
| PF13398 | Peptidase_M50B | 5.36 |
| PF02517 | Rce1-like | 1.79 |
| PF01425 | Amidase | 1.19 |
| PF01636 | APH | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 64.88 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.79 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.79 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.19 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.12 % |
| All Organisms | root | All Organisms | 39.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0254516 | Not Available | 525 | Open in IMG/M |
| 3300003219|JGI26341J46601_10208627 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300004152|Ga0062386_100276836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1334 | Open in IMG/M |
| 3300005435|Ga0070714_100864072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
| 3300005537|Ga0070730_10898730 | Not Available | 555 | Open in IMG/M |
| 3300005537|Ga0070730_10977521 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005541|Ga0070733_10045857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2734 | Open in IMG/M |
| 3300005553|Ga0066695_10783021 | Not Available | 552 | Open in IMG/M |
| 3300005569|Ga0066705_10542371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
| 3300005602|Ga0070762_10874274 | Not Available | 611 | Open in IMG/M |
| 3300005610|Ga0070763_10579280 | Not Available | 649 | Open in IMG/M |
| 3300005952|Ga0080026_10181183 | Not Available | 619 | Open in IMG/M |
| 3300006046|Ga0066652_100502227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1127 | Open in IMG/M |
| 3300006162|Ga0075030_100802519 | Not Available | 743 | Open in IMG/M |
| 3300006162|Ga0075030_101193082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300006172|Ga0075018_10299502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
| 3300006804|Ga0079221_10818781 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009038|Ga0099829_11358332 | Not Available | 587 | Open in IMG/M |
| 3300009088|Ga0099830_10940556 | Not Available | 715 | Open in IMG/M |
| 3300009524|Ga0116225_1332388 | Not Available | 677 | Open in IMG/M |
| 3300009525|Ga0116220_10366282 | Not Available | 641 | Open in IMG/M |
| 3300009525|Ga0116220_10439219 | Not Available | 587 | Open in IMG/M |
| 3300009698|Ga0116216_10140482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1485 | Open in IMG/M |
| 3300009700|Ga0116217_10207817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1284 | Open in IMG/M |
| 3300009764|Ga0116134_1305201 | Not Available | 547 | Open in IMG/M |
| 3300010326|Ga0134065_10169961 | Not Available | 772 | Open in IMG/M |
| 3300010329|Ga0134111_10354071 | Not Available | 621 | Open in IMG/M |
| 3300010360|Ga0126372_12214704 | Not Available | 599 | Open in IMG/M |
| 3300010376|Ga0126381_100997623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1208 | Open in IMG/M |
| 3300010379|Ga0136449_100735362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1646 | Open in IMG/M |
| 3300010379|Ga0136449_102879885 | Not Available | 676 | Open in IMG/M |
| 3300010880|Ga0126350_11884985 | Not Available | 735 | Open in IMG/M |
| 3300012205|Ga0137362_10371238 | Not Available | 1239 | Open in IMG/M |
| 3300012208|Ga0137376_11509385 | Not Available | 563 | Open in IMG/M |
| 3300012349|Ga0137387_11254433 | Not Available | 521 | Open in IMG/M |
| 3300012360|Ga0137375_10625196 | Not Available | 892 | Open in IMG/M |
| 3300012958|Ga0164299_10991815 | Not Available | 618 | Open in IMG/M |
| 3300012971|Ga0126369_11387358 | Not Available | 793 | Open in IMG/M |
| 3300012971|Ga0126369_11973791 | Not Available | 672 | Open in IMG/M |
| 3300012987|Ga0164307_10967109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 690 | Open in IMG/M |
| 3300014487|Ga0182000_10244840 | Not Available | 715 | Open in IMG/M |
| 3300014969|Ga0157376_13069365 | Not Available | 506 | Open in IMG/M |
| 3300015374|Ga0132255_101042343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1228 | Open in IMG/M |
| 3300015374|Ga0132255_102532078 | Not Available | 784 | Open in IMG/M |
| 3300016294|Ga0182041_11078294 | Not Available | 729 | Open in IMG/M |
| 3300016319|Ga0182033_11591160 | Not Available | 591 | Open in IMG/M |
| 3300016357|Ga0182032_11642987 | Not Available | 559 | Open in IMG/M |
| 3300016404|Ga0182037_10642588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 904 | Open in IMG/M |
| 3300017926|Ga0187807_1326819 | Not Available | 513 | Open in IMG/M |
| 3300017928|Ga0187806_1023839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1786 | Open in IMG/M |
| 3300017928|Ga0187806_1078325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1034 | Open in IMG/M |
| 3300017933|Ga0187801_10074254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1263 | Open in IMG/M |
| 3300017955|Ga0187817_10488382 | Not Available | 786 | Open in IMG/M |
| 3300017959|Ga0187779_10984730 | Not Available | 584 | Open in IMG/M |
| 3300017970|Ga0187783_10383086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1022 | Open in IMG/M |
| 3300017972|Ga0187781_11438181 | Not Available | 510 | Open in IMG/M |
| 3300017974|Ga0187777_10543756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 815 | Open in IMG/M |
| 3300017975|Ga0187782_10539625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 894 | Open in IMG/M |
| 3300018019|Ga0187874_10352555 | Not Available | 595 | Open in IMG/M |
| 3300018035|Ga0187875_10280249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 905 | Open in IMG/M |
| 3300018040|Ga0187862_10721759 | Not Available | 581 | Open in IMG/M |
| 3300018058|Ga0187766_10015658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4322 | Open in IMG/M |
| 3300018058|Ga0187766_10424172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 884 | Open in IMG/M |
| 3300018060|Ga0187765_10691633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 669 | Open in IMG/M |
| 3300018060|Ga0187765_10704728 | Not Available | 663 | Open in IMG/M |
| 3300018085|Ga0187772_10739576 | Not Available | 707 | Open in IMG/M |
| 3300018086|Ga0187769_11154917 | Not Available | 586 | Open in IMG/M |
| 3300020580|Ga0210403_11092349 | Not Available | 620 | Open in IMG/M |
| 3300020581|Ga0210399_10534431 | Not Available | 973 | Open in IMG/M |
| 3300020581|Ga0210399_10958946 | Not Available | 691 | Open in IMG/M |
| 3300020581|Ga0210399_11425770 | Not Available | 540 | Open in IMG/M |
| 3300020583|Ga0210401_11587835 | Not Available | 511 | Open in IMG/M |
| 3300021178|Ga0210408_11334460 | Not Available | 543 | Open in IMG/M |
| 3300021180|Ga0210396_10765664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 830 | Open in IMG/M |
| 3300021362|Ga0213882_10308407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 661 | Open in IMG/M |
| 3300021402|Ga0210385_10575821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 857 | Open in IMG/M |
| 3300021406|Ga0210386_11328247 | Not Available | 604 | Open in IMG/M |
| 3300021407|Ga0210383_11259867 | Not Available | 619 | Open in IMG/M |
| 3300021420|Ga0210394_10895992 | Not Available | 772 | Open in IMG/M |
| 3300021420|Ga0210394_11163459 | Not Available | 663 | Open in IMG/M |
| 3300021474|Ga0210390_10639380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 890 | Open in IMG/M |
| 3300021477|Ga0210398_10193891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1656 | Open in IMG/M |
| 3300021478|Ga0210402_11400074 | Not Available | 626 | Open in IMG/M |
| 3300022533|Ga0242662_10244760 | Not Available | 580 | Open in IMG/M |
| 3300024254|Ga0247661_1110603 | Not Available | 523 | Open in IMG/M |
| 3300024271|Ga0224564_1023191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1136 | Open in IMG/M |
| 3300025913|Ga0207695_11380238 | Not Available | 585 | Open in IMG/M |
| 3300025915|Ga0207693_10861180 | Not Available | 696 | Open in IMG/M |
| 3300025928|Ga0207700_11460843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 607 | Open in IMG/M |
| 3300025929|Ga0207664_11485189 | Not Available | 599 | Open in IMG/M |
| 3300025931|Ga0207644_11773834 | Not Available | 517 | Open in IMG/M |
| 3300025961|Ga0207712_11780699 | Not Available | 552 | Open in IMG/M |
| 3300026217|Ga0209871_1092769 | Not Available | 587 | Open in IMG/M |
| 3300026475|Ga0257147_1023634 | Not Available | 867 | Open in IMG/M |
| 3300027010|Ga0207839_1036710 | Not Available | 556 | Open in IMG/M |
| 3300027604|Ga0208324_1077713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 942 | Open in IMG/M |
| 3300027692|Ga0209530_1232646 | Not Available | 503 | Open in IMG/M |
| 3300027703|Ga0207862_1061158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1134 | Open in IMG/M |
| 3300027775|Ga0209177_10051490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1169 | Open in IMG/M |
| 3300027910|Ga0209583_10226106 | Not Available | 813 | Open in IMG/M |
| 3300028773|Ga0302234_10063432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1653 | Open in IMG/M |
| 3300028789|Ga0302232_10235816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 908 | Open in IMG/M |
| 3300028877|Ga0302235_10082359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1483 | Open in IMG/M |
| 3300028877|Ga0302235_10333857 | Not Available | 653 | Open in IMG/M |
| 3300028879|Ga0302229_10482483 | Not Available | 548 | Open in IMG/M |
| 3300029636|Ga0222749_10296450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 835 | Open in IMG/M |
| 3300030007|Ga0311338_10783683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 952 | Open in IMG/M |
| 3300030399|Ga0311353_10228155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1736 | Open in IMG/M |
| 3300030490|Ga0302184_10440394 | Not Available | 501 | Open in IMG/M |
| 3300030520|Ga0311372_10749302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1349 | Open in IMG/M |
| 3300030580|Ga0311355_10515537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1144 | Open in IMG/M |
| 3300030617|Ga0311356_11226142 | Not Available | 689 | Open in IMG/M |
| 3300030617|Ga0311356_11904198 | Not Available | 527 | Open in IMG/M |
| 3300030618|Ga0311354_10631504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1035 | Open in IMG/M |
| 3300031236|Ga0302324_102366891 | Not Available | 653 | Open in IMG/M |
| 3300031525|Ga0302326_13030784 | Not Available | 572 | Open in IMG/M |
| 3300031543|Ga0318516_10277057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 970 | Open in IMG/M |
| 3300031546|Ga0318538_10280490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 897 | Open in IMG/M |
| 3300031572|Ga0318515_10727745 | Not Available | 524 | Open in IMG/M |
| 3300031573|Ga0310915_10755682 | Not Available | 685 | Open in IMG/M |
| 3300031573|Ga0310915_11246784 | Not Available | 513 | Open in IMG/M |
| 3300031573|Ga0310915_11247554 | Not Available | 513 | Open in IMG/M |
| 3300031680|Ga0318574_10317364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 906 | Open in IMG/M |
| 3300031681|Ga0318572_10340307 | Not Available | 889 | Open in IMG/M |
| 3300031681|Ga0318572_10584487 | Not Available | 665 | Open in IMG/M |
| 3300031708|Ga0310686_101559537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 820 | Open in IMG/M |
| 3300031708|Ga0310686_103596807 | Not Available | 764 | Open in IMG/M |
| 3300031708|Ga0310686_116567200 | Not Available | 540 | Open in IMG/M |
| 3300031748|Ga0318492_10440089 | Not Available | 688 | Open in IMG/M |
| 3300031748|Ga0318492_10522374 | Not Available | 630 | Open in IMG/M |
| 3300031764|Ga0318535_10103207 | Not Available | 1250 | Open in IMG/M |
| 3300031765|Ga0318554_10784332 | Not Available | 533 | Open in IMG/M |
| 3300031770|Ga0318521_10346152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 880 | Open in IMG/M |
| 3300031782|Ga0318552_10052953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1927 | Open in IMG/M |
| 3300031798|Ga0318523_10417311 | Not Available | 666 | Open in IMG/M |
| 3300031845|Ga0318511_10201288 | Not Available | 885 | Open in IMG/M |
| 3300031845|Ga0318511_10604696 | Not Available | 511 | Open in IMG/M |
| 3300031860|Ga0318495_10007416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4424 | Open in IMG/M |
| 3300031860|Ga0318495_10023182 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300031879|Ga0306919_11106993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 604 | Open in IMG/M |
| 3300031910|Ga0306923_11771647 | Not Available | 635 | Open in IMG/M |
| 3300031941|Ga0310912_10421450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1040 | Open in IMG/M |
| 3300031954|Ga0306926_12830575 | Not Available | 523 | Open in IMG/M |
| 3300032055|Ga0318575_10683149 | Not Available | 519 | Open in IMG/M |
| 3300032063|Ga0318504_10273753 | Not Available | 797 | Open in IMG/M |
| 3300032063|Ga0318504_10327497 | Not Available | 727 | Open in IMG/M |
| 3300032064|Ga0318510_10264220 | Not Available | 710 | Open in IMG/M |
| 3300032065|Ga0318513_10072218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1581 | Open in IMG/M |
| 3300032066|Ga0318514_10035269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2365 | Open in IMG/M |
| 3300032067|Ga0318524_10737541 | Not Available | 520 | Open in IMG/M |
| 3300032076|Ga0306924_11382877 | Not Available | 752 | Open in IMG/M |
| 3300032076|Ga0306924_11459643 | Not Available | 727 | Open in IMG/M |
| 3300032160|Ga0311301_10377345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2191 | Open in IMG/M |
| 3300032160|Ga0311301_10436591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1981 | Open in IMG/M |
| 3300032180|Ga0307471_101837249 | Not Available | 757 | Open in IMG/M |
| 3300032261|Ga0306920_102236770 | Not Available | 759 | Open in IMG/M |
| 3300032261|Ga0306920_103350476 | Not Available | 596 | Open in IMG/M |
| 3300032770|Ga0335085_11132519 | Not Available | 836 | Open in IMG/M |
| 3300032783|Ga0335079_11089615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 809 | Open in IMG/M |
| 3300032805|Ga0335078_10574939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1428 | Open in IMG/M |
| 3300032892|Ga0335081_12568642 | Not Available | 524 | Open in IMG/M |
| 3300032896|Ga0335075_10625596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1057 | Open in IMG/M |
| 3300032897|Ga0335071_11324046 | Not Available | 665 | Open in IMG/M |
| 3300032898|Ga0335072_10710583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 981 | Open in IMG/M |
| 3300033158|Ga0335077_10675106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1067 | Open in IMG/M |
| 3300033158|Ga0335077_10883113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 902 | Open in IMG/M |
| 3300033158|Ga0335077_10886765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 900 | Open in IMG/M |
| 3300033158|Ga0335077_11324679 | Not Available | 698 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.98% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.19% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.19% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.60% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.60% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_02545162 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MPEFRDVIPGSQVSVSQPSLAGLQAAMAAGTLSSAALTGFYLQRIERLNPALH |
| JGI26341J46601_102086272 | 3300003219 | Bog Forest Soil | MIPGTQVSASQPSLAGLQAAMASGTLTSAALTGFYLQRTG* |
| Ga0062386_1002768361 | 3300004152 | Bog Forest Soil | MIPGIQVSASQPSLAGLQAAMASGTLTSAALTGFYLQRIDRLNPAL |
| Ga0070714_1008640721 | 3300005435 | Agricultural Soil | MPEFRDVIPGSQVTASQPSLAGLQAAMAAGTLSSAALTGFYRQRIERLNPALHAVITV |
| Ga0070730_108987301 | 3300005537 | Surface Soil | MPEFRDVIPGTQVSAGQPSLTGLQGELAAGTLSSAALTGF |
| Ga0070730_109775212 | 3300005537 | Surface Soil | MPDFREMIPGTRASAGHTSLVELQAAMAAGELTSSELTSFYLQRID |
| Ga0070733_100458571 | 3300005541 | Surface Soil | MPEFREVIPGTRASAGHTSLAELQTAISAGELTSSE |
| Ga0066695_107830212 | 3300005553 | Soil | MPEFRDVIPGSQVSVSQPSLVGLQAALAAGTLSSAALTG |
| Ga0066705_105423712 | 3300005569 | Soil | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSAALTGFYLQRIERLNPALHA |
| Ga0070762_108742741 | 3300005602 | Soil | MPDFREVIPGTRASAGHASLAELQAAMAAGELTSAELTS |
| Ga0070763_105792801 | 3300005610 | Soil | MPEFRDLIPGTQVSASQPTVAGLQAALAAGTLTSAALT |
| Ga0080026_101811832 | 3300005952 | Permafrost Soil | MPDFRDVIPGTRISAGQASVAGLQAELASGRLTAAALT |
| Ga0066652_1005022271 | 3300006046 | Soil | VIPGTQVSVSQPSLAGLQAAMAAGTLSSAALTAFYRQRIERLNPALH |
| Ga0075030_1008025191 | 3300006162 | Watersheds | MAEFRDVIPGTQVSASQPSLAGLQAAMASGALSSVALT |
| Ga0075030_1011930822 | 3300006162 | Watersheds | MPDFRDVIPGMRVSAGQASLAELQAAMASGELSSAALTGFYLQRI |
| Ga0075018_102995022 | 3300006172 | Watersheds | MPEFRDVIPGTQVSASQPSLAGLQAAMASGALSSVALTSFYLQR |
| Ga0079221_108187812 | 3300006804 | Agricultural Soil | MPEYRDVILGTQVSVSQPSVAGLQAAMAAGTLSSADLTGFYRQR |
| Ga0099829_113583322 | 3300009038 | Vadose Zone Soil | MPDFRDMIPGTQISASQPSLAGLQAAMASGALSSA |
| Ga0099830_109405561 | 3300009088 | Vadose Zone Soil | MPDFRDMIPGTQISASQPSLAGLQAAMASGALSSATLTGFYLQRIDRLNP |
| Ga0116225_13323882 | 3300009524 | Peatlands Soil | MPEYRDMIPGTQVSVSQPSLAGLQAAMAAGTLTSAALTSFYLQRID |
| Ga0116220_103662822 | 3300009525 | Peatlands Soil | MPDFRDVLPGPLLPAGRASLAGLQAALASGELTSA |
| Ga0116220_104392191 | 3300009525 | Peatlands Soil | MPEFRDMIPGTQVGVSQPSLAGLQAAMAAGTLTSAALTSFYLQRIDRLNPALHA |
| Ga0116216_101404821 | 3300009698 | Peatlands Soil | MPEFRDTIPGSQVSASQPSLAGLQAAMAAGTLSSTALTGFYLQRIDRLNPA |
| Ga0116217_102078173 | 3300009700 | Peatlands Soil | MPEYRDMIPGTQVSVSQPSLAGLQAAMAAGTLTSAALTSFYLQRIDRLN |
| Ga0116134_13052011 | 3300009764 | Peatland | MPEFRDMIPGTQVSVSQPSLAGLQAAMAAGTLSSVALT |
| Ga0134065_101699612 | 3300010326 | Grasslands Soil | MPEFRDVIPGSQVSVGRPSLAGLQAALAAGTLSSAALTAFYLQRI |
| Ga0134111_103540712 | 3300010329 | Grasslands Soil | MPEFRDVIPGSQVAVSQPSLAGLQAAMAAGTLSSAALTGFYRQRIERLNPALH |
| Ga0126372_122147042 | 3300010360 | Tropical Forest Soil | MPEFRDVTPGSQVTVSQPSLGGLQAAMAAGTLSSAAL |
| Ga0126381_1009976232 | 3300010376 | Tropical Forest Soil | MPDFRDVIPGTHASAGQASLAELQAAMASGELTSAALTAFYLQRIDRLNP |
| Ga0136449_1007353623 | 3300010379 | Peatlands Soil | MPEFRDMIPGTQVSVSQPSLAGLQAAMAAGTLTSAAL |
| Ga0136449_1028798851 | 3300010379 | Peatlands Soil | MPDFRDVITGTHISAGQASLAALQAEMASGALSSAALTGFYLQRIDRLNPALH |
| Ga0126350_118849851 | 3300010880 | Boreal Forest Soil | MPEFRDVIPGTEVSMSQPALGGLQAAMAAGTLSSAALTGFYLQRIDR |
| Ga0137362_103712383 | 3300012205 | Vadose Zone Soil | MPEFRDVIPGSQVSASQPSLAGLQAAMAAGTLSSAALTGFYLQRIDRLNPALH |
| Ga0137376_115093852 | 3300012208 | Vadose Zone Soil | MPEFRDVIPGSQVSVSQPSLAGLQAALATGTLSSAALTGFYLQRI |
| Ga0137387_112544331 | 3300012349 | Vadose Zone Soil | MPEFRDVIPGTQVSASQPSLAGLQAAMAAGTLSSAALTGFYLQRIDRLNPALHA |
| Ga0137375_106251961 | 3300012360 | Vadose Zone Soil | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSAA |
| Ga0164299_109918151 | 3300012958 | Soil | MPEFRDVIPGSQVTASQPSLAGLQAAMAAGTLSSAALTGF |
| Ga0126369_113873581 | 3300012971 | Tropical Forest Soil | MPELRDVIPGGQVSVSQPSLAGLQAAMAAGTLSSAALTGFYLQ |
| Ga0126369_119737912 | 3300012971 | Tropical Forest Soil | MPEFRDAIPGSQVSVSQPSLAGLQTALAGGTLSSAVLTGFYLQRI |
| Ga0164307_109671091 | 3300012987 | Soil | MPEYRDVIPGTQVSVSQPSVAGLQAAMAAGTLSSADLTGFYRQRIERLNPALHA |
| Ga0182000_102448401 | 3300014487 | Soil | MPELRDVIPGTQVGASQPSLSGLQAAMAAGRLSSADLTSFYRQRIER |
| Ga0157376_130693651 | 3300014969 | Miscanthus Rhizosphere | MPEYRDVIPGTQVSVSQPSVAGLQAAMAAGTLSSADLTGFYRQRIERL |
| Ga0132255_1010423431 | 3300015374 | Arabidopsis Rhizosphere | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSA |
| Ga0132255_1025320781 | 3300015374 | Arabidopsis Rhizosphere | MPEFHDVIPGSQVSVSQPSLAGLQAALAAGTLSSAALTGFY |
| Ga0182041_110782942 | 3300016294 | Soil | MPEFRDVIPGSKVSVSQPSLAGLQAAMAAGTLSSAALTGFYLQHIERLN |
| Ga0182033_115911602 | 3300016319 | Soil | MPDFRDVIPGTRASVGQASLADLQAAMASGELTSAALTAFYLQRIDRLN |
| Ga0182032_116429871 | 3300016357 | Soil | MPDFRDVIPGTHASAGQASLAELQAAMGSGELTSAALTAFYLQRIDR |
| Ga0182037_106425881 | 3300016404 | Soil | MPDFRDVIPGTSASAGQASLTELQAAMASGDLTSAALTGFYL |
| Ga0187807_13268192 | 3300017926 | Freshwater Sediment | MPDFCEVIPGGHANAGHASLAGLQAAMTSGELTSAALTACYLQRIDRLNPALHAV |
| Ga0187806_10238391 | 3300017928 | Freshwater Sediment | MLEYRDMIPGTQVSVSQPSLAGLQAAMAAGTLTSAALTSFYL |
| Ga0187806_10783251 | 3300017928 | Freshwater Sediment | MPDFRDVIPGTRASAGQASLAELQAAMASGDLTSVALTGFYLQR |
| Ga0187801_100742541 | 3300017933 | Freshwater Sediment | MPDFRDVIPGTRATAEQAPLAELQAAMASGELTSAALT |
| Ga0187817_104883822 | 3300017955 | Freshwater Sediment | MPDFCEVIPGGHASAGHASLAGLQAAMTSGELTSAALTACYLQRIDRLNPAL |
| Ga0187779_109847301 | 3300017959 | Tropical Peatland | MPDFRDVIPGTHASAGQASLAELQAAMASGELTSAAL |
| Ga0187783_103830862 | 3300017970 | Tropical Peatland | MPEFRDVLPGTQVSVSQPSLAGLQAAMAAGTLTSAALTGFYLERIDRLNPALH |
| Ga0187781_114381811 | 3300017972 | Tropical Peatland | MPDFRDTVPGTQVDAGQASLAELQAAMTSGQLSSAA |
| Ga0187777_105437561 | 3300017974 | Tropical Peatland | MPDFRDVIPGTLISAGRASLAQLQAAMAAGELSSAVLTSFYLQRIDR |
| Ga0187782_105396252 | 3300017975 | Tropical Peatland | MPDFRDVILGTRVSAGQASLAELQAAMASGELTSAALTGFY |
| Ga0187874_103525552 | 3300018019 | Peatland | MPDFRDAILGTRIGAGQAPLTELQAEMASGALTSAALTGFYLQRIDHLNPALHA |
| Ga0187875_102802491 | 3300018035 | Peatland | MPDFRDAILGTRTGAGQASLTGLQAEMASGALTSAALTGF |
| Ga0187862_107217592 | 3300018040 | Peatland | MPDFRDAILGTRTGAGQASLTGLQAEMASGALTSAALTGFYLQRID |
| Ga0187766_100156586 | 3300018058 | Tropical Peatland | MPDFRDVIPGTRIGTGHVSLADLQAAMNSGELSSTELTGFYLQRIDRLN |
| Ga0187766_104241722 | 3300018058 | Tropical Peatland | MPDFRDVIPGTRASAGQASLAELQAAMASGELTSAAL |
| Ga0187765_106916332 | 3300018060 | Tropical Peatland | MPEFRDAIPGSQVSVSQPSLAGLQAALAAGTLSSAALTGFYLQR |
| Ga0187765_107047281 | 3300018060 | Tropical Peatland | MIPGSQVSASQPSVAGLQAAMAEGTLSSAALTGYYLQ |
| Ga0187772_107395761 | 3300018085 | Tropical Peatland | MPDFRDVIPGTRVSAGQASLAELQAAMASGELTSAALTGFYLQRIDRLNP |
| Ga0187769_111549171 | 3300018086 | Tropical Peatland | MPELIPGTQVSVSQPSLTGLQAAMAAGTLTSAALTGYYLQRI |
| Ga0210403_110923492 | 3300020580 | Soil | MPEFRDVIPGSQVSVSQPTLAGLQAALAAGTLSSAALT |
| Ga0210399_105344312 | 3300020581 | Soil | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSAAL |
| Ga0210399_109589462 | 3300020581 | Soil | MPEYHDMIPGTQVSASQPSLAGLQAAMASGEISSAALTGFYLQRIDRL |
| Ga0210399_114257702 | 3300020581 | Soil | MPVFRDVIPGSEVSVSQPSLAGLQAALAAGTLSSAVLT |
| Ga0210401_115878351 | 3300020583 | Soil | MPDFPEVIPGTHASAGHASLAELQAAMTAGGLTSAELTNFYLQR |
| Ga0210408_113344602 | 3300021178 | Soil | MPEIRDVIPGTRVSASQPSLAGLQAAMASGEISSAALTGFYL |
| Ga0210396_107656642 | 3300021180 | Soil | MPEIRDVIPGTQVSASQPSLAGLQAAMASGEISSAALTGFYLQRIGRL |
| Ga0213882_103084072 | 3300021362 | Exposed Rock | MPEFRDVIPGTRVSASQPSLAGLQGAMAAGTLTSAALTGYYLQRIGRLNPALHA |
| Ga0210385_105758211 | 3300021402 | Soil | MPEIRDVIPGTQVSASQPSLAGLQAAMASGEISSAALTGFYLQRIGRLNPA |
| Ga0210386_113282471 | 3300021406 | Soil | MPDFPEVIPGTHASAGHASLAELQAAMTAGGLTSAEL |
| Ga0210383_112598671 | 3300021407 | Soil | MPDFPEVIPGTHASAGHASLAELQAAMAAGGLTSAELTNFYLQRIDRLN |
| Ga0210394_108959922 | 3300021420 | Soil | MPEYHDMIPGTQVSASQPSLVGLQAAMAAGTLTSTALTGFYLQR |
| Ga0210394_111634592 | 3300021420 | Soil | MIPGTQVSASQPSLAGLQAAMAAGTLTSVALTGFYLQRIDR |
| Ga0210390_106393801 | 3300021474 | Soil | MPDFRDVIPGTRIRAGAATLAALQAELAAGALNSATLTG |
| Ga0210398_101938911 | 3300021477 | Soil | MPDFRDAILGTRIGAGQASLTGLQAEMASGALTSAALTGFYLQRIDHLNPALH |
| Ga0210402_114000742 | 3300021478 | Soil | MPEFRDVIPGSQVSVSQPTLAGLQAALAAGTLSSAALTGFYLQRIERLN |
| Ga0242662_102447602 | 3300022533 | Soil | MPEFRDVIPGSQVSVSQPTLAGLQAALAAGTLSSAALTGFYLQRIER |
| Ga0247661_11106031 | 3300024254 | Soil | MPEYRDVIPGTQVSVSQPSVAGLQAAMAAGTLSSADLTGFYRQRIERLNP |
| Ga0224564_10231912 | 3300024271 | Soil | MPEYRDMIPGTQVSASQPSLVGLQAAMAAGTLTSTALTSFYLQRID |
| Ga0207695_113802381 | 3300025913 | Corn Rhizosphere | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSAALTGFYLQRIERLN |
| Ga0207693_108611801 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDFRDAIPGTRTSAGQVTLAQLQAAMASGELTSRALTGFY |
| Ga0207700_114608432 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDFREMIPGTRASAGHTSLVELQAAMAADELTSSEL |
| Ga0207664_114851892 | 3300025929 | Agricultural Soil | MPELRDVIPGTQVSVSQPALAGLQAAMAAGTLSSAALTGFYL |
| Ga0207644_117738341 | 3300025931 | Switchgrass Rhizosphere | MPEYRDVIPGTEVSVSQPSVTGLQAAMAAGTLSSADLTGFYR |
| Ga0207712_117806992 | 3300025961 | Switchgrass Rhizosphere | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSAALT |
| Ga0209871_10927691 | 3300026217 | Permafrost Soil | MPDFRDVIPGTRISAGQASVAGLQAELASGRLTAAALTAFYLQRIDHLNPALHA |
| Ga0257147_10236342 | 3300026475 | Soil | MPEFRDVIPGSQVSVSQPTLAGLQAALAAGTLSSAALTGFYLQRIERLNP |
| Ga0207839_10367101 | 3300027010 | Tropical Forest Soil | MPDLYDVIPGTQIAAGQASLAELQAAMTSGPLSSAALTNFYLERIDRLNPALH |
| Ga0208324_10777131 | 3300027604 | Peatlands Soil | MPEFRDMIPGTQVSASQPSLAGLQAAMATGTLTSA |
| Ga0209530_12326461 | 3300027692 | Forest Soil | MPDFREVIPGTRGSAGHASLADLQTAMAAGELTSAELTGFYLQ |
| Ga0207862_10611581 | 3300027703 | Tropical Forest Soil | MPDLYDVIPGTQIAAGQASLAELQAAMTSGPLSSAALTNFYLER |
| Ga0209177_100514902 | 3300027775 | Agricultural Soil | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSAALTGFYLQRIER |
| Ga0209583_102261061 | 3300027910 | Watersheds | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSAALTGFYLQR |
| Ga0302234_100634323 | 3300028773 | Palsa | MPDFRDAIPGTRIGAGQASLTGLQAELASGALTSAALTGYYLQ |
| Ga0302232_102358161 | 3300028789 | Palsa | MPDFRDAILGTRIGAGRASLTGLQAEMASGALTSAALTGLYLQRIDHQNP |
| Ga0302235_100823591 | 3300028877 | Palsa | MPDFRDEIPGSRTSAGRVSLAGLQVDMASGLLSSAALTGFYLQRIDHLNP |
| Ga0302235_103338571 | 3300028877 | Palsa | MPDFRDAILGTRIGAGRASLTGLQAEMASGALTSAALTGLYLQRIDHLNPALH |
| Ga0302229_104824832 | 3300028879 | Palsa | MPDFRDAILGTRIGAGQAPLTELQAEMACGALTSAALTGFYLQRIDHLNPALHAVI |
| Ga0222749_102964501 | 3300029636 | Soil | MPDFREVIPGTRASAGHASLAELQAAMAAGELTSAEL |
| Ga0311338_107836831 | 3300030007 | Palsa | MPDFRDAILGTRIGAGQASLTVLQAEIASGALTSAALTGLYLQR |
| Ga0311353_102281551 | 3300030399 | Palsa | MPDFRDAILGTRIGAGQASLTVLQAEIASGALTSAAL |
| Ga0302184_104403941 | 3300030490 | Palsa | MPDFRDAILGTRIGAGRASLTGLQAEMASGALTSAALTGL |
| Ga0311372_107493021 | 3300030520 | Palsa | MPDFRDEIPGSRTSAGRVSLAGLQADMASGLLSSAALTGFYLQRI |
| Ga0311355_105155372 | 3300030580 | Palsa | MPDFRDVIPGTRASAGRVSLAELQAAIASGELTSAAL |
| Ga0311356_112261421 | 3300030617 | Palsa | MPDFRDAILGTRIGAGRASLTGLQAEMASGALTSAALTGLYLQRIDHQNPALHAV |
| Ga0311356_119041981 | 3300030617 | Palsa | MPDFRDEIPGSRTSAGRVSLAGLQVDMASGLLSSAALTGFYLQRIDH |
| Ga0311354_106315042 | 3300030618 | Palsa | MPDFRDAILGTRIGAGQVSLTGLQAEMASGALTSAALTGFYLQ |
| Ga0302324_1023668911 | 3300031236 | Palsa | MPDFRDAILGTHNGAGQASLTGLQAEMASGALTSAALTGFYLQRIDHLNP |
| Ga0302326_130307842 | 3300031525 | Palsa | MPDFRDAILGTRIGAGRASLTGLQAEMASGALTSA |
| Ga0318516_102770572 | 3300031543 | Soil | MREIRDAIPGTKVSASQPSLAGLQAAMAAGTLSSAALTAFYLQRIDRLN |
| Ga0318538_102804901 | 3300031546 | Soil | MPEFRDVIPGSQVSASQPSLAGLQAAMAEGTLSSAALT |
| Ga0318515_107277451 | 3300031572 | Soil | MPELRDVIPGSQVSASQPSLAGLQAALAGGTLSSAVLTGFYRQRIERLNPALPV |
| Ga0310915_107556822 | 3300031573 | Soil | MPDFHDVIPGTQISAGQASLAELQAAMASGQLSSAALTSFYLERID |
| Ga0310915_112467842 | 3300031573 | Soil | MPDFRDVIPGTEISAGQASLAELQAAMASGQLSSAALTAFYL |
| Ga0310915_112475541 | 3300031573 | Soil | MPEFRDVIPGSQVIVSQPSLAGLQAALAAGTLSSVA |
| Ga0318574_103173642 | 3300031680 | Soil | MPDNRDVIPGTRAAAGQASLAELQATMASGELTSAALT |
| Ga0318572_103403071 | 3300031681 | Soil | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSVA |
| Ga0318572_105844871 | 3300031681 | Soil | MPDFRDVIPGTSASAGQASLTELQAAMASGDLTSAALTGFYLQRIDRLN |
| Ga0310686_1015595372 | 3300031708 | Soil | MPDFRDVIPGTRASAGRVSLAELQAAMASGELTSAALTAFYLYRIDRLNPA |
| Ga0310686_1035968071 | 3300031708 | Soil | MPDFRDLIPGTQISAGHASLAGLQAELASGALSSVALTSFYLQRID |
| Ga0310686_1165672001 | 3300031708 | Soil | MPEYRDMIPGTQVSASQPSLVGLQAAMAAGTLTSTAL |
| Ga0318492_104400892 | 3300031748 | Soil | MPEFRDVIPGSQVIVSQPSLAGLQAALAAGTLSSATLTGFYLQRIERLNPA |
| Ga0318492_105223741 | 3300031748 | Soil | MPEFRDVIPGSQVGVSQPSLAGLQAAMAAGTLSSAALTGSYLQR |
| Ga0318535_101032071 | 3300031764 | Soil | MPEFRDVIPGSQVSASQPSLAGLQAAMAEGTLSSAALTGFYLQRIERLNPALQVETG |
| Ga0318554_107843321 | 3300031765 | Soil | MREIRDAIPGTKVSASQPSLAGLQAAMAAGTLSSAALTAFYLQR |
| Ga0318521_103461522 | 3300031770 | Soil | MPELRDVIPGSQVSASQPSLAGLQAALAGGTLSSAVLTGFY |
| Ga0318552_100529533 | 3300031782 | Soil | MPELRDVIPGSQVSASQPSLAGLQAALAGGTLSSAVLTGFYR |
| Ga0318523_104173112 | 3300031798 | Soil | MPDFRDVIPGTRASVGQASLADLQAAMASGELTSAALTAFY |
| Ga0318511_102012882 | 3300031845 | Soil | MPELRDVIPGSQVSASQPSLAGLQAALAGGTLSSAVLTGF |
| Ga0318511_106046962 | 3300031845 | Soil | MPEFRDVIPGSQVGVSQPSLAGLQAAMAAGTLSSAALTGFY |
| Ga0318495_100074161 | 3300031860 | Soil | MPELRDVIPGSQVSASQPSLAGLQAALAGGTLSSAVLTGFYRQRIERLNPALHAVIT |
| Ga0318495_100231821 | 3300031860 | Soil | MPDFDDVVPNTQISVGQASLTELQAALASGQLSSASLTA |
| Ga0306919_111069931 | 3300031879 | Soil | MPDFHDVIPGTQISAGQASLAELQAAMASGQLSSAALTSF |
| Ga0306923_117716471 | 3300031910 | Soil | MPDFRDVIPGTRVSVGQASLADLQAAMASGELASAAL |
| Ga0310912_104214502 | 3300031941 | Soil | MPDNRDVIPGTRAAAGQASLAELQAAMASGELTSAALT |
| Ga0306926_128305751 | 3300031954 | Soil | MPEFRDMIPGSQVSASQPSLAGLQAAMAEGTLSSAALTGFYLQR |
| Ga0318575_106831491 | 3300032055 | Soil | MPEFRDVIPGSQVIVSQPSLAGLQAALAAGTLSSATLTGFY |
| Ga0318504_102737531 | 3300032063 | Soil | MPEFRDVIPGSQVIVSQPSLAGLQAALAAGTLSSATLTGFYLQRIE |
| Ga0318504_103274971 | 3300032063 | Soil | MPEFRDVIPGSQVSASQPSLAGLQAAMAEGTLSSAALTGFYLQRIERL |
| Ga0318510_102642201 | 3300032064 | Soil | MPEFRDVIPGSQVGVSQPSLAGLQAAMAAGTLSSAALTGFYLQRIERLNPALQVETGQG |
| Ga0318513_100722183 | 3300032065 | Soil | MPEFRDVIPGSQVSASQPSLAGLQAAMAEGTLNSAALTGFYL |
| Ga0318514_100352691 | 3300032066 | Soil | MPDFRDVIPGTRASVGQASLADLQAAMASGELTSAALTAFYLQRI |
| Ga0318524_107375411 | 3300032067 | Soil | MPEFRDVIPGSQVSVSQPSLAGLQAALAAGTLSSVALT |
| Ga0306924_113828771 | 3300032076 | Soil | MREIRDAIPGTKVSASQPSLAGLQAAMAAGTLSSAVLTGFYLQR |
| Ga0306924_114596432 | 3300032076 | Soil | MPDFRDVIPGTRASAGQASLAELQAAMASGELTSAALTAFYLQRID |
| Ga0311301_103773454 | 3300032160 | Peatlands Soil | MPEFRDTIPGSQVSVSQPSLAGLQAAMGAGTLSSA |
| Ga0311301_104365911 | 3300032160 | Peatlands Soil | MPDFRDVIPGTRASAGRVSLAELQAAMASGELTSAAL |
| Ga0307471_1018372492 | 3300032180 | Hardwood Forest Soil | MPDFRDVIPGTRINAGHASLAQLQAAMAAGKLTSAALTGYYLKRIER |
| Ga0306920_1022367702 | 3300032261 | Soil | MPEFRDVIPGSQVGVSQPSLAGLQAAMAAGTLSSA |
| Ga0306920_1033504762 | 3300032261 | Soil | MPEFRGVIPGTQVSVSQPSLVGLQAALAEGTLSSAALTNFYL |
| Ga0335085_111325191 | 3300032770 | Soil | MPEFRDPIPGAQVSVSQPSLAGLQAGMAAGTLSSAALTGFYLQRID |
| Ga0335079_110896151 | 3300032783 | Soil | MPDFRDVIPGSQVSASRPSVAGLQAAMAAGTLSSAALTGYYLQR |
| Ga0335078_105749391 | 3300032805 | Soil | MPEYRDVIPGTQVSVSQPSVTGLQTAMAAGTLSSADLTGFYQQRIERL |
| Ga0335081_125686422 | 3300032892 | Soil | MPDFRDVIPGSQVSVSQPSLAGLQAGLAAGTLSSAALTGFYLQRIER |
| Ga0335075_106255962 | 3300032896 | Soil | MPDFRDVIPGTEIGAGQVSLDGLQRALAGGRLTSAALTDFYSQR |
| Ga0335071_113240461 | 3300032897 | Soil | MPDFRDVIPGTRASAGHVPLSELQAAMAAGDLTSAALAGFCAERIHRLNPALHAVIT |
| Ga0335072_107105831 | 3300032898 | Soil | MPEFRDAIPGSQVSVSQPSLAGLQAALAAGTLSSAALTGFY |
| Ga0335077_106751062 | 3300033158 | Soil | MPEFRDVIPGAQVSVSQPSLAGLQAAMAAGTLSSAALTGFYLQRIDRLN |
| Ga0335077_108831132 | 3300033158 | Soil | MPEFRDVIPGSQVGVSQPSLAGLQAAMAAGTLSSAALTGFYLQRIERLNP |
| Ga0335077_108867651 | 3300033158 | Soil | MPDFRDVIPGSQVSVSQPSLAGLQAGLAAGTLSSAALTGFYQ |
| Ga0335077_113246791 | 3300033158 | Soil | MIPGSQVSASQPSVAGLQAAMAAGTLSSAALTGYYLQRIDRLNP |
| ⦗Top⦘ |