Basic Information | |
---|---|
Family ID | F037393 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 42 residues |
Representative Sequence | DAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNANYRG |
Number of Associated Samples | 143 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.19 % |
% of genes near scaffold ends (potentially truncated) | 97.62 % |
% of genes from short scaffolds (< 2000 bps) | 92.26 % |
Associated GOLD sequencing projects | 136 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.119 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.167 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.286 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF07969 | Amidohydro_3 | 11.31 |
PF00459 | Inositol_P | 8.93 |
PF00106 | adh_short | 4.76 |
PF00528 | BPD_transp_1 | 3.57 |
PF02518 | HATPase_c | 3.57 |
PF03972 | MmgE_PrpD | 3.57 |
PF01841 | Transglut_core | 3.57 |
PF00296 | Bac_luciferase | 2.98 |
PF07690 | MFS_1 | 2.98 |
PF14595 | Thioredoxin_9 | 2.98 |
PF00496 | SBP_bac_5 | 2.98 |
PF00248 | Aldo_ket_red | 2.38 |
PF03328 | HpcH_HpaI | 2.38 |
PF00072 | Response_reg | 1.79 |
PF01613 | Flavin_Reduct | 1.79 |
PF04962 | KduI | 1.19 |
PF00565 | SNase | 1.19 |
PF01965 | DJ-1_PfpI | 1.19 |
PF01323 | DSBA | 1.19 |
PF02826 | 2-Hacid_dh_C | 1.19 |
PF00389 | 2-Hacid_dh | 1.19 |
PF13561 | adh_short_C2 | 1.19 |
PF08450 | SGL | 1.19 |
PF08282 | Hydrolase_3 | 0.60 |
PF01425 | Amidase | 0.60 |
PF01370 | Epimerase | 0.60 |
PF02639 | DUF188 | 0.60 |
PF13539 | Peptidase_M15_4 | 0.60 |
PF12697 | Abhydrolase_6 | 0.60 |
PF13649 | Methyltransf_25 | 0.60 |
PF13533 | Biotin_lipoyl_2 | 0.60 |
PF00330 | Aconitase | 0.60 |
PF09980 | DUF2214 | 0.60 |
PF06050 | HGD-D | 0.60 |
PF13594 | Obsolete Pfam Family | 0.60 |
PF13699 | DUF4157 | 0.60 |
PF00903 | Glyoxalase | 0.60 |
PF13278 | Obsolete Pfam Family | 0.60 |
PF03461 | TRCF | 0.60 |
PF06480 | FtsH_ext | 0.60 |
PF08239 | SH3_3 | 0.60 |
PF01734 | Patatin | 0.60 |
PF00206 | Lyase_1 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 3.57 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.98 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 2.38 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 2.38 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 2.38 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 1.79 |
COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 1.19 |
COG3717 | 5-keto 4-deoxyuronate isomerase | Carbohydrate transport and metabolism [G] | 1.19 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.19 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.19 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.60 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.60 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.60 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.60 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.60 |
COG1775 | Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB | Amino acid transport and metabolism [E] | 0.60 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.60 |
COG1671 | Uncharacterized conserved protein YaiI, UPF0178 family | Function unknown [S] | 0.60 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.60 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.60 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.12 % |
Unclassified | root | N/A | 14.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_107090817 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300002407|C687J29651_10140789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 789 | Open in IMG/M |
3300002911|JGI25390J43892_10017616 | Not Available | 1707 | Open in IMG/M |
3300005171|Ga0066677_10753111 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005177|Ga0066690_11051302 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005186|Ga0066676_10446045 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300005328|Ga0070676_10008236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5612 | Open in IMG/M |
3300005331|Ga0070670_100142415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2073 | Open in IMG/M |
3300005332|Ga0066388_100838886 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
3300005332|Ga0066388_102566704 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300005332|Ga0066388_106037554 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300005457|Ga0070662_100856293 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300005545|Ga0070695_101464432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus cereus group → Bacillus manliponensis | 567 | Open in IMG/M |
3300005553|Ga0066695_10796692 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005554|Ga0066661_10231312 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300005569|Ga0066705_10531030 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300005577|Ga0068857_102167298 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005713|Ga0066905_100125871 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
3300005713|Ga0066905_100429825 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300005713|Ga0066905_101688903 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005879|Ga0075295_1022400 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300006034|Ga0066656_10086214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1883 | Open in IMG/M |
3300006172|Ga0075018_10428048 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300006755|Ga0079222_11812678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 591 | Open in IMG/M |
3300006794|Ga0066658_10271143 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300006797|Ga0066659_10061077 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
3300006845|Ga0075421_100273402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2064 | Open in IMG/M |
3300006854|Ga0075425_101737145 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300006871|Ga0075434_101387917 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300006881|Ga0068865_101458381 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300006881|Ga0068865_101503855 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300007004|Ga0079218_12154519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 645 | Open in IMG/M |
3300009012|Ga0066710_100790391 | Not Available | 1454 | Open in IMG/M |
3300009012|Ga0066710_101191544 | Not Available | 1180 | Open in IMG/M |
3300009012|Ga0066710_103123249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 639 | Open in IMG/M |
3300009089|Ga0099828_10089626 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
3300009092|Ga0105250_10190146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 864 | Open in IMG/M |
3300009147|Ga0114129_10860496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1152 | Open in IMG/M |
3300009147|Ga0114129_12146611 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 673 | Open in IMG/M |
3300009156|Ga0111538_11031678 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300009157|Ga0105092_10312635 | Not Available | 887 | Open in IMG/M |
3300009174|Ga0105241_12078108 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300009177|Ga0105248_12069001 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300009610|Ga0105340_1320484 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300009792|Ga0126374_10266960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1127 | Open in IMG/M |
3300009803|Ga0105065_1014295 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300009817|Ga0105062_1052329 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300009820|Ga0105085_1068254 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 662 | Open in IMG/M |
3300010041|Ga0126312_10912551 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 640 | Open in IMG/M |
3300010047|Ga0126382_12405649 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 512 | Open in IMG/M |
3300010301|Ga0134070_10337798 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300010325|Ga0134064_10149682 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300010358|Ga0126370_12366365 | Not Available | 527 | Open in IMG/M |
3300010359|Ga0126376_11518817 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300010362|Ga0126377_10936288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 930 | Open in IMG/M |
3300010362|Ga0126377_12574231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 584 | Open in IMG/M |
3300010362|Ga0126377_12968444 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 547 | Open in IMG/M |
3300010366|Ga0126379_11214462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 860 | Open in IMG/M |
3300010366|Ga0126379_11681450 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300010371|Ga0134125_13037767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
3300010373|Ga0134128_13161598 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300010375|Ga0105239_11809283 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300010376|Ga0126381_102232896 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
3300010391|Ga0136847_12875580 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300010398|Ga0126383_10633631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1143 | Open in IMG/M |
3300010399|Ga0134127_11799047 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300010400|Ga0134122_10007738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8004 | Open in IMG/M |
3300010400|Ga0134122_10959562 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300010868|Ga0124844_1247778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 627 | Open in IMG/M |
3300010868|Ga0124844_1248324 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
3300011432|Ga0137428_1022119 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300012189|Ga0137388_10594699 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300012189|Ga0137388_10662602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 970 | Open in IMG/M |
3300012200|Ga0137382_10236557 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
3300012211|Ga0137377_10405204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1302 | Open in IMG/M |
3300012349|Ga0137387_10893237 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012351|Ga0137386_10054157 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 2777 | Open in IMG/M |
3300012582|Ga0137358_10414680 | Not Available | 910 | Open in IMG/M |
3300012685|Ga0137397_10063287 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
3300012918|Ga0137396_10471521 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300012922|Ga0137394_10056898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3236 | Open in IMG/M |
3300012923|Ga0137359_11545621 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300012925|Ga0137419_11653105 | Not Available | 545 | Open in IMG/M |
3300012930|Ga0137407_10803687 | Not Available | 888 | Open in IMG/M |
3300012931|Ga0153915_11820965 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300012944|Ga0137410_10022622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4343 | Open in IMG/M |
3300012944|Ga0137410_11540968 | Not Available | 581 | Open in IMG/M |
3300012948|Ga0126375_10174308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1384 | Open in IMG/M |
3300012977|Ga0134087_10124643 | Not Available | 1100 | Open in IMG/M |
3300013104|Ga0157370_11787734 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300014256|Ga0075318_1126111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
3300014326|Ga0157380_11089506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 837 | Open in IMG/M |
3300014496|Ga0182011_10937275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 538 | Open in IMG/M |
3300014502|Ga0182021_10273716 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300014839|Ga0182027_11033453 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 839 | Open in IMG/M |
3300014883|Ga0180086_1186215 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 539 | Open in IMG/M |
3300015053|Ga0137405_1138392 | Not Available | 1550 | Open in IMG/M |
3300015245|Ga0137409_11059708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 649 | Open in IMG/M |
3300015254|Ga0180089_1037814 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300015264|Ga0137403_10052710 | All Organisms → cellular organisms → Bacteria | 4188 | Open in IMG/M |
3300015264|Ga0137403_10204293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1906 | Open in IMG/M |
3300015372|Ga0132256_102349327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 636 | Open in IMG/M |
3300017997|Ga0184610_1153278 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 757 | Open in IMG/M |
3300018000|Ga0184604_10368147 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300018029|Ga0187787_10087285 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300018058|Ga0187766_11155342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 558 | Open in IMG/M |
3300018059|Ga0184615_10260384 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300018061|Ga0184619_10286007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 757 | Open in IMG/M |
3300018078|Ga0184612_10505909 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300018433|Ga0066667_11917282 | Not Available | 541 | Open in IMG/M |
3300018468|Ga0066662_12500816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 544 | Open in IMG/M |
3300019487|Ga0187893_10799713 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 572 | Open in IMG/M |
3300019879|Ga0193723_1136460 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300020170|Ga0179594_10086993 | Not Available | 1109 | Open in IMG/M |
3300020215|Ga0196963_10530105 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300025311|Ga0209343_10809333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300025312|Ga0209321_10205428 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300025318|Ga0209519_10131582 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300025885|Ga0207653_10321345 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300026089|Ga0207648_11917068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 554 | Open in IMG/M |
3300026285|Ga0209438_1080953 | Not Available | 1040 | Open in IMG/M |
3300026317|Ga0209154_1042947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2036 | Open in IMG/M |
3300026322|Ga0209687_1271805 | Not Available | 530 | Open in IMG/M |
3300026323|Ga0209472_1207189 | Not Available | 657 | Open in IMG/M |
3300026324|Ga0209470_1158204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 991 | Open in IMG/M |
3300026335|Ga0209804_1322744 | Not Available | 521 | Open in IMG/M |
3300026480|Ga0257177_1077670 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300026523|Ga0209808_1163801 | Not Available | 826 | Open in IMG/M |
3300026524|Ga0209690_1101898 | Not Available | 1172 | Open in IMG/M |
3300026528|Ga0209378_1055148 | Not Available | 1903 | Open in IMG/M |
3300027006|Ga0209896_1037753 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300027873|Ga0209814_10162027 | Not Available | 961 | Open in IMG/M |
3300027873|Ga0209814_10561500 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300027877|Ga0209293_10621699 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300027907|Ga0207428_11262165 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 513 | Open in IMG/M |
3300027909|Ga0209382_11297340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
3300027909|Ga0209382_11441995 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300027910|Ga0209583_10509835 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300027910|Ga0209583_10600322 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 560 | Open in IMG/M |
3300027950|Ga0209885_1005276 | Not Available | 1273 | Open in IMG/M |
3300028597|Ga0247820_10918222 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 621 | Open in IMG/M |
3300028673|Ga0257175_1121308 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10224757 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300031548|Ga0307408_101773923 | Not Available | 589 | Open in IMG/M |
3300031668|Ga0318542_10124799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1262 | Open in IMG/M |
3300031720|Ga0307469_10719089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 907 | Open in IMG/M |
3300031720|Ga0307469_11627583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 621 | Open in IMG/M |
3300031720|Ga0307469_11724071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
3300031720|Ga0307469_12534274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
3300031740|Ga0307468_100069024 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 1952 | Open in IMG/M |
3300031740|Ga0307468_100373113 | Not Available | 1075 | Open in IMG/M |
3300031740|Ga0307468_101050942 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300031778|Ga0318498_10520090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
3300031797|Ga0318550_10114883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1277 | Open in IMG/M |
3300031820|Ga0307473_10505454 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300031911|Ga0307412_10410892 | Not Available | 1105 | Open in IMG/M |
3300031940|Ga0310901_10074600 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300032089|Ga0318525_10313704 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 805 | Open in IMG/M |
3300032180|Ga0307471_101361109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 871 | Open in IMG/M |
3300032180|Ga0307471_101469193 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300032261|Ga0306920_100096320 | All Organisms → cellular organisms → Bacteria | 4377 | Open in IMG/M |
3300032342|Ga0315286_10246427 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
3300032397|Ga0315287_12768929 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300033433|Ga0326726_10811398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 906 | Open in IMG/M |
3300033513|Ga0316628_102176220 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 735 | Open in IMG/M |
3300034668|Ga0314793_067036 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 692 | Open in IMG/M |
3300034670|Ga0314795_047320 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 752 | Open in IMG/M |
3300034677|Ga0314802_033861 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 562 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.12% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.14% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.98% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.98% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.38% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.79% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.19% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.19% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.19% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.19% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.19% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.60% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.60% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.60% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.60% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.60% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.60% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014256 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034677 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1070908171 | 3300000955 | Soil | PASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG* |
C687J29651_101407892 | 3300002407 | Soil | DVYDAKTGRIDMHGLQPVGRLAGNQYAHIHDIFEMKRPNENYRG* |
JGI25390J43892_100176162 | 3300002911 | Grasslands Soil | LYDAATGRLDMHRLRPVGRLAGNLYTRVHDIFEMKRPNPDYRG* |
Ga0066677_107531112 | 3300005171 | Soil | HLHVRDDVYDPASGRLDMHRLRPGGAWLAMYTHVNEVFEMKRPAVDYKG* |
Ga0066690_110513022 | 3300005177 | Soil | ATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPDPDYRG* |
Ga0066676_104460452 | 3300005186 | Soil | DDVYDPASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVGYKG* |
Ga0070676_100082361 | 3300005328 | Miscanthus Rhizosphere | DDIYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMTRPSENYAG* |
Ga0070670_1001424151 | 3300005331 | Switchgrass Rhizosphere | IYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG* |
Ga0066388_1008388863 | 3300005332 | Tropical Forest Soil | GTGRIDIARLRPVGRLAGNQYAHIHDLFEMKRPNENYKG* |
Ga0066388_1025667041 | 3300005332 | Tropical Forest Soil | KTGRIDIHRLQPVGRLAGHQYAHIHDIFEMKRPNENYKG* |
Ga0066388_1060375542 | 3300005332 | Tropical Forest Soil | YDAATGRVDMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG* |
Ga0070662_1008562931 | 3300005457 | Corn Rhizosphere | VYDAASGRIDMHRLRPVGRLAGNLYSHIHDIFEMKRPSVDYKG* |
Ga0070695_1014644321 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RDDIYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG* |
Ga0066695_107966921 | 3300005553 | Soil | RIDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG* |
Ga0066661_102313122 | 3300005554 | Soil | DGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG* |
Ga0066705_105310301 | 3300005569 | Soil | DVYDPASGRFDMHKLKPVGRLTGNLYSHIHQIFEMKRPNPDYRG* |
Ga0068857_1021672981 | 3300005577 | Corn Rhizosphere | PATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG* |
Ga0066905_1001258711 | 3300005713 | Tropical Forest Soil | WHVRDDIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG* |
Ga0066905_1004298251 | 3300005713 | Tropical Forest Soil | VRDGLYDASTGRIDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG* |
Ga0066905_1016889032 | 3300005713 | Tropical Forest Soil | RDDIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG* |
Ga0075295_10224002 | 3300005879 | Rice Paddy Soil | DDLYETATGRIDMARLKPVGRLAGHAYAHVHDIFHMKRPSETYAG* |
Ga0066656_100862141 | 3300006034 | Soil | DMHRLRPVGRLAGNLYARVHDIFEMKRPNPDYRG* |
Ga0075018_104280482 | 3300006172 | Watersheds | GRIDMARLKPVGRLAGHAYAHVHDIFQMKRPSETYAG* |
Ga0079222_118126781 | 3300006755 | Agricultural Soil | TGRIDMQRLRPVGRLAGHLYTHVHDLFELKRPAPGYKG* |
Ga0066658_102711431 | 3300006794 | Soil | IRDDLYNPSTGRIDMYRLHPVGRLAGNLYTHVHDIFEMKRPVENYAG* |
Ga0066659_100610773 | 3300006797 | Soil | DGLYDASTGRIDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG* |
Ga0075421_1002734021 | 3300006845 | Populus Rhizosphere | DPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG* |
Ga0075425_1017371452 | 3300006854 | Populus Rhizosphere | GRLDMHRLKPVGRLAGQLYTHVHEIFEMKRPSVDYRG* |
Ga0075434_1013879172 | 3300006871 | Populus Rhizosphere | NTGRVDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG* |
Ga0068865_1014583812 | 3300006881 | Miscanthus Rhizosphere | DLHRLRPVGRLAGNLYSRVHDIFEMKRPTADYRG* |
Ga0068865_1015038552 | 3300006881 | Miscanthus Rhizosphere | DLYNLNTGRIDMHKLHPVGRLAGNLYAHVHDIFEMKRPVENYAG* |
Ga0079218_121545191 | 3300007004 | Agricultural Soil | DLYDPVTGRLDMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG* |
Ga0066710_1007903911 | 3300009012 | Grasslands Soil | RDGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG |
Ga0066710_1011915441 | 3300009012 | Grasslands Soil | RDGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNADYRG |
Ga0066710_1031232493 | 3300009012 | Grasslands Soil | LDMHALRPVGRLCGNLYSHIHEIFEMKRPNPDYRG |
Ga0099828_100896261 | 3300009089 | Vadose Zone Soil | AATGRLDMHRLRPVGRLTGNLYSHIHDIFEMKRPSENYRG* |
Ga0105250_101901462 | 3300009092 | Switchgrass Rhizosphere | RIDIRRLQPVGRLAGNQYSHIHDIFEMKRPNENYKG* |
Ga0114129_108604961 | 3300009147 | Populus Rhizosphere | DIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG* |
Ga0114129_121466112 | 3300009147 | Populus Rhizosphere | GRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG* |
Ga0111538_110316781 | 3300009156 | Populus Rhizosphere | DMHELRPVGRLAGNLYSHIHDIFEMKRPNDRYAG* |
Ga0105092_103126352 | 3300009157 | Freshwater Sediment | VFDPATGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPAADYKG* |
Ga0105241_120781082 | 3300009174 | Corn Rhizosphere | ASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG* |
Ga0105248_120690011 | 3300009177 | Switchgrass Rhizosphere | DVYDAATGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPSAAYKG* |
Ga0105340_13204842 | 3300009610 | Soil | PTTGRLDMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG* |
Ga0126374_102669601 | 3300009792 | Tropical Forest Soil | TGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPVADYRG* |
Ga0105065_10142952 | 3300009803 | Groundwater Sand | YDAASGRIDMTRLKPVGRLAGQQYAHVHDIFQMKRPNEDYKG* |
Ga0105062_10523292 | 3300009817 | Groundwater Sand | MQFDPRDDLYNPNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG* |
Ga0105085_10682541 | 3300009820 | Groundwater Sand | RDDLYNPNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG* |
Ga0126312_109125512 | 3300010041 | Serpentine Soil | GRIDMYKLHPVGRLAGELYTHVHDIFEMKRPVENYRG* |
Ga0126382_124056492 | 3300010047 | Tropical Forest Soil | NPNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG* |
Ga0134070_103377981 | 3300010301 | Grasslands Soil | DIYDAATGRLDMHRLRPVGRLCGNLYTHVHDIFEMKRPGTTYRG* |
Ga0134064_101496822 | 3300010325 | Grasslands Soil | IVYFHVRDDIYDAATGRLDMHRLRPVGRLCGNLYTHVHDIFEMKRPGTTYRG* |
Ga0126370_123663651 | 3300010358 | Tropical Forest Soil | HVRDDVYDPATGRLDMHRLKPVGRLAGQLYTHVHEIFEMKRPSVGYKG* |
Ga0126376_115188172 | 3300010359 | Tropical Forest Soil | YDAKTGRIDIHRLQPVGRLAGHQYAHIHDIFEMTRPNENYKG* |
Ga0126377_109362882 | 3300010362 | Tropical Forest Soil | LDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG* |
Ga0126377_125742311 | 3300010362 | Tropical Forest Soil | DMHKLKPVGRLAGQLYTHVHEIFEMKRPSVDYRG* |
Ga0126377_129684441 | 3300010362 | Tropical Forest Soil | DMHQLHPVGRLAGNLYTHVHDIFEMKRPVENYAG* |
Ga0126379_112144621 | 3300010366 | Tropical Forest Soil | GRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG* |
Ga0126379_116814502 | 3300010366 | Tropical Forest Soil | DMHGLRPVGRLAGNLYSHIHDIFEMKRPGDRYAG* |
Ga0134125_130377671 | 3300010371 | Terrestrial Soil | PSTGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPAADYKG* |
Ga0134128_131615981 | 3300010373 | Terrestrial Soil | DVYDAASGRIDMQRLRPVGRLAGHLYTHVHDLFEMKRPAAGYKG* |
Ga0105239_118092831 | 3300010375 | Corn Rhizosphere | RDDIYDPATGRLDMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG* |
Ga0126381_1022328961 | 3300010376 | Tropical Forest Soil | DDVYDAKTGRIDIHRLQPVGRLAGHQYAHVHDIFEMKRPDENYKG* |
Ga0136847_128755801 | 3300010391 | Freshwater Sediment | TGRVDMHRLKPVGRLAGQAYSHINDIFEMKRPVENYGG* |
Ga0126383_106336313 | 3300010398 | Tropical Forest Soil | DMHRLRPVGRLAGNLYSHIHDIFEMKRPNENYRG* |
Ga0134127_117990471 | 3300010399 | Terrestrial Soil | YDAATGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPSAAYQG* |
Ga0134122_100077381 | 3300010400 | Terrestrial Soil | DIYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSESYAG* |
Ga0134122_109595621 | 3300010400 | Terrestrial Soil | DMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG* |
Ga0124844_12477783 | 3300010868 | Tropical Forest Soil | DVYDAASGRIDMHRLRPVGRLAGNLYSHIHDIFEMKRPATDYKG* |
Ga0124844_12483242 | 3300010868 | Tropical Forest Soil | VYDAASGRIDMHRLRPVGRLAGNLYSHIHDIFEMKRPATDYKG* |
Ga0137428_10221193 | 3300011432 | Soil | DLYDAASGRIDLHRLRPVGRLAGNLYSRVHDIFEMKRPSADYRG* |
Ga0137388_105946991 | 3300012189 | Vadose Zone Soil | PPRESMDRLRPVGRLCGNLYTHVHIFEMKRPGANYRG* |
Ga0137388_106626021 | 3300012189 | Vadose Zone Soil | QWHVRDDVYDAATGRLDMHRLRPVGRLTGNLYSHIHDIFAMKRPSENYRG* |
Ga0137382_102365573 | 3300012200 | Vadose Zone Soil | HLRDDVYDPASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVNYKG* |
Ga0137377_104052041 | 3300012211 | Vadose Zone Soil | SGRLDMHRLQPVGRLAGHLYTHVHEIFEMKRPSVNYTG* |
Ga0137387_108932372 | 3300012349 | Vadose Zone Soil | YETATGRIDMARLKPVGRLAGHAYTHVHDIFQTKRPSETYAG* |
Ga0137386_100541574 | 3300012351 | Vadose Zone Soil | PNPGRINMHRVHPVGRLAGNLYTHVHDMFEMKRPLENRGG* |
Ga0137358_104146802 | 3300012582 | Vadose Zone Soil | LYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG* |
Ga0137397_100632874 | 3300012685 | Vadose Zone Soil | ATGRIDVARLKPVGRLAGHQYSYIHEIFEMKRPNEHYRG* |
Ga0137396_104715211 | 3300012918 | Vadose Zone Soil | TGRIDMARLKPVGRLAGHAYTHVHDIFQMKRPSETYAG* |
Ga0137394_100568981 | 3300012922 | Vadose Zone Soil | ATGRIDMTRLRPVGRLAGHAYTHVHDIFQMKRPSETYAG* |
Ga0137359_115456212 | 3300012923 | Vadose Zone Soil | RLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG* |
Ga0137419_116531052 | 3300012925 | Vadose Zone Soil | RDGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG* |
Ga0137407_108036871 | 3300012930 | Vadose Zone Soil | GRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG* |
Ga0153915_118209652 | 3300012931 | Freshwater Wetlands | RIDMHRLKPVGRLAGQLYAHVHDIFVMKRPDPHYAG* |
Ga0137410_100226221 | 3300012944 | Vadose Zone Soil | ATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG* |
Ga0137410_115409682 | 3300012944 | Vadose Zone Soil | DVYDPKSGRLDMHQLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG* |
Ga0126375_101743081 | 3300012948 | Tropical Forest Soil | DAQTGRIDMHRLRPVGRLAGNLYTHVHDIFEMKRPAANYRG* |
Ga0134087_101246432 | 3300012977 | Grasslands Soil | LYDAATGRIDLRRLRPVGRLAGNLYTHVHDIFEMKRPNANYRG* |
Ga0157370_117877341 | 3300013104 | Corn Rhizosphere | DYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG* |
Ga0075318_11261112 | 3300014256 | Natural And Restored Wetlands | DMRRLKPVGRLAGHLYTHVHDIFEMKRPAVDYKG* |
Ga0157380_110895063 | 3300014326 | Switchgrass Rhizosphere | IYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMTRPSENYAG* |
Ga0182011_109372751 | 3300014496 | Fen | TGRIDMRRLKPVGRLAGEMYTHVHDLFEMKRPVSGYSG* |
Ga0182021_102737161 | 3300014502 | Fen | IDMRRLKPVGRLAGEMYTHVHDLFEMKRPVSDYAG* |
Ga0182027_110334531 | 3300014839 | Fen | FRDDLYDPGTGRIDMRRLKPVGRLAGEMYTHVHDLFEMKRPVSGYSG* |
Ga0180086_11862153 | 3300014883 | Soil | AATGRLDMHRLRPVGRLTGNLYSHIHDIFEMKRPSADYRG* |
Ga0137405_11383921 | 3300015053 | Vadose Zone Soil | IVYVHVRDGLYDAATGRLDMHRLRGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNADYRG* |
Ga0137409_110597082 | 3300015245 | Vadose Zone Soil | DDVYDAATGRLDMHRLRPVGRLTGNLYSHIHDIFEMKRPSENYRG* |
Ga0180089_10378142 | 3300015254 | Soil | DVYDAATGRIDMARLKPVGRLAGHQYTYVHDIFEMKRPNENYRG* |
Ga0137403_100527101 | 3300015264 | Vadose Zone Soil | VYDAATGRIDIARLKPVGRLAGHQYSYIHDIFEMKRPNENYKG* |
Ga0137403_102042931 | 3300015264 | Vadose Zone Soil | VYDAATGRIDIARLKPVGRLAGHQYSYIHEIFEMKRPNENYKG* |
Ga0132256_1023493272 | 3300015372 | Arabidopsis Rhizosphere | RDDIYDSRTGRVDMHRLRPVGRLAGHQYAHVHDIFEMKRPSESYRG* |
Ga0184610_11532782 | 3300017997 | Groundwater Sediment | DLYNPRTGRIDMHKFHPVGRLAGNLYTHVHDIFEMKRPVENYAG |
Ga0184604_103681472 | 3300018000 | Groundwater Sediment | AATGRIDITRLKPVGRLAGHQYAHIHDIFEMKRPNENYKG |
Ga0187787_100872851 | 3300018029 | Tropical Peatland | GRIDMARLRPVGRLAGHQYTHVHDIFQMKRPSETYAG |
Ga0187766_111553422 | 3300018058 | Tropical Peatland | DVYDPATGRIDMHRLRPLARLAGQQYAHVHDIFEMKRPNEHYAG |
Ga0184615_102603841 | 3300018059 | Groundwater Sediment | ATGRIDMRRLRPVGRLAGHQYTHVHDIFEMRRPAVDYKG |
Ga0184619_102860072 | 3300018061 | Groundwater Sediment | VYDATTGRIDMRRLRPVGRLAGHQYTHVHDIFEMKRPAVDYKG |
Ga0184612_105059091 | 3300018078 | Groundwater Sediment | ATGRVDIARLKPVGRLAGHQYTYVHDIFEMKRPNEHYRG |
Ga0066667_119172821 | 3300018433 | Grasslands Soil | VRDDVYDPASGRFDMHKLKPVGRLTGNLYSHIHQIFEMKRPNPDYRG |
Ga0066662_125008161 | 3300018468 | Grasslands Soil | DVYDPASGRLDMHRLQPVGRLAGHLYTHVHEIFEMKRPSVNYKG |
Ga0187893_107997131 | 3300019487 | Microbial Mat On Rocks | DDLYNTNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG |
Ga0193723_11364602 | 3300019879 | Soil | GRIDIARLKPVGRLAGHQYSYIHEIFEMKRPNENYKG |
Ga0179594_100869932 | 3300020170 | Vadose Zone Soil | ATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNADYRG |
Ga0196963_105301051 | 3300020215 | Soil | AATGRVDMHRLAPVGRLAGHMYTHVHDIFVMKRPNEHYAG |
Ga0209343_108093331 | 3300025311 | Groundwater | DVYDAKTGRIDMHGLQPVGRLAGNQYAHIHDIFEMKRPNENYRG |
Ga0209321_102054281 | 3300025312 | Soil | KTGRIDMHGLQPVGRLAGNQYAHIHDIFEMKRPNENYRG |
Ga0209519_101315821 | 3300025318 | Soil | TTGRIDLHRLRPVGRLAGNLYTHVHDIFEMKRPVAGYRG |
Ga0207653_103213452 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | ATGRLDMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG |
Ga0207648_119170681 | 3300026089 | Miscanthus Rhizosphere | LDMHALKPVGRLCGNLYSHIHQIFEMKRPSASYRG |
Ga0209438_10809531 | 3300026285 | Grasslands Soil | TGRIDVARLKPVGRLAGHQYSYIHEIFEMKRPNENYKG |
Ga0209154_10429473 | 3300026317 | Soil | VYFHVRDDIYDAATGRLDMHRLRPVGRLCGNLYTHVHDIFEMKRPGTTYRG |
Ga0209687_12718051 | 3300026322 | Soil | VRDGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG |
Ga0209472_12071892 | 3300026323 | Soil | IDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG |
Ga0209470_11582041 | 3300026324 | Soil | QWHVRDDIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG |
Ga0209804_13227441 | 3300026335 | Soil | DGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG |
Ga0257177_10776701 | 3300026480 | Soil | RDDIYDAATGRLDMHRLRPVGRLCGNLYTHVHDIFEMKRPGANYRG |
Ga0209808_11638011 | 3300026523 | Soil | LDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG |
Ga0209690_11018981 | 3300026524 | Soil | DGLYDASTGRIDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG |
Ga0209378_10551481 | 3300026528 | Soil | DAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNANYRG |
Ga0209896_10377531 | 3300027006 | Groundwater Sand | MQFDPRDDLYNPNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG |
Ga0209814_101620271 | 3300027873 | Populus Rhizosphere | LYDPVTGRVDMHRLCPVGRLAGNLYTHVHDIFEMKRPSADYRG |
Ga0209814_105615002 | 3300027873 | Populus Rhizosphere | IVHLHLRDDVYDPARGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG |
Ga0209293_106216991 | 3300027877 | Wetland | GRVDMHRLKPVGRLAGEMYTHVHDLFELKRPVANYLG |
Ga0207428_112621652 | 3300027907 | Populus Rhizosphere | IRDDLYNPNTGRVDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG |
Ga0209382_112973402 | 3300027909 | Populus Rhizosphere | ATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG |
Ga0209382_114419953 | 3300027909 | Populus Rhizosphere | IYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG |
Ga0209583_105098352 | 3300027910 | Watersheds | TGRIDMARLKPVGRLAGHAYTHVHDIFHMKRPSETYAG |
Ga0209583_106003222 | 3300027910 | Watersheds | YNPNTGRIDMHKLHPVGCLAGNLYTHVHDIFEMKRPVENYAG |
Ga0209885_10052763 | 3300027950 | Groundwater Sand | YDAASGRIDMTRLKPVGRLAGQQYAHVHDIFQMKRPNEDYKG |
Ga0247820_109182221 | 3300028597 | Soil | PNTGRIDMYKLRPVGRLAGNLYTHVHDIFEMKRPVGNYAG |
Ga0257175_11213082 | 3300028673 | Soil | TGRIDMARLKPVGRLAGHAYTHVHDIFQMKRPSETYAG |
(restricted) Ga0255310_102247572 | 3300031197 | Sandy Soil | DLYEAATGRIDMARLKPVGRLAGHAYAHVHDIFQMKRPSESYAG |
Ga0307408_1017739231 | 3300031548 | Rhizosphere | PQTGRIDMYNLHPVGRLAGELYTHVQDIFEMKRPVEHYAG |
Ga0318542_101247991 | 3300031668 | Soil | QLHFRDDVYDPTTGRLDMHRLRPVGRLAGQLYTHVHDIFEMKRPAADYRG |
Ga0307469_107190891 | 3300031720 | Hardwood Forest Soil | VRDDIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG |
Ga0307469_116275832 | 3300031720 | Hardwood Forest Soil | DVYDAASGRIDMHRLRPVGRLAGNLYSHIHDIFEMKRPSTDYKG |
Ga0307469_117240712 | 3300031720 | Hardwood Forest Soil | LHVRDDVYDPASGRLDMHRLRPVGHLAGHLYTHVHEIFEMKRPAVDYRA |
Ga0307469_125342741 | 3300031720 | Hardwood Forest Soil | RLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG |
Ga0307468_1000690243 | 3300031740 | Hardwood Forest Soil | LDMHRLRPVGRLAGQLYTHVHEIFEMKRPSVDYRG |
Ga0307468_1003731131 | 3300031740 | Hardwood Forest Soil | AATGRIDVGRLKPVGRLAGHQYAYIHDIFEMKRPNENYRG |
Ga0307468_1010509422 | 3300031740 | Hardwood Forest Soil | VREDLYDAGSGRIDLHRLRPVGRLAGNLYSRVHDIFEMKRPTADYRG |
Ga0318498_105200902 | 3300031778 | Soil | AKTGRIDVHRLQPVGRLAGHQYAHIHDIFEMKRPDENYKG |
Ga0318550_101148831 | 3300031797 | Soil | YDPTTGRLDMHRLRPVGRLAGQLYTHVHDIFEMKRPAADYRG |
Ga0307473_105054542 | 3300031820 | Hardwood Forest Soil | SGRIDMTRLRPVGRLAGHAYTHVHDIFQMKRPSETYAG |
Ga0307412_104108922 | 3300031911 | Rhizosphere | HVRDDVYDAATGRLDMERLRPVGRLCGNLYSHIHQIFEMKRPSPDYRG |
Ga0310901_100746003 | 3300031940 | Soil | PATGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPAVDYKG |
Ga0318525_103137041 | 3300032089 | Soil | LDMHRLRPVGRLAGQLYTHVHDIFEMKRPAADYRG |
Ga0307471_1013611091 | 3300032180 | Hardwood Forest Soil | DAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG |
Ga0307471_1014691931 | 3300032180 | Hardwood Forest Soil | DDVYDPASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG |
Ga0306920_1000963204 | 3300032261 | Soil | LHVRDEVYDPATGRLDMHRLRPVGRLAGQLYTHVHDIFEMKRPAADYRG |
Ga0315286_102464273 | 3300032342 | Sediment | DAKTGRIDIHRLQPVGRLAGNQYSHIHDIFEMKRPNENYKG |
Ga0315287_127689291 | 3300032397 | Sediment | FRDDLYDPKTGRIDMKGLKPVGRLAGEMYTHVHDLFEMKRPVADYPG |
Ga0326726_108113982 | 3300033433 | Peat Soil | RVDMQRLKPVGRLAGEMYTHVHDLFEMQRPDANYAG |
Ga0316628_1021762202 | 3300033513 | Soil | LYETSTGRIDMARLKPVGRLAGHAYTHVHDIFQMKRPSETYPG |
Ga0314793_067036_186_338 | 3300034668 | Soil | MAKHNSRVYNLNTGRIDMHKLHPVGRLAGNLYAHVHDIFEMKRPVENYAG |
Ga0314795_047320_1_135 | 3300034670 | Soil | DLYNPNTGRIDMYKLCPVGRLAGNLYTHVHDIFEMKRPGENYAG |
Ga0314802_033861_2_118 | 3300034677 | Soil | TGRVDMYKLHPVGRLAGNLYTHVHDIFEMKRPGENYAG |
⦗Top⦘ |