Metagenome / Metatranscriptome Family F037393

Basic Information
Family ID	F037393
Family Type	Metagenome / Metatranscriptome
Number of Sequences	168
Average Sequence Length	42 residues
Representative Sequence	DAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNANYRG
Number of Associated Samples	143
Number of Associated Scaffolds	168

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.19 %
% of genes near scaffold ends (potentially truncated)	97.62 %
% of genes from short scaffolds (< 2000 bps)	92.26 %
Associated GOLD sequencing projects	136
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.18

Most Common Taxonomy
Group	Bacteria (85.119 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.500 % of family members)
Environment Ontology (ENVO)	Unclassified (29.167 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (39.286 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 168 Family Scaffolds
PF07969	Amidohydro_3	11.31
PF00459	Inositol_P	8.93
PF00106	adh_short	4.76
PF00528	BPD_transp_1	3.57
PF02518	HATPase_c	3.57
PF03972	MmgE_PrpD	3.57
PF01841	Transglut_core	3.57
PF00296	Bac_luciferase	2.98
PF07690	MFS_1	2.98
PF14595	Thioredoxin_9	2.98
PF00496	SBP_bac_5	2.98
PF00248	Aldo_ket_red	2.38
PF03328	HpcH_HpaI	2.38
PF00072	Response_reg	1.79
PF01613	Flavin_Reduct	1.79
PF04962	KduI	1.19
PF00565	SNase	1.19
PF01965	DJ-1_PfpI	1.19
PF01323	DSBA	1.19
PF02826	2-Hacid_dh_C	1.19
PF00389	2-Hacid_dh	1.19
PF13561	adh_short_C2	1.19
PF08450	SGL	1.19
PF08282	Hydrolase_3	0.60
PF01425	Amidase	0.60
PF01370	Epimerase	0.60
PF02639	DUF188	0.60
PF13539	Peptidase_M15_4	0.60
PF12697	Abhydrolase_6	0.60
PF13649	Methyltransf_25	0.60
PF13533	Biotin_lipoyl_2	0.60
PF00330	Aconitase	0.60
PF09980	DUF2214	0.60
PF06050	HGD-D	0.60
PF13594	Obsolete Pfam Family	0.60
PF13699	DUF4157	0.60
PF00903	Glyoxalase	0.60
PF13278	Obsolete Pfam Family	0.60
PF03461	TRCF	0.60
PF06480	FtsH_ext	0.60
PF08239	SH3_3	0.60
PF01734	Patatin	0.60
PF00206	Lyase_1	0.60

COG ID	Name	Functional Category	% Frequency in 168 Family Scaffolds
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	3.57
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	2.98
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	2.38
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	2.38
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	2.38
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	1.79
COG1197	Transcription-repair coupling factor (superfamily II helicase)	Transcription [K]	1.19
COG3717	5-keto 4-deoxyuronate isomerase	Carbohydrate transport and metabolism [G]	1.19
COG3391	DNA-binding beta-propeller fold protein YncE	General function prediction only [R]	1.19
COG3386	Sugar lactone lactonase YvrE	Carbohydrate transport and metabolism [G]	1.19
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.60
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.60
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	0.60
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.60
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.60
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.60
COG1775	Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB	Amino acid transport and metabolism [E]	0.60
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.60
COG1671	Uncharacterized conserved protein YaiI, UPF0178 family	Function unknown [S]	0.60
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	0.60
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	0.60
COG0465	ATP-dependent Zn proteases	Posttranslational modification, protein turnover, chaperones [O]	0.60

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	85.12 %
Unclassified	root	N/A	14.88 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	85.12 %
Unclassified	root	N/A	14.88 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	85.12 %
Unclassified	root	N/A	14.88 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	20.24 %
Unclassified	root	N/A	14.88 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	8.33 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	8.33 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.98 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.60 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	20.24 %
Unclassified	root	N/A	14.88 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	8.33 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.38 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.79 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.79 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.60 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.60 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.60 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.60 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	19.05 %
Unclassified	root	N/A	14.88 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	8.33 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	1.19 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	1.19 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.19 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.60 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.60 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.60 %
unclassified Terriglobia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia	0.60 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.60 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.60 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.60 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	14.88 %
Unclassified	root	N/A	14.88 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	1.19 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	1.19 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.60 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.60 %
Isosphaerales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales	0.60 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.60 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.60 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.60 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.60 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.60 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.60 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.88 %
Unclassified	root	N/A	14.88 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	1.19 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.60 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.60 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	0.60 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.60 %
unclassified Rhodospirillaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae	0.60 %
unclassified Burkholderiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.60 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.60 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.60 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.88 %
Unclassified	root	N/A	14.88 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	1.19 %
Rhodospirillaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	0.60 %
Burkholderiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium	0.60 %
Bacillus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus	0.60 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.60 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.60 %
Pseudomonas fluorescens group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group	0.60 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	0.60 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.60 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.60 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.60 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.88 %
Unclassified	root	N/A	14.88 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	1.19 %
Pseudomonas fluorescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens	0.60 %
Bacillus cereus group	species group	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus cereus group	0.60 %
Rhodospirillaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	0.60 %
Burkholderiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium	0.60 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.60 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.60 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	0.60 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.60 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.60 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.60 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.88 %
Unclassified	root	N/A	14.88 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	1.19 %
Bacillus manliponensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus cereus group → Bacillus manliponensis	0.60 %
Pseudomonas fluorescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens	0.60 %
Rhodospirillaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	0.60 %
Burkholderiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium	0.60 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.60 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.60 %
Isosphaeraceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	0.60 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.60 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.60 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000955\|JGI1027J12803_107090817	All Organisms → cellular organisms → Bacteria	1105	Open in IMG/M
3300002407\|C687J29651_10140789	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	789	Open in IMG/M
3300002911\|JGI25390J43892_10017616	Not Available	1707	Open in IMG/M
3300005171\|Ga0066677_10753111	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300005177\|Ga0066690_11051302	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300005186\|Ga0066676_10446045	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300005328\|Ga0070676_10008236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5612	Open in IMG/M
3300005331\|Ga0070670_100142415	All Organisms → cellular organisms → Bacteria → Proteobacteria	2073	Open in IMG/M
3300005332\|Ga0066388_100838886	All Organisms → cellular organisms → Bacteria	1506	Open in IMG/M
3300005332\|Ga0066388_102566704	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300005332\|Ga0066388_106037554	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300005457\|Ga0070662_100856293	All Organisms → cellular organisms → Bacteria	774	Open in IMG/M
3300005545\|Ga0070695_101464432	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus cereus group → Bacillus manliponensis	567	Open in IMG/M
3300005553\|Ga0066695_10796692	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300005554\|Ga0066661_10231312	All Organisms → cellular organisms → Bacteria	1145	Open in IMG/M
3300005569\|Ga0066705_10531030	All Organisms → cellular organisms → Bacteria	733	Open in IMG/M
3300005577\|Ga0068857_102167298	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300005713\|Ga0066905_100125871	All Organisms → cellular organisms → Bacteria	1798	Open in IMG/M
3300005713\|Ga0066905_100429825	All Organisms → cellular organisms → Bacteria	1080	Open in IMG/M
3300005713\|Ga0066905_101688903	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300005879\|Ga0075295_1022400	All Organisms → cellular organisms → Bacteria	750	Open in IMG/M
3300006034\|Ga0066656_10086214	All Organisms → cellular organisms → Bacteria → Proteobacteria	1883	Open in IMG/M
3300006172\|Ga0075018_10428048	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300006755\|Ga0079222_11812678	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	591	Open in IMG/M
3300006794\|Ga0066658_10271143	All Organisms → cellular organisms → Bacteria	909	Open in IMG/M
3300006797\|Ga0066659_10061077	All Organisms → cellular organisms → Bacteria	2425	Open in IMG/M
3300006845\|Ga0075421_100273402	All Organisms → cellular organisms → Bacteria → Proteobacteria	2064	Open in IMG/M
3300006854\|Ga0075425_101737145	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300006871\|Ga0075434_101387917	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300006881\|Ga0068865_101458381	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300006881\|Ga0068865_101503855	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300007004\|Ga0079218_12154519	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	645	Open in IMG/M
3300009012\|Ga0066710_100790391	Not Available	1454	Open in IMG/M
3300009012\|Ga0066710_101191544	Not Available	1180	Open in IMG/M
3300009012\|Ga0066710_103123249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	639	Open in IMG/M
3300009089\|Ga0099828_10089626	All Organisms → cellular organisms → Bacteria	2642	Open in IMG/M
3300009092\|Ga0105250_10190146	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	864	Open in IMG/M
3300009147\|Ga0114129_10860496	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1152	Open in IMG/M
3300009147\|Ga0114129_12146611	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	673	Open in IMG/M
3300009156\|Ga0111538_11031678	All Organisms → cellular organisms → Bacteria	1040	Open in IMG/M
3300009157\|Ga0105092_10312635	Not Available	887	Open in IMG/M
3300009174\|Ga0105241_12078108	All Organisms → cellular organisms → Bacteria	561	Open in IMG/M
3300009177\|Ga0105248_12069001	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300009610\|Ga0105340_1320484	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300009792\|Ga0126374_10266960	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1127	Open in IMG/M
3300009803\|Ga0105065_1014295	All Organisms → cellular organisms → Bacteria	871	Open in IMG/M
3300009817\|Ga0105062_1052329	All Organisms → cellular organisms → Bacteria	750	Open in IMG/M
3300009820\|Ga0105085_1068254	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	662	Open in IMG/M
3300010041\|Ga0126312_10912551	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	640	Open in IMG/M
3300010047\|Ga0126382_12405649	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	512	Open in IMG/M
3300010301\|Ga0134070_10337798	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300010325\|Ga0134064_10149682	All Organisms → cellular organisms → Bacteria	806	Open in IMG/M
3300010358\|Ga0126370_12366365	Not Available	527	Open in IMG/M
3300010359\|Ga0126376_11518817	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300010362\|Ga0126377_10936288	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	930	Open in IMG/M
3300010362\|Ga0126377_12574231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens	584	Open in IMG/M
3300010362\|Ga0126377_12968444	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	547	Open in IMG/M
3300010366\|Ga0126379_11214462	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	860	Open in IMG/M
3300010366\|Ga0126379_11681450	All Organisms → cellular organisms → Bacteria	739	Open in IMG/M
3300010371\|Ga0134125_13037767	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	509	Open in IMG/M
3300010373\|Ga0134128_13161598	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	506	Open in IMG/M
3300010375\|Ga0105239_11809283	All Organisms → cellular organisms → Bacteria	708	Open in IMG/M
3300010376\|Ga0126381_102232896	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	787	Open in IMG/M
3300010391\|Ga0136847_12875580	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300010398\|Ga0126383_10633631	All Organisms → cellular organisms → Bacteria → Proteobacteria	1143	Open in IMG/M
3300010399\|Ga0134127_11799047	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300010400\|Ga0134122_10007738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8004	Open in IMG/M
3300010400\|Ga0134122_10959562	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300010868\|Ga0124844_1247778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium	627	Open in IMG/M
3300010868\|Ga0124844_1248324	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	626	Open in IMG/M
3300011432\|Ga0137428_1022119	All Organisms → cellular organisms → Bacteria	1599	Open in IMG/M
3300012189\|Ga0137388_10594699	All Organisms → cellular organisms → Bacteria	1029	Open in IMG/M
3300012189\|Ga0137388_10662602	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	970	Open in IMG/M
3300012200\|Ga0137382_10236557	All Organisms → cellular organisms → Bacteria	1263	Open in IMG/M
3300012211\|Ga0137377_10405204	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1302	Open in IMG/M
3300012349\|Ga0137387_10893237	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300012351\|Ga0137386_10054157	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	2777	Open in IMG/M
3300012582\|Ga0137358_10414680	Not Available	910	Open in IMG/M
3300012685\|Ga0137397_10063287	All Organisms → cellular organisms → Bacteria	2671	Open in IMG/M
3300012918\|Ga0137396_10471521	All Organisms → cellular organisms → Bacteria	930	Open in IMG/M
3300012922\|Ga0137394_10056898	All Organisms → cellular organisms → Bacteria → Proteobacteria	3236	Open in IMG/M
3300012923\|Ga0137359_11545621	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300012925\|Ga0137419_11653105	Not Available	545	Open in IMG/M
3300012930\|Ga0137407_10803687	Not Available	888	Open in IMG/M
3300012931\|Ga0153915_11820965	All Organisms → cellular organisms → Bacteria	712	Open in IMG/M
3300012944\|Ga0137410_10022622	All Organisms → cellular organisms → Bacteria → Proteobacteria	4343	Open in IMG/M
3300012944\|Ga0137410_11540968	Not Available	581	Open in IMG/M
3300012948\|Ga0126375_10174308	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1384	Open in IMG/M
3300012977\|Ga0134087_10124643	Not Available	1100	Open in IMG/M
3300013104\|Ga0157370_11787734	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300014256\|Ga0075318_1126111	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	528	Open in IMG/M
3300014326\|Ga0157380_11089506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	837	Open in IMG/M
3300014496\|Ga0182011_10937275	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	538	Open in IMG/M
3300014502\|Ga0182021_10273716	All Organisms → cellular organisms → Bacteria	1983	Open in IMG/M
3300014839\|Ga0182027_11033453	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	839	Open in IMG/M
3300014883\|Ga0180086_1186215	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	539	Open in IMG/M
3300015053\|Ga0137405_1138392	Not Available	1550	Open in IMG/M
3300015245\|Ga0137409_11059708	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	649	Open in IMG/M
3300015254\|Ga0180089_1037814	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300015264\|Ga0137403_10052710	All Organisms → cellular organisms → Bacteria	4188	Open in IMG/M
3300015264\|Ga0137403_10204293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1906	Open in IMG/M
3300015372\|Ga0132256_102349327	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	636	Open in IMG/M
3300017997\|Ga0184610_1153278	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	757	Open in IMG/M
3300018000\|Ga0184604_10368147	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300018029\|Ga0187787_10087285	All Organisms → cellular organisms → Bacteria	983	Open in IMG/M
3300018058\|Ga0187766_11155342	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	558	Open in IMG/M
3300018059\|Ga0184615_10260384	All Organisms → cellular organisms → Bacteria	971	Open in IMG/M
3300018061\|Ga0184619_10286007	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	757	Open in IMG/M
3300018078\|Ga0184612_10505909	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300018433\|Ga0066667_11917282	Not Available	541	Open in IMG/M
3300018468\|Ga0066662_12500816	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	544	Open in IMG/M
3300019487\|Ga0187893_10799713	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	572	Open in IMG/M
3300019879\|Ga0193723_1136460	All Organisms → cellular organisms → Bacteria	669	Open in IMG/M
3300020170\|Ga0179594_10086993	Not Available	1109	Open in IMG/M
3300020215\|Ga0196963_10530105	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300025311\|Ga0209343_10809333	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	517	Open in IMG/M
3300025312\|Ga0209321_10205428	All Organisms → cellular organisms → Bacteria	1015	Open in IMG/M
3300025318\|Ga0209519_10131582	All Organisms → cellular organisms → Bacteria	1478	Open in IMG/M
3300025885\|Ga0207653_10321345	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M
3300026089\|Ga0207648_11917068	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	554	Open in IMG/M
3300026285\|Ga0209438_1080953	Not Available	1040	Open in IMG/M
3300026317\|Ga0209154_1042947	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2036	Open in IMG/M
3300026322\|Ga0209687_1271805	Not Available	530	Open in IMG/M
3300026323\|Ga0209472_1207189	Not Available	657	Open in IMG/M
3300026324\|Ga0209470_1158204	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	991	Open in IMG/M
3300026335\|Ga0209804_1322744	Not Available	521	Open in IMG/M
3300026480\|Ga0257177_1077670	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300026523\|Ga0209808_1163801	Not Available	826	Open in IMG/M
3300026524\|Ga0209690_1101898	Not Available	1172	Open in IMG/M
3300026528\|Ga0209378_1055148	Not Available	1903	Open in IMG/M
3300027006\|Ga0209896_1037753	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300027873\|Ga0209814_10162027	Not Available	961	Open in IMG/M
3300027873\|Ga0209814_10561500	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300027877\|Ga0209293_10621699	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300027907\|Ga0207428_11262165	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	513	Open in IMG/M
3300027909\|Ga0209382_11297340	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	738	Open in IMG/M
3300027909\|Ga0209382_11441995	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300027910\|Ga0209583_10509835	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300027910\|Ga0209583_10600322	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	560	Open in IMG/M
3300027950\|Ga0209885_1005276	Not Available	1273	Open in IMG/M
3300028597\|Ga0247820_10918222	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	621	Open in IMG/M
3300028673\|Ga0257175_1121308	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10224757	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300031548\|Ga0307408_101773923	Not Available	589	Open in IMG/M
3300031668\|Ga0318542_10124799	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1262	Open in IMG/M
3300031720\|Ga0307469_10719089	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	907	Open in IMG/M
3300031720\|Ga0307469_11627583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	621	Open in IMG/M
3300031720\|Ga0307469_11724071	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	604	Open in IMG/M
3300031720\|Ga0307469_12534274	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	501	Open in IMG/M
3300031740\|Ga0307468_100069024	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae	1952	Open in IMG/M
3300031740\|Ga0307468_100373113	Not Available	1075	Open in IMG/M
3300031740\|Ga0307468_101050942	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300031778\|Ga0318498_10520090	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	523	Open in IMG/M
3300031797\|Ga0318550_10114883	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1277	Open in IMG/M
3300031820\|Ga0307473_10505454	All Organisms → cellular organisms → Bacteria	816	Open in IMG/M
3300031911\|Ga0307412_10410892	Not Available	1105	Open in IMG/M
3300031940\|Ga0310901_10074600	All Organisms → cellular organisms → Bacteria	1170	Open in IMG/M
3300032089\|Ga0318525_10313704	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	805	Open in IMG/M
3300032180\|Ga0307471_101361109	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	871	Open in IMG/M
3300032180\|Ga0307471_101469193	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300032261\|Ga0306920_100096320	All Organisms → cellular organisms → Bacteria	4377	Open in IMG/M
3300032342\|Ga0315286_10246427	All Organisms → cellular organisms → Bacteria	1903	Open in IMG/M
3300032397\|Ga0315287_12768929	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300033433\|Ga0326726_10811398	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	906	Open in IMG/M
3300033513\|Ga0316628_102176220	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	735	Open in IMG/M
3300034668\|Ga0314793_067036	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	692	Open in IMG/M
3300034670\|Ga0314795_047320	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	752	Open in IMG/M
3300034677\|Ga0314802_033861	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	562	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.93%
Host-Associated	Host-Associated	16.07%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	72.62%
Plants	Host-Associated → Plants	16.07%
Aquatic	Environmental → Aquatic	11.31%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	71.43%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.69%
Sediment	Environmental → Aquatic → Sediment	7.14%
Freshwater	Environmental → Aquatic → Freshwater	4.17%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.38%
Peat	Environmental → Terrestrial → Peat	0.60%
Cave	Environmental → Terrestrial → Cave	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	55.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.31%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.14%
Loam	Environmental → Terrestrial → Soil → Loam	7.14%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.76%
Sand	Environmental → Terrestrial → Soil → Sand	4.17%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.38%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.38%
Lake	Environmental → Aquatic → Freshwater → Lake	1.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.19%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.60%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.60%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.60%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	14.29%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.31%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.12%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.76%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	3.57%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.98%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.38%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.79%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.19%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.19%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.19%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.60%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.60%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.60%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.60%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.60%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	12.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	10.12%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.14%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.55%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.95%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.76%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.57%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.98%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.98%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.98%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.38%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.79%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.79%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	1.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.79%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.19%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.19%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.19%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.19%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.19%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.19%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.60%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.60%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.60%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.60%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.60%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.60%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.60%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.60%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.60%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.60%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.60%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	0.60%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.60%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.60%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.60%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002407	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1	Environmental	Open in IMG/M
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005879	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009803	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50	Environmental	Open in IMG/M
3300009817	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20	Environmental	Open in IMG/M
3300009820	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300011432	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300014256	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014496	Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG	Environmental	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014839	Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014883	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D	Environmental	Open in IMG/M
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015254	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental	Open in IMG/M
3300025311	Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes)	Environmental	Open in IMG/M
3300025312	Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4	Environmental	Open in IMG/M
3300025318	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026480	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B	Environmental	Open in IMG/M
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental	Open in IMG/M
3300026524	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300027006	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300027950	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes)	Environmental	Open in IMG/M
3300028597	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14	Environmental	Open in IMG/M
3300028673	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B	Environmental	Open in IMG/M
3300031197 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031940	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300034668	Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034670	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034677	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.18
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.18
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F037393

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1027J12803_1070908171	3300000955	Soil	PASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG*
C687J29651_101407892	3300002407	Soil	DVYDAKTGRIDMHGLQPVGRLAGNQYAHIHDIFEMKRPNENYRG*
JGI25390J43892_100176162	3300002911	Grasslands Soil	LYDAATGRLDMHRLRPVGRLAGNLYTRVHDIFEMKRPNPDYRG*
Ga0066677_107531112	3300005171	Soil	HLHVRDDVYDPASGRLDMHRLRPGGAWLAMYTHVNEVFEMKRPAVDYKG*
Ga0066690_110513022	3300005177	Soil	ATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPDPDYRG*
Ga0066676_104460452	3300005186	Soil	DDVYDPASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVGYKG*
Ga0070676_100082361	3300005328	Miscanthus Rhizosphere	DDIYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMTRPSENYAG*
Ga0070670_1001424151	3300005331	Switchgrass Rhizosphere	IYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG*
Ga0066388_1008388863	3300005332	Tropical Forest Soil	GTGRIDIARLRPVGRLAGNQYAHIHDLFEMKRPNENYKG*
Ga0066388_1025667041	3300005332	Tropical Forest Soil	KTGRIDIHRLQPVGRLAGHQYAHIHDIFEMKRPNENYKG*
Ga0066388_1060375542	3300005332	Tropical Forest Soil	YDAATGRVDMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG*
Ga0070662_1008562931	3300005457	Corn Rhizosphere	VYDAASGRIDMHRLRPVGRLAGNLYSHIHDIFEMKRPSVDYKG*
Ga0070695_1014644321	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	RDDIYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG*
Ga0066695_107966921	3300005553	Soil	RIDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG*
Ga0066661_102313122	3300005554	Soil	DGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG*
Ga0066705_105310301	3300005569	Soil	DVYDPASGRFDMHKLKPVGRLTGNLYSHIHQIFEMKRPNPDYRG*
Ga0068857_1021672981	3300005577	Corn Rhizosphere	PATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG*
Ga0066905_1001258711	3300005713	Tropical Forest Soil	WHVRDDIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG*
Ga0066905_1004298251	3300005713	Tropical Forest Soil	VRDGLYDASTGRIDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG*
Ga0066905_1016889032	3300005713	Tropical Forest Soil	RDDIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG*
Ga0075295_10224002	3300005879	Rice Paddy Soil	DDLYETATGRIDMARLKPVGRLAGHAYAHVHDIFHMKRPSETYAG*
Ga0066656_100862141	3300006034	Soil	DMHRLRPVGRLAGNLYARVHDIFEMKRPNPDYRG*
Ga0075018_104280482	3300006172	Watersheds	GRIDMARLKPVGRLAGHAYAHVHDIFQMKRPSETYAG*
Ga0079222_118126781	3300006755	Agricultural Soil	TGRIDMQRLRPVGRLAGHLYTHVHDLFELKRPAPGYKG*
Ga0066658_102711431	3300006794	Soil	IRDDLYNPSTGRIDMYRLHPVGRLAGNLYTHVHDIFEMKRPVENYAG*
Ga0066659_100610773	3300006797	Soil	DGLYDASTGRIDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG*
Ga0075421_1002734021	3300006845	Populus Rhizosphere	DPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG*
Ga0075425_1017371452	3300006854	Populus Rhizosphere	GRLDMHRLKPVGRLAGQLYTHVHEIFEMKRPSVDYRG*
Ga0075434_1013879172	3300006871	Populus Rhizosphere	NTGRVDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG*
Ga0068865_1014583812	3300006881	Miscanthus Rhizosphere	DLHRLRPVGRLAGNLYSRVHDIFEMKRPTADYRG*
Ga0068865_1015038552	3300006881	Miscanthus Rhizosphere	DLYNLNTGRIDMHKLHPVGRLAGNLYAHVHDIFEMKRPVENYAG*
Ga0079218_121545191	3300007004	Agricultural Soil	DLYDPVTGRLDMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG*
Ga0066710_1007903911	3300009012	Grasslands Soil	RDGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG
Ga0066710_1011915441	3300009012	Grasslands Soil	RDGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNADYRG
Ga0066710_1031232493	3300009012	Grasslands Soil	LDMHALRPVGRLCGNLYSHIHEIFEMKRPNPDYRG
Ga0099828_100896261	3300009089	Vadose Zone Soil	AATGRLDMHRLRPVGRLTGNLYSHIHDIFEMKRPSENYRG*
Ga0105250_101901462	3300009092	Switchgrass Rhizosphere	RIDIRRLQPVGRLAGNQYSHIHDIFEMKRPNENYKG*
Ga0114129_108604961	3300009147	Populus Rhizosphere	DIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG*
Ga0114129_121466112	3300009147	Populus Rhizosphere	GRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG*
Ga0111538_110316781	3300009156	Populus Rhizosphere	DMHELRPVGRLAGNLYSHIHDIFEMKRPNDRYAG*
Ga0105092_103126352	3300009157	Freshwater Sediment	VFDPATGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPAADYKG*
Ga0105241_120781082	3300009174	Corn Rhizosphere	ASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG*
Ga0105248_120690011	3300009177	Switchgrass Rhizosphere	DVYDAATGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPSAAYKG*
Ga0105340_13204842	3300009610	Soil	PTTGRLDMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG*
Ga0126374_102669601	3300009792	Tropical Forest Soil	TGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPVADYRG*
Ga0105065_10142952	3300009803	Groundwater Sand	YDAASGRIDMTRLKPVGRLAGQQYAHVHDIFQMKRPNEDYKG*
Ga0105062_10523292	3300009817	Groundwater Sand	MQFDPRDDLYNPNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG*
Ga0105085_10682541	3300009820	Groundwater Sand	RDDLYNPNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG*
Ga0126312_109125512	3300010041	Serpentine Soil	GRIDMYKLHPVGRLAGELYTHVHDIFEMKRPVENYRG*
Ga0126382_124056492	3300010047	Tropical Forest Soil	NPNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG*
Ga0134070_103377981	3300010301	Grasslands Soil	DIYDAATGRLDMHRLRPVGRLCGNLYTHVHDIFEMKRPGTTYRG*
Ga0134064_101496822	3300010325	Grasslands Soil	IVYFHVRDDIYDAATGRLDMHRLRPVGRLCGNLYTHVHDIFEMKRPGTTYRG*
Ga0126370_123663651	3300010358	Tropical Forest Soil	HVRDDVYDPATGRLDMHRLKPVGRLAGQLYTHVHEIFEMKRPSVGYKG*
Ga0126376_115188172	3300010359	Tropical Forest Soil	YDAKTGRIDIHRLQPVGRLAGHQYAHIHDIFEMTRPNENYKG*
Ga0126377_109362882	3300010362	Tropical Forest Soil	LDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG*
Ga0126377_125742311	3300010362	Tropical Forest Soil	DMHKLKPVGRLAGQLYTHVHEIFEMKRPSVDYRG*
Ga0126377_129684441	3300010362	Tropical Forest Soil	DMHQLHPVGRLAGNLYTHVHDIFEMKRPVENYAG*
Ga0126379_112144621	3300010366	Tropical Forest Soil	GRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG*
Ga0126379_116814502	3300010366	Tropical Forest Soil	DMHGLRPVGRLAGNLYSHIHDIFEMKRPGDRYAG*
Ga0134125_130377671	3300010371	Terrestrial Soil	PSTGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPAADYKG*
Ga0134128_131615981	3300010373	Terrestrial Soil	DVYDAASGRIDMQRLRPVGRLAGHLYTHVHDLFEMKRPAAGYKG*
Ga0105239_118092831	3300010375	Corn Rhizosphere	RDDIYDPATGRLDMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG*
Ga0126381_1022328961	3300010376	Tropical Forest Soil	DDVYDAKTGRIDIHRLQPVGRLAGHQYAHVHDIFEMKRPDENYKG*
Ga0136847_128755801	3300010391	Freshwater Sediment	TGRVDMHRLKPVGRLAGQAYSHINDIFEMKRPVENYGG*
Ga0126383_106336313	3300010398	Tropical Forest Soil	DMHRLRPVGRLAGNLYSHIHDIFEMKRPNENYRG*
Ga0134127_117990471	3300010399	Terrestrial Soil	YDAATGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPSAAYQG*
Ga0134122_100077381	3300010400	Terrestrial Soil	DIYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSESYAG*
Ga0134122_109595621	3300010400	Terrestrial Soil	DMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG*
Ga0124844_12477783	3300010868	Tropical Forest Soil	DVYDAASGRIDMHRLRPVGRLAGNLYSHIHDIFEMKRPATDYKG*
Ga0124844_12483242	3300010868	Tropical Forest Soil	VYDAASGRIDMHRLRPVGRLAGNLYSHIHDIFEMKRPATDYKG*
Ga0137428_10221193	3300011432	Soil	DLYDAASGRIDLHRLRPVGRLAGNLYSRVHDIFEMKRPSADYRG*
Ga0137388_105946991	3300012189	Vadose Zone Soil	PPRESMDRLRPVGRLCGNLYTHVHIFEMKRPGANYRG*
Ga0137388_106626021	3300012189	Vadose Zone Soil	QWHVRDDVYDAATGRLDMHRLRPVGRLTGNLYSHIHDIFAMKRPSENYRG*
Ga0137382_102365573	3300012200	Vadose Zone Soil	HLRDDVYDPASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVNYKG*
Ga0137377_104052041	3300012211	Vadose Zone Soil	SGRLDMHRLQPVGRLAGHLYTHVHEIFEMKRPSVNYTG*
Ga0137387_108932372	3300012349	Vadose Zone Soil	YETATGRIDMARLKPVGRLAGHAYTHVHDIFQTKRPSETYAG*
Ga0137386_100541574	3300012351	Vadose Zone Soil	PNPGRINMHRVHPVGRLAGNLYTHVHDMFEMKRPLENRGG*
Ga0137358_104146802	3300012582	Vadose Zone Soil	LYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG*
Ga0137397_100632874	3300012685	Vadose Zone Soil	ATGRIDVARLKPVGRLAGHQYSYIHEIFEMKRPNEHYRG*
Ga0137396_104715211	3300012918	Vadose Zone Soil	TGRIDMARLKPVGRLAGHAYTHVHDIFQMKRPSETYAG*
Ga0137394_100568981	3300012922	Vadose Zone Soil	ATGRIDMTRLRPVGRLAGHAYTHVHDIFQMKRPSETYAG*
Ga0137359_115456212	3300012923	Vadose Zone Soil	RLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG*
Ga0137419_116531052	3300012925	Vadose Zone Soil	RDGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG*
Ga0137407_108036871	3300012930	Vadose Zone Soil	GRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG*
Ga0153915_118209652	3300012931	Freshwater Wetlands	RIDMHRLKPVGRLAGQLYAHVHDIFVMKRPDPHYAG*
Ga0137410_100226221	3300012944	Vadose Zone Soil	ATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG*
Ga0137410_115409682	3300012944	Vadose Zone Soil	DVYDPKSGRLDMHQLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG*
Ga0126375_101743081	3300012948	Tropical Forest Soil	DAQTGRIDMHRLRPVGRLAGNLYTHVHDIFEMKRPAANYRG*
Ga0134087_101246432	3300012977	Grasslands Soil	LYDAATGRIDLRRLRPVGRLAGNLYTHVHDIFEMKRPNANYRG*
Ga0157370_117877341	3300013104	Corn Rhizosphere	DYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG*
Ga0075318_11261112	3300014256	Natural And Restored Wetlands	DMRRLKPVGRLAGHLYTHVHDIFEMKRPAVDYKG*
Ga0157380_110895063	3300014326	Switchgrass Rhizosphere	IYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMTRPSENYAG*
Ga0182011_109372751	3300014496	Fen	TGRIDMRRLKPVGRLAGEMYTHVHDLFEMKRPVSGYSG*
Ga0182021_102737161	3300014502	Fen	IDMRRLKPVGRLAGEMYTHVHDLFEMKRPVSDYAG*
Ga0182027_110334531	3300014839	Fen	FRDDLYDPGTGRIDMRRLKPVGRLAGEMYTHVHDLFEMKRPVSGYSG*
Ga0180086_11862153	3300014883	Soil	AATGRLDMHRLRPVGRLTGNLYSHIHDIFEMKRPSADYRG*
Ga0137405_11383921	3300015053	Vadose Zone Soil	IVYVHVRDGLYDAATGRLDMHRLRGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNADYRG*
Ga0137409_110597082	3300015245	Vadose Zone Soil	DDVYDAATGRLDMHRLRPVGRLTGNLYSHIHDIFEMKRPSENYRG*
Ga0180089_10378142	3300015254	Soil	DVYDAATGRIDMARLKPVGRLAGHQYTYVHDIFEMKRPNENYRG*
Ga0137403_100527101	3300015264	Vadose Zone Soil	VYDAATGRIDIARLKPVGRLAGHQYSYIHDIFEMKRPNENYKG*
Ga0137403_102042931	3300015264	Vadose Zone Soil	VYDAATGRIDIARLKPVGRLAGHQYSYIHEIFEMKRPNENYKG*
Ga0132256_1023493272	3300015372	Arabidopsis Rhizosphere	RDDIYDSRTGRVDMHRLRPVGRLAGHQYAHVHDIFEMKRPSESYRG*
Ga0184610_11532782	3300017997	Groundwater Sediment	DLYNPRTGRIDMHKFHPVGRLAGNLYTHVHDIFEMKRPVENYAG
Ga0184604_103681472	3300018000	Groundwater Sediment	AATGRIDITRLKPVGRLAGHQYAHIHDIFEMKRPNENYKG
Ga0187787_100872851	3300018029	Tropical Peatland	GRIDMARLRPVGRLAGHQYTHVHDIFQMKRPSETYAG
Ga0187766_111553422	3300018058	Tropical Peatland	DVYDPATGRIDMHRLRPLARLAGQQYAHVHDIFEMKRPNEHYAG
Ga0184615_102603841	3300018059	Groundwater Sediment	ATGRIDMRRLRPVGRLAGHQYTHVHDIFEMRRPAVDYKG
Ga0184619_102860072	3300018061	Groundwater Sediment	VYDATTGRIDMRRLRPVGRLAGHQYTHVHDIFEMKRPAVDYKG
Ga0184612_105059091	3300018078	Groundwater Sediment	ATGRVDIARLKPVGRLAGHQYTYVHDIFEMKRPNEHYRG
Ga0066667_119172821	3300018433	Grasslands Soil	VRDDVYDPASGRFDMHKLKPVGRLTGNLYSHIHQIFEMKRPNPDYRG
Ga0066662_125008161	3300018468	Grasslands Soil	DVYDPASGRLDMHRLQPVGRLAGHLYTHVHEIFEMKRPSVNYKG
Ga0187893_107997131	3300019487	Microbial Mat On Rocks	DDLYNTNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG
Ga0193723_11364602	3300019879	Soil	GRIDIARLKPVGRLAGHQYSYIHEIFEMKRPNENYKG
Ga0179594_100869932	3300020170	Vadose Zone Soil	ATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNADYRG
Ga0196963_105301051	3300020215	Soil	AATGRVDMHRLAPVGRLAGHMYTHVHDIFVMKRPNEHYAG
Ga0209343_108093331	3300025311	Groundwater	DVYDAKTGRIDMHGLQPVGRLAGNQYAHIHDIFEMKRPNENYRG
Ga0209321_102054281	3300025312	Soil	KTGRIDMHGLQPVGRLAGNQYAHIHDIFEMKRPNENYRG
Ga0209519_101315821	3300025318	Soil	TTGRIDLHRLRPVGRLAGNLYTHVHDIFEMKRPVAGYRG
Ga0207653_103213452	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	ATGRLDMHRLRPIGRLAGNLYSHIHEIFEMKRPVDNYRG
Ga0207648_119170681	3300026089	Miscanthus Rhizosphere	LDMHALKPVGRLCGNLYSHIHQIFEMKRPSASYRG
Ga0209438_10809531	3300026285	Grasslands Soil	TGRIDVARLKPVGRLAGHQYSYIHEIFEMKRPNENYKG
Ga0209154_10429473	3300026317	Soil	VYFHVRDDIYDAATGRLDMHRLRPVGRLCGNLYTHVHDIFEMKRPGTTYRG
Ga0209687_12718051	3300026322	Soil	VRDGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG
Ga0209472_12071892	3300026323	Soil	IDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG
Ga0209470_11582041	3300026324	Soil	QWHVRDDIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG
Ga0209804_13227441	3300026335	Soil	DGLYDAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG
Ga0257177_10776701	3300026480	Soil	RDDIYDAATGRLDMHRLRPVGRLCGNLYTHVHDIFEMKRPGANYRG
Ga0209808_11638011	3300026523	Soil	LDMHRLRPVGRLAGNLYTHVHDIFEMKRPNPDYRG
Ga0209690_11018981	3300026524	Soil	DGLYDASTGRIDLHRLHPVGRLAGNLYTHVHDIFEMKRPSAHYRG
Ga0209378_10551481	3300026528	Soil	DAATGRLDMHRLRPVGRLAGNLYTHVHDIFEMKRPNANYRG
Ga0209896_10377531	3300027006	Groundwater Sand	MQFDPRDDLYNPNTGRIDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG
Ga0209814_101620271	3300027873	Populus Rhizosphere	LYDPVTGRVDMHRLCPVGRLAGNLYTHVHDIFEMKRPSADYRG
Ga0209814_105615002	3300027873	Populus Rhizosphere	IVHLHLRDDVYDPARGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG
Ga0209293_106216991	3300027877	Wetland	GRVDMHRLKPVGRLAGEMYTHVHDLFELKRPVANYLG
Ga0207428_112621652	3300027907	Populus Rhizosphere	IRDDLYNPNTGRVDMHKLHPVGRLAGNLYTHVHDIFEMKRPVENYAG
Ga0209382_112973402	3300027909	Populus Rhizosphere	ATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG
Ga0209382_114419953	3300027909	Populus Rhizosphere	IYDPATGRIHMARLKPVGRLAGHAYAHVHDIFEMKRPSENYAG
Ga0209583_105098352	3300027910	Watersheds	TGRIDMARLKPVGRLAGHAYTHVHDIFHMKRPSETYAG
Ga0209583_106003222	3300027910	Watersheds	YNPNTGRIDMHKLHPVGCLAGNLYTHVHDIFEMKRPVENYAG
Ga0209885_10052763	3300027950	Groundwater Sand	YDAASGRIDMTRLKPVGRLAGQQYAHVHDIFQMKRPNEDYKG
Ga0247820_109182221	3300028597	Soil	PNTGRIDMYKLRPVGRLAGNLYTHVHDIFEMKRPVGNYAG
Ga0257175_11213082	3300028673	Soil	TGRIDMARLKPVGRLAGHAYTHVHDIFQMKRPSETYAG
(restricted) Ga0255310_102247572	3300031197	Sandy Soil	DLYEAATGRIDMARLKPVGRLAGHAYAHVHDIFQMKRPSESYAG
Ga0307408_1017739231	3300031548	Rhizosphere	PQTGRIDMYNLHPVGRLAGELYTHVQDIFEMKRPVEHYAG
Ga0318542_101247991	3300031668	Soil	QLHFRDDVYDPTTGRLDMHRLRPVGRLAGQLYTHVHDIFEMKRPAADYRG
Ga0307469_107190891	3300031720	Hardwood Forest Soil	VRDDIYDAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG
Ga0307469_116275832	3300031720	Hardwood Forest Soil	DVYDAASGRIDMHRLRPVGRLAGNLYSHIHDIFEMKRPSTDYKG
Ga0307469_117240712	3300031720	Hardwood Forest Soil	LHVRDDVYDPASGRLDMHRLRPVGHLAGHLYTHVHEIFEMKRPAVDYRA
Ga0307469_125342741	3300031720	Hardwood Forest Soil	RLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG
Ga0307468_1000690243	3300031740	Hardwood Forest Soil	LDMHRLRPVGRLAGQLYTHVHEIFEMKRPSVDYRG
Ga0307468_1003731131	3300031740	Hardwood Forest Soil	AATGRIDVGRLKPVGRLAGHQYAYIHDIFEMKRPNENYRG
Ga0307468_1010509422	3300031740	Hardwood Forest Soil	VREDLYDAGSGRIDLHRLRPVGRLAGNLYSRVHDIFEMKRPTADYRG
Ga0318498_105200902	3300031778	Soil	AKTGRIDVHRLQPVGRLAGHQYAHIHDIFEMKRPDENYKG
Ga0318550_101148831	3300031797	Soil	YDPTTGRLDMHRLRPVGRLAGQLYTHVHDIFEMKRPAADYRG
Ga0307473_105054542	3300031820	Hardwood Forest Soil	SGRIDMTRLRPVGRLAGHAYTHVHDIFQMKRPSETYAG
Ga0307412_104108922	3300031911	Rhizosphere	HVRDDVYDAATGRLDMERLRPVGRLCGNLYSHIHQIFEMKRPSPDYRG
Ga0310901_100746003	3300031940	Soil	PATGRLDMHRLKPVGRLAGHLYTHVHDIFEMKRPAVDYKG
Ga0318525_103137041	3300032089	Soil	LDMHRLRPVGRLAGQLYTHVHDIFEMKRPAADYRG
Ga0307471_1013611091	3300032180	Hardwood Forest Soil	DAATGRLDMHRLRPVGRLTGNLYSHIHQIFEMKRPSANYRG
Ga0307471_1014691931	3300032180	Hardwood Forest Soil	DDVYDPASGRLDMHRLRPVGRLAGHLYTHVHEIFEMKRPAVDYKG
Ga0306920_1000963204	3300032261	Soil	LHVRDEVYDPATGRLDMHRLRPVGRLAGQLYTHVHDIFEMKRPAADYRG
Ga0315286_102464273	3300032342	Sediment	DAKTGRIDIHRLQPVGRLAGNQYSHIHDIFEMKRPNENYKG
Ga0315287_127689291	3300032397	Sediment	FRDDLYDPKTGRIDMKGLKPVGRLAGEMYTHVHDLFEMKRPVADYPG
Ga0326726_108113982	3300033433	Peat Soil	RVDMQRLKPVGRLAGEMYTHVHDLFEMQRPDANYAG
Ga0316628_1021762202	3300033513	Soil	LYETSTGRIDMARLKPVGRLAGHAYTHVHDIFQMKRPSETYPG
Ga0314793_067036_186_338	3300034668	Soil	MAKHNSRVYNLNTGRIDMHKLHPVGRLAGNLYAHVHDIFEMKRPVENYAG
Ga0314795_047320_1_135	3300034670	Soil	DLYNPNTGRIDMYKLCPVGRLAGNLYTHVHDIFEMKRPGENYAG
Ga0314802_033861_2_118	3300034677	Soil	TGRVDMYKLHPVGRLAGNLYTHVHDIFEMKRPGENYAG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign