| Basic Information | |
|---|---|
| Family ID | F037386 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.81 % |
| % of genes from short scaffolds (< 2000 bps) | 89.88 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.738 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.381 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.00% β-sheet: 0.00% Coil/Unstructured: 72.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF00248 | Aldo_ket_red | 49.40 |
| PF02776 | TPP_enzyme_N | 9.52 |
| PF02775 | TPP_enzyme_C | 5.95 |
| PF07690 | MFS_1 | 2.38 |
| PF00563 | EAL | 1.79 |
| PF07715 | Plug | 1.19 |
| PF00990 | GGDEF | 1.19 |
| PF00801 | PKD | 1.19 |
| PF08281 | Sigma70_r4_2 | 1.19 |
| PF00293 | NUDIX | 1.19 |
| PF13426 | PAS_9 | 1.19 |
| PF03795 | YCII | 1.19 |
| PF00149 | Metallophos | 1.19 |
| PF03466 | LysR_substrate | 0.60 |
| PF09351 | DUF1993 | 0.60 |
| PF02518 | HATPase_c | 0.60 |
| PF13533 | Biotin_lipoyl_2 | 0.60 |
| PF02321 | OEP | 0.60 |
| PF00324 | AA_permease | 0.60 |
| PF10091 | Glycoamylase | 0.60 |
| PF01850 | PIN | 0.60 |
| PF01431 | Peptidase_M13 | 0.60 |
| PF09900 | DUF2127 | 0.60 |
| PF00270 | DEAD | 0.60 |
| PF05899 | Cupin_3 | 0.60 |
| PF01522 | Polysacc_deac_1 | 0.60 |
| PF04542 | Sigma70_r2 | 0.60 |
| PF03129 | HGTP_anticodon | 0.60 |
| PF00199 | Catalase | 0.60 |
| PF00106 | adh_short | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.79 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.79 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.79 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.79 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.19 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.19 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.60 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.60 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.60 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.60 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.60 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.60 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.60 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.60 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.60 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.74 % |
| Unclassified | root | N/A | 42.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002909|JGI25388J43891_1041103 | Not Available | 712 | Open in IMG/M |
| 3300002911|JGI25390J43892_10012462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1996 | Open in IMG/M |
| 3300002915|JGI25387J43893_1004519 | Not Available | 1808 | Open in IMG/M |
| 3300004091|Ga0062387_100410061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300005332|Ga0066388_106463325 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005334|Ga0068869_100304589 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300005363|Ga0008090_10010685 | Not Available | 853 | Open in IMG/M |
| 3300005439|Ga0070711_101118723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300005444|Ga0070694_100272910 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300005454|Ga0066687_10164638 | Not Available | 1184 | Open in IMG/M |
| 3300005459|Ga0068867_100280246 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300005468|Ga0070707_102243516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 513 | Open in IMG/M |
| 3300005541|Ga0070733_11073434 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005542|Ga0070732_10288421 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005542|Ga0070732_10695237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 619 | Open in IMG/M |
| 3300005556|Ga0066707_10331901 | Not Available | 995 | Open in IMG/M |
| 3300005564|Ga0070664_100967177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300005569|Ga0066705_10655534 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300006032|Ga0066696_10073099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1992 | Open in IMG/M |
| 3300006041|Ga0075023_100158440 | Not Available | 841 | Open in IMG/M |
| 3300006041|Ga0075023_100369115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300006173|Ga0070716_100017564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3711 | Open in IMG/M |
| 3300006173|Ga0070716_101254662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300006173|Ga0070716_101331043 | Not Available | 582 | Open in IMG/M |
| 3300006755|Ga0079222_11445584 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300006804|Ga0079221_10842022 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006954|Ga0079219_11695841 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009029|Ga0066793_10548010 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009038|Ga0099829_11199795 | Not Available | 628 | Open in IMG/M |
| 3300009098|Ga0105245_10030873 | Not Available | 4739 | Open in IMG/M |
| 3300010159|Ga0099796_10586488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 502 | Open in IMG/M |
| 3300010321|Ga0134067_10111860 | Not Available | 944 | Open in IMG/M |
| 3300010326|Ga0134065_10459874 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010333|Ga0134080_10615306 | Not Available | 530 | Open in IMG/M |
| 3300010360|Ga0126372_12241807 | Not Available | 596 | Open in IMG/M |
| 3300010366|Ga0126379_11627769 | Not Available | 751 | Open in IMG/M |
| 3300010366|Ga0126379_12078270 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300010373|Ga0134128_10752415 | Not Available | 1081 | Open in IMG/M |
| 3300010375|Ga0105239_12348664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 621 | Open in IMG/M |
| 3300010376|Ga0126381_100664604 | Not Available | 1488 | Open in IMG/M |
| 3300010376|Ga0126381_104418497 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010398|Ga0126383_11120571 | Not Available | 876 | Open in IMG/M |
| 3300011120|Ga0150983_14864280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| 3300011270|Ga0137391_10373863 | Not Available | 1222 | Open in IMG/M |
| 3300012096|Ga0137389_10104514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2257 | Open in IMG/M |
| 3300012202|Ga0137363_10218221 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300012202|Ga0137363_11303593 | Not Available | 615 | Open in IMG/M |
| 3300012210|Ga0137378_11199347 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012903|Ga0157289_10177501 | Not Available | 678 | Open in IMG/M |
| 3300012918|Ga0137396_10377524 | Not Available | 1050 | Open in IMG/M |
| 3300012927|Ga0137416_11859902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 551 | Open in IMG/M |
| 3300012929|Ga0137404_10128045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2085 | Open in IMG/M |
| 3300012944|Ga0137410_10526596 | Not Available | 969 | Open in IMG/M |
| 3300012986|Ga0164304_11107578 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012988|Ga0164306_10335999 | Not Available | 1114 | Open in IMG/M |
| 3300013306|Ga0163162_10686995 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300014325|Ga0163163_11152371 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300014495|Ga0182015_10090872 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300014968|Ga0157379_10631084 | Not Available | 1002 | Open in IMG/M |
| 3300015054|Ga0137420_1077061 | Not Available | 523 | Open in IMG/M |
| 3300015054|Ga0137420_1381449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2471 | Open in IMG/M |
| 3300015245|Ga0137409_10066193 | All Organisms → cellular organisms → Bacteria | 3390 | Open in IMG/M |
| 3300015245|Ga0137409_10562135 | Not Available | 968 | Open in IMG/M |
| 3300015374|Ga0132255_100385127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2038 | Open in IMG/M |
| 3300016294|Ga0182041_10463369 | Not Available | 1091 | Open in IMG/M |
| 3300016341|Ga0182035_10629007 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300016357|Ga0182032_10726562 | Not Available | 835 | Open in IMG/M |
| 3300016371|Ga0182034_10335028 | Not Available | 1224 | Open in IMG/M |
| 3300016387|Ga0182040_10362622 | Not Available | 1127 | Open in IMG/M |
| 3300017937|Ga0187809_10016949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2346 | Open in IMG/M |
| 3300017972|Ga0187781_11211789 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018058|Ga0187766_10141602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1487 | Open in IMG/M |
| 3300018482|Ga0066669_10137876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1771 | Open in IMG/M |
| 3300019789|Ga0137408_1182236 | Not Available | 644 | Open in IMG/M |
| 3300020150|Ga0187768_1027129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → unclassified Rhizobiaceae → Rhizobiaceae bacterium | 1239 | Open in IMG/M |
| 3300020581|Ga0210399_10638218 | Not Available | 879 | Open in IMG/M |
| 3300021180|Ga0210396_10794398 | Not Available | 812 | Open in IMG/M |
| 3300021362|Ga0213882_10238112 | Not Available | 754 | Open in IMG/M |
| 3300021406|Ga0210386_10453139 | Not Available | 1108 | Open in IMG/M |
| 3300021420|Ga0210394_11332995 | Not Available | 612 | Open in IMG/M |
| 3300021559|Ga0210409_10235961 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300021560|Ga0126371_11295894 | Not Available | 862 | Open in IMG/M |
| 3300021560|Ga0126371_11503331 | Not Available | 802 | Open in IMG/M |
| 3300024182|Ga0247669_1043305 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300025898|Ga0207692_10259322 | Not Available | 1044 | Open in IMG/M |
| 3300025906|Ga0207699_10230084 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300025909|Ga0207705_11525219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 505 | Open in IMG/M |
| 3300025922|Ga0207646_11861697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 513 | Open in IMG/M |
| 3300025934|Ga0207686_10435900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 1005 | Open in IMG/M |
| 3300025942|Ga0207689_10294159 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300025949|Ga0207667_11459368 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300026041|Ga0207639_10544361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
| 3300026088|Ga0207641_11502047 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300026318|Ga0209471_1203922 | Not Available | 749 | Open in IMG/M |
| 3300026333|Ga0209158_1218181 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300026530|Ga0209807_1316319 | Not Available | 530 | Open in IMG/M |
| 3300027635|Ga0209625_1065126 | Not Available | 815 | Open in IMG/M |
| 3300027795|Ga0209139_10178530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300027821|Ga0209811_10427862 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027824|Ga0209040_10445935 | Not Available | 590 | Open in IMG/M |
| 3300027842|Ga0209580_10219441 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300027867|Ga0209167_10125511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1331 | Open in IMG/M |
| 3300027903|Ga0209488_10890341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 625 | Open in IMG/M |
| 3300028808|Ga0302228_10114346 | Not Available | 1258 | Open in IMG/M |
| 3300029984|Ga0311332_11029486 | Not Available | 661 | Open in IMG/M |
| 3300029992|Ga0302276_10373394 | Not Available | 596 | Open in IMG/M |
| 3300030737|Ga0302310_10021008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4479 | Open in IMG/M |
| 3300031057|Ga0170834_107381350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2460 | Open in IMG/M |
| 3300031231|Ga0170824_101488816 | Not Available | 1211 | Open in IMG/M |
| 3300031231|Ga0170824_101748683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 551 | Open in IMG/M |
| 3300031231|Ga0170824_103553941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 629 | Open in IMG/M |
| 3300031231|Ga0170824_127704116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1960 | Open in IMG/M |
| 3300031231|Ga0170824_128942928 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300031233|Ga0302307_10211420 | Not Available | 1000 | Open in IMG/M |
| 3300031258|Ga0302318_10407501 | Not Available | 686 | Open in IMG/M |
| 3300031561|Ga0318528_10072355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1776 | Open in IMG/M |
| 3300031561|Ga0318528_10605026 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031640|Ga0318555_10092630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1585 | Open in IMG/M |
| 3300031680|Ga0318574_10772633 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031712|Ga0265342_10474990 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031719|Ga0306917_10532165 | Not Available | 923 | Open in IMG/M |
| 3300031719|Ga0306917_11045974 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031723|Ga0318493_10050552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1965 | Open in IMG/M |
| 3300031736|Ga0318501_10084113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1560 | Open in IMG/M |
| 3300031740|Ga0307468_100103750 | Not Available | 1699 | Open in IMG/M |
| 3300031748|Ga0318492_10250476 | Not Available | 915 | Open in IMG/M |
| 3300031751|Ga0318494_10245516 | Not Available | 1026 | Open in IMG/M |
| 3300031754|Ga0307475_10026463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4152 | Open in IMG/M |
| 3300031754|Ga0307475_11115468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 617 | Open in IMG/M |
| 3300031754|Ga0307475_11504988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 516 | Open in IMG/M |
| 3300031764|Ga0318535_10208805 | Not Available | 873 | Open in IMG/M |
| 3300031765|Ga0318554_10075215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1877 | Open in IMG/M |
| 3300031765|Ga0318554_10284930 | Not Available | 940 | Open in IMG/M |
| 3300031768|Ga0318509_10029656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2655 | Open in IMG/M |
| 3300031770|Ga0318521_10989517 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031771|Ga0318546_11331031 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031777|Ga0318543_10409745 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031778|Ga0318498_10254327 | Not Available | 792 | Open in IMG/M |
| 3300031779|Ga0318566_10082554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1563 | Open in IMG/M |
| 3300031781|Ga0318547_10254134 | Not Available | 1060 | Open in IMG/M |
| 3300031781|Ga0318547_10505699 | Not Available | 746 | Open in IMG/M |
| 3300031792|Ga0318529_10551538 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031793|Ga0318548_10299866 | Not Available | 789 | Open in IMG/M |
| 3300031793|Ga0318548_10305521 | Not Available | 781 | Open in IMG/M |
| 3300031797|Ga0318550_10280577 | Not Available | 808 | Open in IMG/M |
| 3300031799|Ga0318565_10148524 | Not Available | 1136 | Open in IMG/M |
| 3300031823|Ga0307478_10344040 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300031823|Ga0307478_11206184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300031833|Ga0310917_10491904 | Not Available | 835 | Open in IMG/M |
| 3300031845|Ga0318511_10123013 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300031893|Ga0318536_10048220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2050 | Open in IMG/M |
| 3300031893|Ga0318536_10269454 | Not Available | 865 | Open in IMG/M |
| 3300031896|Ga0318551_10215565 | Not Available | 1066 | Open in IMG/M |
| 3300031947|Ga0310909_10046780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3303 | Open in IMG/M |
| 3300032009|Ga0318563_10042421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2314 | Open in IMG/M |
| 3300032009|Ga0318563_10268956 | Not Available | 921 | Open in IMG/M |
| 3300032009|Ga0318563_10469199 | Not Available | 680 | Open in IMG/M |
| 3300032010|Ga0318569_10215210 | Not Available | 891 | Open in IMG/M |
| 3300032018|Ga0315272_10155816 | Not Available | 1076 | Open in IMG/M |
| 3300032043|Ga0318556_10225710 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300032065|Ga0318513_10494462 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300032076|Ga0306924_10082089 | Not Available | 3615 | Open in IMG/M |
| 3300032091|Ga0318577_10365950 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300032094|Ga0318540_10111660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1292 | Open in IMG/M |
| 3300032180|Ga0307471_100585857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1273 | Open in IMG/M |
| 3300033289|Ga0310914_11483373 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300033290|Ga0318519_10371486 | Not Available | 848 | Open in IMG/M |
| 3300034163|Ga0370515_0106113 | Not Available | 1211 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.19% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.19% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.60% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.60% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.60% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.60% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25388J43891_10411031 | 3300002909 | Grasslands Soil | AVALPPRHLLRPDMDEAAEGQRLAAFLAGYDLPAEEQRRWRV* |
| JGI25390J43892_100124623 | 3300002911 | Grasslands Soil | LRHRGVALPPRYLVCPEVDAVAEGQRFAAFLAGYDLPAEEQRRWRV* |
| JGI25387J43893_10045191 | 3300002915 | Grasslands Soil | ALPPRYLVRPQVDAVAEAQRFAAFLAGYDLPAEEQRRWRV* |
| Ga0062387_1004100612 | 3300004091 | Bog Forest Soil | RGLAALLRHRGVKLPPRHLIRRDAEAATEGRRFTEFLSGYDLPATEQRRWRV* |
| Ga0066388_1064633252 | 3300005332 | Tropical Forest Soil | LHWRRLAPLLRHRGVALPPRHIIRPDLDAAVERQRLAAFLTGYDLPVEEQRRWRV* |
| Ga0068869_1003045892 | 3300005334 | Miscanthus Rhizosphere | HWRRLAPLLRNRGVVPPPRHLIRPDVDTTAQGQRLAAFLAGYDLPESEQRRWRV* |
| Ga0008090_100106852 | 3300005363 | Tropical Rainforest Soil | GLHWRRLAPLLRHRGVTLPPRHVIRPDLDAGAEGQRLAAFLSSYDLPLEEQRRWRV* |
| Ga0070711_1011187231 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | APLLRHRGIALPPRHIIRPDVDAAAEGQRLARWLDAYDLPVEEQQRWR* |
| Ga0070694_1002729102 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EPGNGLHWRRLAPLLRNRGVVPPPRHLIRPDVDTTAQGQRLAAFLAGYDLPEAEQRRWRV |
| Ga0066687_101646381 | 3300005454 | Soil | GEGLHWRRLAPLLRHRGVALPPRYLVCPEVDAVAEGQRFAAFLAGYDLPAEEQRRWRV* |
| Ga0068867_1002802462 | 3300005459 | Miscanthus Rhizosphere | PPPRHLIRPDVDTSDQGQRLAAFLAGYDLPEAEQRRWRV* |
| Ga0070707_1022435162 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GLHWRRLAPLLRHRGVALPPRYIVRPDVDAAFEGQRLAALLANYDLPVEEQHRWRV* |
| Ga0070733_110734342 | 3300005541 | Surface Soil | LLRHRRVALPPRHLIRAEVDAAVEARRLAAFLAGYDLPLEEQRRWRV* |
| Ga0070732_102884211 | 3300005542 | Surface Soil | APLLRHRGVALPPRHLLRPEAPATAEGQRLANFLTGYDLPAEQQRRWRV* |
| Ga0070732_106952372 | 3300005542 | Surface Soil | MALPPRYLVRPELDPATEGYRFAAFLAGYDLPMEEQRRWRV* |
| Ga0066707_103319012 | 3300005556 | Soil | VALPPRHLIRPDVDAAAEAKRLAAFLADYDLPVEEQRRWRV* |
| Ga0070664_1009671772 | 3300005564 | Corn Rhizosphere | HWRRLAPLLRHRGIALPPRHIIRPDVDAAAEGQRLARWLDAYDLPVEEQQRWR* |
| Ga0066705_106555341 | 3300005569 | Soil | RHRAVALPPRHLLRPDMDEAAQRQRLAAFLADYDLPAEEQRRWRV* |
| Ga0066696_100730991 | 3300006032 | Soil | LAPLLRHRGVALPPRYLVCPEVDAVAEGQRFATFLAGYDLPAEEQRRWRV* |
| Ga0075023_1001584401 | 3300006041 | Watersheds | HWRRLAPLLRHRSVALPPRHIVRGDVDATLEAQRLVALLVSYDLPECERRRWRV* |
| Ga0075023_1003691152 | 3300006041 | Watersheds | HWRRLAPLLRHRGVALPPRHILRPDVDAALEGQRLAALLGKYDLPVEEQRRWRV* |
| Ga0070716_1000175644 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RLARLLQHRGVALPPRHLLRSRADARAEGERLAAFLAGYDLPVEEQRRWRV* |
| Ga0070716_1012546622 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PLLRHRGLALPPRHLIRPDVDAASEGQKLAVFLSDYDLPPEEQHRWRV* |
| Ga0070716_1013310432 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GLHWRRLAPLLRHRGVALPPRHLIRPDVDAALEGQRLAGFLAGYDLPLEEQRRWRV* |
| Ga0079222_114455841 | 3300006755 | Agricultural Soil | RPCCDTAASLPPRHIIRPELDATAEGERLTAFLSEYDLPLEERRRWRV* |
| Ga0079221_108420221 | 3300006804 | Agricultural Soil | GVALPPRHIVRQDGDVALESQRLAAFLANYDLPAEEQRRWRV* |
| Ga0079219_116958412 | 3300006954 | Agricultural Soil | PRHLIRPEVDAAAEAQRLAAFLTGYDLPVQEQRRWRV* |
| Ga0066793_105480101 | 3300009029 | Prmafrost Soil | LPPRHLIRPAVDAAIERQQLAAFLVDYDLPVEEQSRWRV* |
| Ga0099829_111997951 | 3300009038 | Vadose Zone Soil | RHLIRPDVDAATEGQRFAAFLSGYDLPVEEQRRWRV* |
| Ga0105245_100308734 | 3300009098 | Miscanthus Rhizosphere | RGVAPPPRHLIRPDVDTTAQGQRLAAFLSGYDLPEAEQRRWRV* |
| Ga0099796_105864881 | 3300010159 | Vadose Zone Soil | ALPPRHLIRPDVDAAAEGQRLADFLSGYDLPVEEQRRWRV* |
| Ga0134067_101118602 | 3300010321 | Grasslands Soil | GVALPPRYLVRPQVDAVAEGQRFAAFLAGYDLPAEEQRRWRV* |
| Ga0134065_104598742 | 3300010326 | Grasslands Soil | WRRLAPLLRHRAVALPPRHLLRPDMDEAAQRQRLAAFLADYDLPAEEQRRWRV* |
| Ga0134080_106153061 | 3300010333 | Grasslands Soil | RYFVCPEVDAVAEGQRFAAFLAGYDLPAEEQRRWRV* |
| Ga0126372_122418072 | 3300010360 | Tropical Forest Soil | ALPPRHLVSPDVDAAVEGERLAAFLAGYDLPVAEQRRWRV* |
| Ga0126379_116277692 | 3300010366 | Tropical Forest Soil | PPRHIIRPDLDAAAEGQRLAVFLSGYDLPVEEQRRWRV* |
| Ga0126379_120782701 | 3300010366 | Tropical Forest Soil | PRHLLRSRADAGAEGERLATFLADYDLPVEEQRRWRV* |
| Ga0134128_107524152 | 3300010373 | Terrestrial Soil | LPPRHIIRPDIDAVLEAQRLAALLAGYDLPVEEQQRWRV* |
| Ga0105239_123486642 | 3300010375 | Corn Rhizosphere | MPGNGLHWRRLAPLLRHRGIALPPRHIIRPDVDAAAEGQRLARWLDAYDLPVEEQQRWR* |
| Ga0126381_1006646043 | 3300010376 | Tropical Forest Soil | PLLRHRGAALPPRHIIRTDIDAAAETQRLSAFLADYDLPPEEQRRWRV* |
| Ga0126381_1044184972 | 3300010376 | Tropical Forest Soil | VAPPPRHLIRTDADAATETRRLGEFLASYDLPVEEQRRWRV* |
| Ga0126383_111205711 | 3300010398 | Tropical Forest Soil | RRGVALPPRHLLRSKADARAEGERLANFLADYDLPVEEQRRWRV* |
| Ga0150983_148642801 | 3300011120 | Forest Soil | RPRHLIRADAGAAAEARRLAEFLGGYDLPVEEQRRWRV* |
| Ga0137391_103738632 | 3300011270 | Vadose Zone Soil | PLLRHRGVALPPRHLIRPDVDAATEGQRFAAFLSGYDLPVEEQRRWRV* |
| Ga0137389_101045141 | 3300012096 | Vadose Zone Soil | RLAPLLRHRGAALPPRHFIRPDVDAAAEGQRFAVFLSGYDLPVEEQRRWRV* |
| Ga0137363_102182214 | 3300012202 | Vadose Zone Soil | LHWRRLAPLLRHRGVALPPRHLIRPDVDAAAEAKRLAAFLADYDLPVEEQRRWRV* |
| Ga0137363_113035931 | 3300012202 | Vadose Zone Soil | PRYLVRPELDAAAEGQRFAAFLAGYDLPAEEQRRWRV* |
| Ga0137378_111993472 | 3300012210 | Vadose Zone Soil | GGLHWRGLAPLLRHRGVALPPRHLIRPGVDAAAEGQRLAGFLSGYDLPVEEQRRWRV* |
| Ga0157289_101775011 | 3300012903 | Soil | HIIRPDVDAAAEQERLATWLNNYDLPVEEQQRWR* |
| Ga0137396_103775241 | 3300012918 | Vadose Zone Soil | PLLRHRGVALPPRYLVRPELDAAAEGQRFAAFLAGYDLPAE* |
| Ga0137416_118599021 | 3300012927 | Vadose Zone Soil | HRGVAPPPRHLIRPDVDAASEGQRFAAFLSGYDLPVEAQRHWRV* |
| Ga0137404_101280453 | 3300012929 | Vadose Zone Soil | LRHRGVALPPRHLIRPDVDAATEGQRLALFLSGYDLPVEEQRRWRV* |
| Ga0137410_105265962 | 3300012944 | Vadose Zone Soil | RHLIRPDVDAASEGQRFAAFLSGYDLPVEEQRRWRV* |
| Ga0164304_111075782 | 3300012986 | Soil | NRGVVPPPRHLIRPDVDTTAQGQRLAAFLAGYDLPEAEQRRWRV* |
| Ga0164306_103359991 | 3300012988 | Soil | GLHWRRLAPLLRNRGVVPPPRHLIRPDVDTTAQGQRLAAFLSGYDLPEAEQRRWRV* |
| Ga0163162_106869951 | 3300013306 | Switchgrass Rhizosphere | LPPRHIIRPDVDAAAEAQRLARWLDAYDLPVDEQQRWR* |
| Ga0163163_111523712 | 3300014325 | Switchgrass Rhizosphere | WRRLAPLLRDRGVVPPPRHLIRPDVDTTAQGQRLAAFLAGYDLPEAEQRRWRV* |
| Ga0182015_100908724 | 3300014495 | Palsa | RLASLLRHRGVALPPCHLIRPTVDATAEGQQLAAFLVEYDLPLKEQRRLRG* |
| Ga0157379_106310842 | 3300014968 | Switchgrass Rhizosphere | LAPLLRHRGVVALPPRHIVRPEFDAASEERRLAAFLTSYDLPLEEQHR |
| Ga0137420_10770612 | 3300015054 | Vadose Zone Soil | HRGVALPPRYLVRPELDAAAEGQRFAAFLAGYDLPAEEQRRWRV* |
| Ga0137420_13814491 | 3300015054 | Vadose Zone Soil | DAAARPELDAAAEGQRFAAFLAGYDLPAEEQRRWRV* |
| Ga0137409_100661931 | 3300015245 | Vadose Zone Soil | RHRGVAPPPRHLIRPDVDAATEGQRLALFLSGYDLPVEEQRRWRV* |
| Ga0137409_105621352 | 3300015245 | Vadose Zone Soil | HLIRPDVDVATEGQRFAAFLSGYDLPVEEQRRWRV* |
| Ga0132255_1003851273 | 3300015374 | Arabidopsis Rhizosphere | LQHRGVALPPRHLLRSKADASAEGQRLATFLADYDLPVEEQRRWRV* |
| Ga0182041_104633692 | 3300016294 | Soil | RGVALPPRHIIRPDQGAAAEGQRLGAFLASYDLPVEEQRRWRV |
| Ga0182035_106290072 | 3300016341 | Soil | LHWRRLTPLLRHRGVALPPRHLIRPEAPAAAEGERLAKFLAGYDLPADEQRRWRV |
| Ga0182032_107265621 | 3300016357 | Soil | RGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEHRRWRV |
| Ga0182034_103350282 | 3300016371 | Soil | WRRLAPLLRHRGVMLPPRYIIRPDLEAVVEGQRLAGFLSGYDLPVEEQRRWRV |
| Ga0182040_103626222 | 3300016387 | Soil | RGLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0187809_100169491 | 3300017937 | Freshwater Sediment | LAPLLRHRGAALPPRHIIRPDLDAAAEGQRLAAFLAGYDLPVEEQRRWRV |
| Ga0187781_112117892 | 3300017972 | Tropical Peatland | APLWRNRGGALPSRHLIRPDIDAATEGQRLTAFLAGYDLPAAEQRRWRG |
| Ga0187766_101416023 | 3300018058 | Tropical Peatland | HWRRFAPLLRHRGVALPPRHIIRADLDAALEGRRLAAFLTGYDLPV |
| Ga0066669_101378763 | 3300018482 | Grasslands Soil | HLLRPDMDEAAQRQRLAAFLADYDLPAEEQRRWRV |
| Ga0137408_11822362 | 3300019789 | Vadose Zone Soil | RYLVRPELDAAAEGQRFAAFLAGYDLPAEEQRRWRV |
| Ga0187768_10271291 | 3300020150 | Tropical Peatland | RQRRVARPPRHLIRAQRGAAAEGQRLADFLARYDLPVEEQRRWRV |
| Ga0210399_106382182 | 3300020581 | Soil | RLAPLLRHRGAALPPRYLVRPDVDAVAEGQRFAAFLAGYDLPAEEQHRWRV |
| Ga0210396_107943981 | 3300021180 | Soil | VALPPRYLIRPEGGAAAEAERFALFLSGYDLPVEEQRRWRV |
| Ga0213882_102381121 | 3300021362 | Exposed Rock | PRHLIRTDGDTGIEGGRLAAFLSGYDLPQEERRRWRV |
| Ga0210386_104531391 | 3300021406 | Soil | RYLIRPDGDAAVEAERFALFLSGYDLPVEEQRRWRV |
| Ga0210394_113329951 | 3300021420 | Soil | RGVGLPPRHIIRPDADPALEEQRLTELLASYDLPVEEQRRWRV |
| Ga0210409_102359614 | 3300021559 | Soil | TALLRHRGVAPPPRHVIRTEVDAAIETQRLTDFLSGYDLPAQERRRWRV |
| Ga0126371_112958942 | 3300021560 | Tropical Forest Soil | RLLQQRGVALPPRHLLRSRADAGAEGERLATFLADYDLPVEEQRRWRV |
| Ga0126371_115033311 | 3300021560 | Tropical Forest Soil | LLRHRGAALPPRHIIRTDIDAAAETQRLSAFLADYDLPPEEQRRWRV |
| Ga0247669_10433051 | 3300024182 | Soil | RGLAMPPRHLIRPDVDAASEGQKLAVFLSDYDLPPEEQHRWRV |
| Ga0207692_102593222 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EPGNGLHWRRLAPLLRHRGVALPPRHIIRPELDATAEGERLTAFLSEYDLPLEERRRWRV |
| Ga0207699_102300842 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLAPLLRNRGVVPPPRHLIRPDVDTTAQGQRLAAFLAGYDLPESEQRRWRV |
| Ga0207705_115252191 | 3300025909 | Corn Rhizosphere | EPGHGLHWRRLAPLLRHRGIALPPRHIIKADVDAVAETHRLATWLDNYDLPVEEQRRWR |
| Ga0207646_118616972 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GLHWRRLAPLLRHRGVALPPRYIVRPDVDAAFEGQRLAALLANYDLPVEEQHRWRV |
| Ga0207686_104359002 | 3300025934 | Miscanthus Rhizosphere | PPRHLIRPDVDTTAQGQRLAAFLSGYDLPEAEQRRWRV |
| Ga0207689_102941592 | 3300025942 | Miscanthus Rhizosphere | EAERDSHRSELAPLLRNRGVVPPPRHLIRPDVDTSDQGQRLAAFLAGYDLPEAEQRRWRV |
| Ga0207667_114593681 | 3300025949 | Corn Rhizosphere | LLRNRGVVPPPRHLIRPDVDTTAQGQRLAAFLAGYDLPESEQRRWRV |
| Ga0207639_105443612 | 3300026041 | Corn Rhizosphere | PPRHIIRPDVDAAAEAQRLGRWLDAYDLPVEEQQRWR |
| Ga0207641_115020471 | 3300026088 | Switchgrass Rhizosphere | NGLHWRRLAPLLRNRGVVPPPRHLIRPDVDTTAQGQRLAAFLAGYDLPESEQRRWRV |
| Ga0209471_12039221 | 3300026318 | Soil | HWRRLAPLLRHRAVALPPRHVLRPDMDEAAEGQRLAAFLADYDLPAEEQRRWRV |
| Ga0209158_12181812 | 3300026333 | Soil | PPRHVLRPDMDEAAEGQRLAAFLADYDLPAEEQRRWRV |
| Ga0209807_13163191 | 3300026530 | Soil | LRHRGVALPPRYLVCPEVDAVAEGQRFATFLAGYDLPAEEQRRWRV |
| Ga0209625_10651261 | 3300027635 | Forest Soil | YLVRPDVDAVAEGQRFAAFLAGYDLPAEEQHRWRV |
| Ga0209139_101785302 | 3300027795 | Bog Forest Soil | RGLAALLRHRGVKLPPRHLIRRDAEAATEGRRFTEFLSGYDLPATEQRRWRV |
| Ga0209811_104278621 | 3300027821 | Surface Soil | LPPRHLLRSRADARAEGERLATFLAGYDLPVEEQRRWRV |
| Ga0209040_104459352 | 3300027824 | Bog Forest Soil | APPPRFSLRPDADAAAEGQRLAAFLSGYDLPEEEQRRWRV |
| Ga0209580_102194411 | 3300027842 | Surface Soil | APLLRHRGVALPPRHLLRPEAPATAEGQRLANFLTGYDLPAEQQRRWRV |
| Ga0209167_101255113 | 3300027867 | Surface Soil | LHWRRLAPLLRHRRVALPPRHLIRAEVDAAVEARRLAAFLAGYDLPLEEQRRWRV |
| Ga0209488_108903412 | 3300027903 | Vadose Zone Soil | HGLHWRRLAPLLRHRGVALPPRHIVRPDVDAALEGQRLAALLSSYDLPVEEQHRWRV |
| Ga0302228_101143461 | 3300028808 | Palsa | PPRYLLRPDGDAAVEGQRLALFLSGYDLPVEEQRRWRA |
| Ga0311332_110294862 | 3300029984 | Fen | GVLPLPRHLIRTEVNTAAEGQRLATFLSDYDLPVEEQRRWRL |
| Ga0302276_103733942 | 3300029992 | Bog | WRRMAPLLKHRGVAQPLRHIVRPDADAALEAQRLATLLASYDLPIEEQRRWRV |
| Ga0302310_100210085 | 3300030737 | Palsa | GVALPPRHIIRVQEDTVAEARRLAEFLAGYDLPPEEQRRWRPGVRGER |
| Ga0170834_1073813504 | 3300031057 | Forest Soil | LRHRGVAPPPRYLIRPDVDAAAEGQRFAEFLSGYDLPVEEQRRWRV |
| Ga0170824_1014888163 | 3300031231 | Forest Soil | LAPLLRHRGVAAPPRHLIRPDVDAAAEGQRFAVFLSGYDLPVEEQRHWRV |
| Ga0170824_1017486831 | 3300031231 | Forest Soil | HRGVAPPPRYLIRPDVDAAAEGQRFAEFLSGYDLPVEEQRRWRV |
| Ga0170824_1035539411 | 3300031231 | Forest Soil | HWRRLAPLLRHRSVALPPRHLLRPDIDAAAEGQRLADFLSGYDLPVEEQRRWRV |
| Ga0170824_1277041163 | 3300031231 | Forest Soil | RRLAPLLRHRGVALPPRHLIRPDVDAASEGQKLTVFLSGYDLPPEEQHRWRV |
| Ga0170824_1289429284 | 3300031231 | Forest Soil | VALPPRHFIRPDVDAAAEGRRFAEFLSGYDLPVEEQRRWRV |
| Ga0302307_102114202 | 3300031233 | Palsa | LLRHRGVALPPRYLIRPEGDAAAEAERFALFLSGYDLPVEEQRRWRV |
| Ga0302318_104075011 | 3300031258 | Bog | AQPLRHIVRPDADAALEAQRLATLLASYDLPIEEQRRWRV |
| Ga0318528_100723551 | 3300031561 | Soil | GVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0318528_106050262 | 3300031561 | Soil | HRGVALPPRHILRPDLDAAAERQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318555_100926301 | 3300031640 | Soil | PPRHILRPDRDAAAERQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318574_107726331 | 3300031680 | Soil | IWRGVALPPRHIIRPDRDAASEGQRLAVFLTGYDLPIEEQRRWRV |
| Ga0265342_104749901 | 3300031712 | Rhizosphere | APLLRHRGAALPPRHIVRPDVDVALEGQRLAALLTGYDLPPDEQRRWRV |
| Ga0306917_105321652 | 3300031719 | Soil | PLLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0306917_110459741 | 3300031719 | Soil | ARLLQQRGVALPPRHLLRSRTDARAQGERLATFLADYDLPVEEQRRWRV |
| Ga0318493_100505521 | 3300031723 | Soil | LHWRRLAPLLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0318501_100841131 | 3300031736 | Soil | HIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0307468_1001037502 | 3300031740 | Hardwood Forest Soil | LRRRGVTVPPRHVIRPDAGAVAESERLTAFLAGYDLPVEEQRRWRGRTQEDR |
| Ga0318492_102504761 | 3300031748 | Soil | LLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0318494_102455161 | 3300031751 | Soil | RHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0307475_100264631 | 3300031754 | Hardwood Forest Soil | LVPLLRHRGVALPPRHLIRPEVDAAAERQRFAVFLSGYDLPVEQQRRWRV |
| Ga0307475_111154681 | 3300031754 | Hardwood Forest Soil | LHWRRLAPLLRHRGVALPPRHLIRPDVDAAAEGQRFAVFLSGYDLPVEEQRRWRV |
| Ga0307475_115049881 | 3300031754 | Hardwood Forest Soil | LAPLLRHRGVALPPRFSLRPDVDAAAEGQRFADFLSGYDLPVEEQRRWRV |
| Ga0318535_102088052 | 3300031764 | Soil | PPRHIIRPDLDAGAEGQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318554_100752151 | 3300031765 | Soil | MLPPRHIIRPDLDAVVEGQRLAGFLSGYDLPVEEQRRWRV |
| Ga0318554_102849301 | 3300031765 | Soil | RLLQQRGVALPPRHLLRSRTDARAQGERLATFLADYDLPVEEQRRWRV |
| Ga0318509_100296561 | 3300031768 | Soil | RRRGVTLPPRHTIRPDLDAAAEGQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318521_109895172 | 3300031770 | Soil | LQQRGVALPPRHLLRSRTDARAQGERLATFLADYDLPVEEQRRWRV |
| Ga0318546_113310312 | 3300031771 | Soil | GVALPPRHIIRPDRDAASEGQRLAVFLTGYDLPIEEQRRWRV |
| Ga0318543_104097451 | 3300031777 | Soil | RGAALPPRHILRPDRDAAAERQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318498_102543271 | 3300031778 | Soil | LPPRHTIRPDLDAGAEGQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318566_100825541 | 3300031779 | Soil | GLHWRRLAPLLRHRGAPLPPRHVIRPEGEASTEAQRLATFLAGYDLPPEEQRRWRV |
| Ga0318547_102541341 | 3300031781 | Soil | APLLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0318547_105056992 | 3300031781 | Soil | SPPRHILRPDRDAAAERQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318529_105515382 | 3300031792 | Soil | RLAPLLRRRGVTLPPRHIIRPDLDAGAEGQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318548_102998662 | 3300031793 | Soil | DGLHWRRLAPLLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0318548_103055212 | 3300031793 | Soil | LPPRHIIRPDLDAVVEGQRLAGFLSGYDLPVEEQRRWRV |
| Ga0318550_102805772 | 3300031797 | Soil | LYRGVALPPRHVIRPDLDAAVERQRLAAFLTGYDLPVEEQRRWRV |
| Ga0318565_101485241 | 3300031799 | Soil | LAPLLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0307478_103440401 | 3300031823 | Hardwood Forest Soil | TALLRHRGVAPPPRHVIRTEVDAAIETQRLTDFLSGYDLPAPERRRWRV |
| Ga0307478_112061842 | 3300031823 | Hardwood Forest Soil | LPPRHLIRADVDAALEGQRLAGFLADYDLPVEEQRRWRV |
| Ga0310917_104919042 | 3300031833 | Soil | PPAPLLRHRGVALPPRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0318511_101230132 | 3300031845 | Soil | HWRRLAPLLRHHGVALPPRHLIRPAASAAAEGERLAKFLAGYDLPADEQRRWRV |
| Ga0318536_100482201 | 3300031893 | Soil | HHGVALPPRHLIRPAASAAAEGERLAKFLAGYDLPADEQRRWRV |
| Ga0318536_102694541 | 3300031893 | Soil | LRHRGVKLPPRHIIRPDLDAVVEGQRLAGFLSGYDLPVEEQRRWRV |
| Ga0318551_102155652 | 3300031896 | Soil | VALPPRHLLRSRTDARAQGERLATFLADYDLPVEEQRRWRV |
| Ga0310909_100467804 | 3300031947 | Soil | LAPLLRHRGAPLPPRHVIRPEGEASTEAQRLATFLAGYDLPPEEQRRWRV |
| Ga0318563_100424213 | 3300032009 | Soil | LLRHRGAPLPPRHVIRPEGEASTEAQRLATFLAGYDLPPEEQRRWRV |
| Ga0318563_102689561 | 3300032009 | Soil | APLLRRRGVTLPPRHTIRPDLDAAAEGQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318563_104691992 | 3300032009 | Soil | APRHIIRPDLDAAAEGQRLGAFLAGYDLPVEEQRRWRV |
| Ga0318569_102152101 | 3300032010 | Soil | HWRRLAPLLRRRGVTLPPRHTIRPDLDAAAEGQRLAAFLTGYDLPLEEQRRWRV |
| Ga0315272_101558162 | 3300032018 | Sediment | VALPPRHIIRADVDAALEAQRLTALLISYDLPESEQRRWRV |
| Ga0318556_102257101 | 3300032043 | Soil | GYGAALPPRHILRPDRDAAAERQRLAAFLTGYDLPLEEQRRWRV |
| Ga0318513_104944621 | 3300032065 | Soil | VTLPPRHIIRPDLDAGAEGQRLAAFLTGYDLPLEEQRRWRV |
| Ga0306924_100820891 | 3300032076 | Soil | GLHWRRLAPLLRHHGVALPPRHLIRPAASAAAEGERLAKFLAGYDLPADEQRRWRV |
| Ga0318577_103659501 | 3300032091 | Soil | PRHLLRSRTDARAQGERLATFLADYDLPVEEQRRWRV |
| Ga0318540_101116604 | 3300032094 | Soil | HWRRLAPLLRHRGAPLPPRHVIRPEGEASTEAQRLATFLAGYDLPPEEQRRWRV |
| Ga0307471_1005858571 | 3300032180 | Hardwood Forest Soil | GDSRDGLHWRRLAPLLRHRGAALPPRHFIRPDVDREAEAKRLADFLAGYDLPLEERRRWR |
| Ga0310914_114833732 | 3300033289 | Soil | QQRGVALPPRHLLRSRTDARSEGERLATFLADYDLPVEEQRRWRV |
| Ga0318519_103714861 | 3300033290 | Soil | KLPPRHIIRPDLDAVVEGQRLAGFLSGYDLPVEEQRRWRV |
| Ga0370515_0106113_1076_1210 | 3300034163 | Untreated Peat Soil | HRGVAPPPRYLLRPDGDAAVEGQRLALFLSGYDLPVEEQRRWRV |
| ⦗Top⦘ |