NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037370

Metagenome / Metatranscriptome Family F037370

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037370
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 36 residues
Representative Sequence MWEVLRWFAVFVIALLLIVAGLFWLMGRPLPIPQF
Number of Associated Samples 142
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 0.00 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (100.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.691 % of family members)
Environment Ontology (ENVO) Unclassified
(23.810 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(34.524 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 39.68%    β-sheet: 0.00%    Coil/Unstructured: 60.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF01406tRNA-synt_1e 58.33
PF10027DUF2269 11.90
PF07690MFS_1 4.17
PF05977MFS_3 3.57
PF02423OCD_Mu_crystall 2.38
PF07676PD40 1.79
PF09190DALR_2 1.79
PF08486SpoIID 1.19
PF01642MM_CoA_mutase 0.60
PF13360PQQ_2 0.60
PF12534Pannexin_like 0.60
PF14306PUA_2 0.60
PF04127DFP 0.60
PF027395_3_exonuc_N 0.60
PF08402TOBE_2 0.60
PF00528BPD_transp_1 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 60.12
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 58.33
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 58.33
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 3.57
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 2.38
COG2385Peptidoglycan hydrolase (amidase) enhancer domain SpoIIDCell wall/membrane/envelope biogenesis [M] 1.19
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.60
COG0452Phosphopantothenoylcysteine synthetase/decarboxylase CoaBCCoenzyme transport and metabolism [H] 0.60
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

NameRankTaxonomyDistribution
UnclassifiedrootN/A100.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.36%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil3.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.98%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.38%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.38%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.79%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.79%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.79%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.19%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.19%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment1.19%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.19%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.19%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.19%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.19%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.19%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.60%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.60%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.60%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.60%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.60%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.60%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.60%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.60%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.60%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.60%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.60%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.60%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.60%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300004020Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300005885Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007775Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MGEnvironmentalOpen in IMG/M
3300007822Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025001Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes)EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026008Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026196Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027647Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeqEnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031256Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033502Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fractionEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_DRAFT_006390302088090008SoilMESETMWDVLRWFAVFVIAILLIVAGLFWIMGRQLPFPNF
P3_DRAFT_000818502088090008SoilMWDVLRWFAVFAIAILVIVAGLFLIMGRQLPIPNF
Perma_A_C_042588302124908032SoilMWDVLRWFAVFVAAILVMVAGLYLVLGKPLPFPHLF
P3_CLC_028845402124908041SoilMESETMWDVLRWFAVFVIAILLIVAGLFWIMGRQLPIPNF
A5_c1_012085502124908044SoilMWDVLRWFAVFVAAIMVMVAGLYLVLGRPLPIPHLF
ICCgaii200_084774722228664021SoilMWDVVRWFAVFVIAVFVIVIGLFWILDKPFPWPQLF
ICChiseqgaiiDRAFT_080301923300000033SoilMEVLRWFAVFVIAILLMVAGLFWLMGRPLPIPQF*
AL16A1W_1010649823300000887PermafrostMWDVLRWFAVFVIAVLVLVAGVYLVLGKPLPIPSLF*
JGI10216J12902_10968838843300000956SoilMAWEVLRWFLVFVLALLLIVAGLFWLMGRPLPIPSF*
A21PFW6_133589323300001333PermafrostFYALIESAEMWDVLRWFAVFVIAVLVLVAGVYLVLGKPLPIPSLF*
A2065W1_1016966443300001537PermafrostMEVLRWLAFFVLAILLIVAGLFWLMGRPLPFPSF*
C687J26616_1012010223300002120SoilMWEVLKWFGLFVLAMLTIVAGLFWLMGRPITIPNLF*
C687J26616_1012550823300002120SoilMWDVLRWFSVFVIAVLVMVAGLYWILGKPLPIPSLF*
C687J26631_1006111223300002124SoilMWDVLRWFAVFIAAVLVLVFGLYLILGKPLPLPQIF*
soilL1_1001705143300003267Sugarcane Root And Bulk SoilVEEGTVWEVLKWFAVFVIALLLIVAGLFWLMGRPLPFPQF*
Ga0055440_1002028423300004020Natural And Restored WetlandsMESETMWDVVRWFAVFVIAILVIVAGLFWIMGRSLPIPNF*
Ga0063356_10161288333300004463Arabidopsis Thaliana RhizosphereMEPPMWDVLRWFAVFVIAVLLIVAGIFWLFGRDLPIPQF*
Ga0070706_10002860213300005467Corn, Switchgrass And Miscanthus RhizosphereLGSRAMWEVLRWMIVFVLALLLIVAAIYLVTGRALPIPQF*
Ga0070730_1002737423300005537Surface SoilMWEVLRWMIVFVLAVLLIVAAIYLVLGQPLPIPQF*
Ga0066661_1011076233300005554SoilMWEVLRWMIVFVLALLLIVAAIYLVTGRALPIPQF*
Ga0066707_1023338223300005556SoilMWDVLRWFSVFVIAILLIVAGLFWIMGRPLPIPQF*
Ga0066707_1077268423300005556SoilMWEVLRWMIVFVLALLLIVTAIYLVTGRPLPIPQF*
Ga0066699_1000588863300005561SoilMWEVLRWMIVFVLALLLIVAAIYLVTGRTLPIPQF*
Ga0066708_1027907113300005576SoilMWEVLRWMIVFVLALLLIVAAIYLVTGRPLPVPQF*
Ga0068854_10034378233300005578Corn RhizosphereMWDVVRWFAVFVIAIIVIVAGLYWILDKPLPIPQF*
Ga0068859_10271400423300005617Switchgrass RhizosphereVWEVLKWMAVFVIALLLIVAGLFWLMGRPLPIPQF*
Ga0074470_10010221233300005836Sediment (Intertidal)MWDVVRWFAVFVIAILVIVAGLFWIMGRSLPIPNF*
Ga0075288_100228043300005874Rice Paddy SoilMWEVLRWFLVFVLALLLIVAGLFWLMGRPLPIPNF*
Ga0075293_101965723300005875Rice Paddy SoilMWDVLRWFAVFVAAILVMVAGLYLLLGKPLPIPHLF*
Ga0075284_100033243300005885Rice Paddy SoilMWEVLRWMIVFVLALLLIVAGIYLVLGEPLPIPQF*
Ga0081539_1003933943300005985Tabebuia Heterophylla RhizosphereMWEVLKWFAVFVIALLLIVAGLFWLMGRELPIPQF*
Ga0066696_1096697713300006032SoilMWEVLRWMIVFVLALLLIVAAIYLVTGRPLPIPQF*
Ga0070716_10089322913300006173Corn, Switchgrass And Miscanthus RhizosphereMWEVLRWMIVFVLALLLIVVAIYLVTGRPLPIPSF*
Ga0066658_1007058023300006794SoilMWEVLRWMIVFVLALLLIVVAIYLATGRPLPIPSF*
Ga0066660_1019840623300006800SoilMPYLGAEPMWEVLRWMIVFVLALLLIVVAIYLVTGRPLPIPQF*
Ga0075428_10044836023300006844Populus RhizosphereMWEVLKWMAVFVIALLLIVAGLFWLMGRDLPIPQF*
Ga0075433_1132532923300006852Populus RhizosphereMWDVVRWFAVFVIAVFVLIAGLYWILGKPLPIPSLF*
Ga0075425_10001395483300006854Populus RhizosphereVWDVIRWFAVFVIAVFVLIAGLYLILGKPLPIPHLF*
Ga0075425_10088211723300006854Populus RhizosphereMWEVLRWMIVFVLALLLIVAAIYLVTGRSLPIPSF*
Ga0079215_1106008723300006894Agricultural SoilMWEVLRWFAVFVLALLLMVAGLFWLMGRPLPIPDF*
Ga0075436_10041227623300006914Populus RhizosphereMWEVLRWMIVFVLALLLIVAAIYIVDGRSLPIPSF*
Ga0097620_10014149433300006931Switchgrass RhizosphereMWDVLRWFAVFVIAVLVLIAGVYLVLGKPLPIPSLF*
Ga0079218_1340928323300007004Agricultural SoilMWEVLKWMIVFVLSLLLIVAGLFWLMGRPLPIPEF*
Ga0102953_102163933300007775SoilMWEVLRWFAVFVLALLLIVAGLFWLMGRPLPIPNF*
Ga0102953_112346413300007775SoilMWEVLRWMIVFIAALLLIVAGIYWVLGRPLPIPSF*
Ga0104325_11605123300007822SoilMWDVLRWFAVFVTAILVIVAGLYLVLGRPLPFPHLF*
Ga0066710_10385055823300009012Grasslands SoilMWDVLRWFAVFVIAVLVLVAGIYLVLGKPLPIPSLF
Ga0105095_1028539023300009053Freshwater SedimentMWEVLRWFAVFVLALLLMVAGLFWLMGRPLPIPEF*
Ga0066709_10162923423300009137Grasslands SoilMWEVVRWMIVFVLALLLIVAAIYLVTGQPLPIPQF*
Ga0114129_1317217923300009147Populus RhizosphereVWEVLKWFAVFVIALLLIVAGLFWLMGRDLPIPTF*
Ga0118657_1279059513300009506Mangrove SedimentVWEVLKWFLVFVIALLLLVAGLFWLMGRPLPIPNF*
Ga0126308_1093452523300010040Serpentine SoilMGWEVLRWFAMFVIALLLIVAGLFVLMGQPLPIPQF*
Ga0136847_1309156213300010391Freshwater SedimentMWDVLRWFAVFAAAVLVMVAGLYLILGRPLPIPHLF*
Ga0138514_10001381223300011003SoilMWDVLRWFAVFVIAVFVIVIGLFWILDKPFPWPQLF*
Ga0138514_10001529823300011003SoilMWEVLRWMIVFVLALLLIVVAIYLVTGRPLPIPQF*
Ga0137458_105155023300011436SoilMWEVLKWMAVFVAAILVMVAGLYIILGKPLPIPQLF*
Ga0120148_100011023300011999PermafrostMWDVLRWFFVFVLAVLILVAGLYWILGKSLPIPHLF*
Ga0137364_1069275323300012198Vadose Zone SoilMWEVLRWMIVFVFALLLIVAAIYLVTGRPLPIPQF*
Ga0137383_1130189813300012199Vadose Zone SoilMWEVVRWMIVFVLALLLIVAAIYLVTGQPLSIPQF*
Ga0137374_1060310713300012204Vadose Zone SoilMAWEVLRWFLVFVLALLLIVAGLFWLMGRPLPFPNF*
Ga0137381_1036633613300012207Vadose Zone SoilMWEVVRWMIVFVLALLLIVAAIYLVTGRPLPIPQF*
Ga0137375_1030715233300012360Vadose Zone SoilMGAEAMWDVLRWFAVFVVAVLLIVAGLFLLFGKPLPIPSLF*
Ga0157216_1040325223300012668Glacier Forefield SoilMWEVLRWFSVFVIAVLVMVAGLYWILGKPLPIPSLF*
Ga0157305_1008415713300012891SoilMWEVLKWMAVFVIALLLIVAGLFWLMGRPLPIPQF*
Ga0153915_1002645653300012931Freshwater WetlandsMWDVLRWFAVFVIAILLLVAGLFWIMGRPLPIPNF*
Ga0153915_1084804923300012931Freshwater WetlandsMWDVLRWFAVFVVAILLLVAGLFWIMGRPLPIPNF*
Ga0162651_10009695423300012938SoilMWEVLKWFGVFMLALLLIVAGLFWLMGRPLPIPQF*
Ga0120181_113095423300013766PermafrostMWDVLRWFFVFVLAVLILVAGRYGILGKPLPIPHLF*
Ga0120158_1023298513300013772PermafrostMWDVLRWFAVFVLAVLVLVAGLYWVLGKPLPIPHSSDSLPGH
Ga0120125_110188823300014056PermafrostMWDVLRWFSVFVIAILLIVAGLFWIMGRPLPIPSF*
Ga0075320_105430813300014255Natural And Restored WetlandsVWEVLKWFAVFVIALLLIVAGLFWLMGRPLPLIPSF*
Ga0075316_115957823300014314Natural And Restored WetlandsMWEVLRWFFVFVLALLLMVAGLFWLMGRPLPIPNF*
Ga0167632_100212443300015085Glacier Forefield SoilMWDVLRWFAVFVAAILVMVAGLYLILGKPLPVPHLF*
Ga0167629_119660023300015209Glacier Forefield SoilMWDVLRWFAVFVLAVLALVAGLYWILGKPLPIPNLF*
Ga0132258_1106746443300015371Arabidopsis RhizosphereMWEVLKWFAVFVIALLLIVAGLFWLMGRPLPIPQF*
Ga0132258_1372518323300015371Arabidopsis RhizosphereMWEVLKWFAVFVIALLLIVAGLFWLMGRPLPIPSF*
Ga0132256_10335086213300015372Arabidopsis RhizosphereMWEVLKWFAVFVIALLLIVAGLFWLMGRPLPIPTF*
Ga0132255_10037493633300015374Arabidopsis RhizosphereVWNVLKWMAVFVIALLLIVAGLFWLMGRPLPIPQF*
Ga0184610_105254823300017997Groundwater SedimentMWDVLRWFAVFVAAVLVIVLGLFWLLDKPFPWPQLF
Ga0184605_1036044423300018027Groundwater SedimentMWDVLRWFAVFVIAIIVIVVGLYWILDKPLPIPQF
Ga0184634_1053817623300018031Groundwater SedimentMWDVLRWFAVFVVAVLVLIWGLYLILGQPFPWPELPF
Ga0184638_101701043300018052Groundwater SedimentMAWEVLRWFLVFVLALLLIVAGLFWLMGRPLPIPSF
Ga0184638_114801523300018052Groundwater SedimentMWDVLRWFAVFVVAILVIVFGLYLILGKPLPIPPLPWF
Ga0184626_1025499423300018053Groundwater SedimentMWDVLRWFAVFVVAVLVIVVGLFWIFDKPFPWPQLF
Ga0184623_1001485123300018056Groundwater SedimentMTWEVLRWMALFVIALLLIVAGLFWLMGRPLPIPNF
Ga0184623_1014728723300018056Groundwater SedimentMWDVLRWFAVFVVAVLVIVAGLFLLFGKPLPIPSLF
Ga0184623_1017382333300018056Groundwater SedimentMWDVLRWFAVFVAAVLVIVAGLFLLFGKPLPIPSLF
Ga0184637_1022124023300018063Groundwater SedimentMWEVLKWFGMFVVAMLVIVFGLFWLMGRPIPIPNIF
Ga0184617_101965233300018066Groundwater SedimentMWDVVRWFAVFVIAIIVIVVGLYWILDKPLPIPQF
Ga0184618_1000521163300018071Groundwater SedimentMWDVLRWFAVFVIAILVIVAGLFWILGKPLPIPQLF
Ga0184618_1040161613300018071Groundwater SedimentMWDVLRWFAVFVIAVLVIVMGLFWLFNKPFPWPQLF
Ga0184640_1052749013300018074Groundwater SedimentMWDVLRWFAVFVAAVLVIVAGLYIILGRPLPIPQLF
Ga0184632_1039355013300018075Groundwater SedimentMWDVLRWFAVFVIAILVIVAGLFWIMGRPLPIPSF
Ga0184609_1002787043300018076Groundwater SedimentMWDVLRWFAVFVAAVLVIVLGLFWLFDRPFPWPQLF
Ga0184633_1000632053300018077Groundwater SedimentMWDVVRWFAVFVVAILVIVFGLYLILGKPFPWPQLPF
Ga0184612_1017573123300018078Groundwater SedimentMWDVLRWFAVFVAAILVIVLGLFWLLDKPFPWPQLF
Ga0184612_1045225023300018078Groundwater SedimentMWDVLRWFAVFVVAVLVLVVGLYWILGRPFPWPHLPF
Ga0184625_1025933323300018081Groundwater SedimentMWDVLRWFAVFVVAVLVIVIGLFWLFDKPFPWPQLF
Ga0184629_1044964323300018084Groundwater SedimentMWDVLRWFAVFVIAVLLIVAGLFLVFGKPLPIPQLF
Ga0190272_1185294323300018429SoilMAWEVLRWFAVFVIAMLLIVAGIFWLLDRPLPFPRF
Ga0066667_1064069613300018433Grasslands SoilSRAMWEVLRWMIVFVLALLLIVAAIYLVTGRPLPIPQF
Ga0066662_1144572223300018468Grasslands SoilMWEVVRWMIVFVLALLLIVAAIYLVTGQPLPIPQF
Ga0190270_1321693813300018469SoilMWDVVRWFAVFVIAVFVLIAGLYWILGKPLPIPSLF
Ga0184643_121272123300019255Groundwater SedimentMWDVLRWFAVFVIAVLLIVAGIYFVLGRPLPLPQLF
Ga0193741_110622013300019884SoilMWDVLRWFAVFVVAVLVIVAGLFLLFGKPLPIPSF
Ga0193751_1000298423300019888SoilMWDVLRWFSVFVIAILLIVAGLFWIMGRPLPIPQF
Ga0210382_1003020933300021080Groundwater SedimentMGWEVMRWFAMFIIAILLIVAGLFWLMGRPLPFPQF
Ga0193719_1008308623300021344SoilVWDVLKWMLVFVAAVSVLVAGLYLILGKPLPIPHLF
Ga0193719_1012482523300021344SoilMWDVLRWFAVFVIAVLVIVAGLFWIMGRPLPIPQLF
Ga0193695_103979013300021418SoilMWDVLRWFAVFVIAVLVIVAGIFWIFGKPLPIPQLF
Ga0224500_1004658123300022213SedimentMWDVLRWFAVFVIAVLVMVAGLYWILGKPLPIPNLF
Ga0222623_1037417213300022694Groundwater SedimentESAMTWEVLRWMALFVIALLLIVAGLFWLMGRPLPIPNF
Ga0209618_103187033300025001SoilMWDVLRWFSVFVIAVLVMVAGLYWILGKPLPIPSLF
Ga0209109_1002961533300025160SoilMWDVLRWFAVFIAAVLVLVFGLYLILGKPLPLPQIF
Ga0209109_1024036623300025160SoilMWDVLRWFAVFVAAILVIVAGLYIILGKPLPIPQLF
Ga0209108_1014825423300025165SoilMWDVLRWFAVFVAAILVIVAGLYIILGKPLPIPHLF
Ga0209431_1018981233300025313SoilMWEVLKWFGLFVLAMLTIVAGLFWLMGRPITIPNLF
Ga0209431_1021973223300025313SoilMWDVLRWFAVFVVAILVIVFGLYLILGQPLPIPGLPWF
Ga0209431_1029030523300025313SoilMWDVLRWFAVFVAAVLVIVFGLYLILGKPLPIPQIF
Ga0210132_102576013300025538Natural And Restored WetlandsMWDVVRWFAVFVIAILVIVAGLFWIMGRSLPIPNF
Ga0210076_101526823300025567Natural And Restored WetlandsVWEVLKWFAVFVIALLLIVAGLFWLMGRPLPFIPSF
Ga0207684_1001405813300025910Corn, Switchgrass And Miscanthus RhizosphereLGSRAMWEVLRWMIVFVLALLLIVAAIYLVTGRPLPIPQF
Ga0207684_1005156153300025910Corn, Switchgrass And Miscanthus RhizosphereVLGSRAMWEVLRWMIVFVLALLLIVAAIYLVTGRALPIPQF
Ga0207646_10001913103300025922Corn, Switchgrass And Miscanthus RhizosphereMWEVLRWMIVFILALLLIVAAIYLVAGRPLPIPQF
Ga0207646_1013687423300025922Corn, Switchgrass And Miscanthus RhizosphereMWDVLRWFAVFVIAVLVIVIGLFWLFNKPFPWPQLF
Ga0207646_1045664623300025922Corn, Switchgrass And Miscanthus RhizosphereMWDVLRWFAVFVIAILVIVAGLFWIFGKPLPIPQF
Ga0207646_1047661323300025922Corn, Switchgrass And Miscanthus RhizosphereMWDVFRWFAVFVIAMLVMVAGLYFVLGKPLPIPSLF
Ga0207644_1183100023300025931Switchgrass RhizosphereVWEVLKWMAVFVLALLLIVAGLFWLMGRPLPIPNF
Ga0208415_101116123300025993Rice Paddy SoilMWEVLRWFLVFVLALLLIVAGLFWLMGRPLPIPNF
Ga0208529_102521123300026008Rice Paddy SoilMWEVLRWMIVFVLALLLIVAGIYLVLGEPLPIPQF
Ga0207708_1036701623300026075Corn, Switchgrass And Miscanthus RhizosphereVWEVLKWMAVFVIALLLIVAGLFWLMGRPLPIPQF
Ga0209919_100966223300026196SoilMWEVLRWFAVFVLALLLIVAGLFWLMGRPLPIPNF
Ga0209919_123066213300026196SoilMWEVLRWMIVFIAALLLIVAGIYWVLGRPLPIPSF
Ga0209159_109388023300026343SoilMWEVLRWMIVFVLALLLIVTAIYLVTGRPLPIPQF
Ga0256867_1027756123300026535SoilMWEVLRWFAVFVLALLLMVAGLFWLMGRPLPIPDF
Ga0209805_134385123300026542SoilMWEVLRWMIVFVLALLLIVAAIYLVTGRTLPIPQF
Ga0209577_1003978733300026552SoilMWEVLRWMIVFVLALLLIVVAIYLVTGRPLPIPQF
Ga0209999_103941033300027543Arabidopsis Thaliana RhizosphereWDVVRWFAVFVIAVFVLIAGLYWILGKPLPIPSLF
Ga0214468_105026033300027647SoilGAQPMWEVLRWFAVFVLALLLIVAGLFWLMGRPLPIPNF
Ga0256866_100297833300027650SoilMWEVLKWFAVFVIALLLMVAGLFWLMGRPLPIPEF
Ga0209166_1001916853300027857Surface SoilMWEVLRWMIVFVLAVLLIVAAIYLVLGQPLPIPQF
Ga0268264_1110871823300028381Switchgrass RhizosphereMWDVLRWFAVFVIAVLVLIAGVYLVLGKPLPIPSLF
Ga0307303_1000428523300028713SoilMWEVLKWFAVFVIALLLIVAGLFWLMGRPLPFLPQF
Ga0307320_1045669213300028771SoilAMTWEVLRWMALFVIALLLIVAGLFWLMGRPLPIPNF
Ga0307282_1017061023300028784SoilMWDVLRWFAVFVLAVLLLVAGLYWILGKPLPIPHLF
Ga0307282_1017854623300028784SoilMWDVLRWFAVFVVAVLVIVLGLFWLFDKPFPWPQLF
Ga0307504_1001009223300028792SoilMWDVLRWFAVFIAAILVLVAGLYLILGKPLPIPHLF
Ga0307281_1036553423300028803SoilSIGAEAMWDVLRWFLVFVVAVLVIVTGLFLLFGKPLPIPQLF
Ga0307281_1037424313300028803SoilMWDVLRWFLVFVVAVLVIVTGLFLLFGKPLPIPQLF
Ga0307296_1005533533300028819SoilMWDVLRWFAVFVAAILVIVLGLFWLMDKPFPWPQLF
Ga0307312_1001893733300028828SoilMWDVLRWFAVFVVAVLVIVLGLFWLLDKPFPWPQLF
Ga0299907_1003958953300030006SoilMWEVLKWMIVFVLSLLLIVAGLFWLMGRPLPIPEF
Ga0247826_1047008713300030336SoilNRSAMWDVVRWFAVFVIAVFVLIAGLYWILGKPLPIPSLF
Ga0299914_1017243243300031228SoilMWEVLRWFAVFVFALLLIVAGLFWLMGRPLPIPQF
Ga0299914_1046643023300031228SoilMWEVLRWLGVFAIALLLIVAGLFWLMGRPLPIPQF
Ga0299913_1057775623300031229SoilMWEVLRWFAVFVIALLLIVAGLFWLMGRPLPIPQF
Ga0315556_107312523300031256Salt Marsh SedimentMWEVLRWMIVFVLAVLLIVMGIYLLLGRPLPIPQF
Ga0310813_1011267323300031716SoilMWDVLRWFAVFVIAVLLIVAGLFLVLGKPLPIPSLF
Ga0310813_1118373723300031716SoilMWEVLKWFAVFVIALLLIVAGLFWLMGRPLPIPQF
Ga0307468_10096028623300031740Hardwood Forest SoilMWEVLKWFGVFMLALLLIVAGLFWLMGRPLPIPQF
Ga0214473_1006017853300031949SoilMWDVLRWFLVFVVAVLVIVMGLFLLFGKPLPIPSLF
Ga0315540_1002204823300032061Salt Marsh SedimentMWEVLRWMIVFVLALLLIVAGIYLVLGQPLPIPQF
Ga0315281_10004237223300032163SedimentMWDVLRWFAVFVAAILVIVAILYLIMGRPLPIPNF
Ga0214472_10004306183300033407SoilMWDVLRWFAVFVIAVLVIVAGLFLVFGKPLPIPQLF
Ga0326726_1187903623300033433Peat SoilMWDVLRWFAVFAAAVLIMIAGLYWVLGKPLPIPHLF
Ga0326731_107536513300033502Peat SoilMWDVLRWFAVFAAAVLIIIAGLYWVLGKPLPIPHLF
Ga0364930_0065469_777_8903300033814SedimentMWDVLRWFAVFVAAIIMIVFGLYWVMGKPLPIPQLPF
Ga0370484_0014174_938_10483300034125Untreated Peat SoilMWDVLRWFAVFLAAIMVMVAGLYLVLGRPLPIPHLF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.