Basic Information | |
---|---|
Family ID | F037370 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 36 residues |
Representative Sequence | MWEVLRWFAVFVIALLLIVAGLFWLMGRPLPIPQF |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.691 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.810 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.524 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.68% β-sheet: 0.00% Coil/Unstructured: 60.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF01406 | tRNA-synt_1e | 58.33 |
PF10027 | DUF2269 | 11.90 |
PF07690 | MFS_1 | 4.17 |
PF05977 | MFS_3 | 3.57 |
PF02423 | OCD_Mu_crystall | 2.38 |
PF07676 | PD40 | 1.79 |
PF09190 | DALR_2 | 1.79 |
PF08486 | SpoIID | 1.19 |
PF01642 | MM_CoA_mutase | 0.60 |
PF13360 | PQQ_2 | 0.60 |
PF12534 | Pannexin_like | 0.60 |
PF14306 | PUA_2 | 0.60 |
PF04127 | DFP | 0.60 |
PF02739 | 5_3_exonuc_N | 0.60 |
PF08402 | TOBE_2 | 0.60 |
PF00528 | BPD_transp_1 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 60.12 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 58.33 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 58.33 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 3.57 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 2.38 |
COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 1.19 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.60 |
COG0452 | Phosphopantothenoylcysteine synthetase/decarboxylase CoaBC | Coenzyme transport and metabolism [H] | 0.60 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 12.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.57% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.98% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.38% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.79% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.79% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.79% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.19% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.19% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.19% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.19% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.19% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.19% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.19% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.19% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.60% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.60% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.60% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.60% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.60% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.60% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.60% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.60% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007775 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MG | Environmental | Open in IMG/M |
3300007822 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 Soapdenovo | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026008 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026196 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MG (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P3_DRAFT_00639030 | 2088090008 | Soil | MESETMWDVLRWFAVFVIAILLIVAGLFWIMGRQLPFPNF |
P3_DRAFT_00081850 | 2088090008 | Soil | MWDVLRWFAVFAIAILVIVAGLFLIMGRQLPIPNF |
Perma_A_C_04258830 | 2124908032 | Soil | MWDVLRWFAVFVAAILVMVAGLYLVLGKPLPFPHLF |
P3_CLC_02884540 | 2124908041 | Soil | MESETMWDVLRWFAVFVIAILLIVAGLFWIMGRQLPIPNF |
A5_c1_01208550 | 2124908044 | Soil | MWDVLRWFAVFVAAIMVMVAGLYLVLGRPLPIPHLF |
ICCgaii200_08477472 | 2228664021 | Soil | MWDVVRWFAVFVIAVFVIVIGLFWILDKPFPWPQLF |
ICChiseqgaiiDRAFT_08030192 | 3300000033 | Soil | MEVLRWFAVFVIAILLMVAGLFWLMGRPLPIPQF* |
AL16A1W_101064982 | 3300000887 | Permafrost | MWDVLRWFAVFVIAVLVLVAGVYLVLGKPLPIPSLF* |
JGI10216J12902_1096883884 | 3300000956 | Soil | MAWEVLRWFLVFVLALLLIVAGLFWLMGRPLPIPSF* |
A21PFW6_13358932 | 3300001333 | Permafrost | FYALIESAEMWDVLRWFAVFVIAVLVLVAGVYLVLGKPLPIPSLF* |
A2065W1_101696644 | 3300001537 | Permafrost | MEVLRWLAFFVLAILLIVAGLFWLMGRPLPFPSF* |
C687J26616_101201022 | 3300002120 | Soil | MWEVLKWFGLFVLAMLTIVAGLFWLMGRPITIPNLF* |
C687J26616_101255082 | 3300002120 | Soil | MWDVLRWFSVFVIAVLVMVAGLYWILGKPLPIPSLF* |
C687J26631_100611122 | 3300002124 | Soil | MWDVLRWFAVFIAAVLVLVFGLYLILGKPLPLPQIF* |
soilL1_100170514 | 3300003267 | Sugarcane Root And Bulk Soil | VEEGTVWEVLKWFAVFVIALLLIVAGLFWLMGRPLPFPQF* |
Ga0055440_100202842 | 3300004020 | Natural And Restored Wetlands | MESETMWDVVRWFAVFVIAILVIVAGLFWIMGRSLPIPNF* |
Ga0063356_1016128833 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEPPMWDVLRWFAVFVIAVLLIVAGIFWLFGRDLPIPQF* |
Ga0070706_1000286021 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LGSRAMWEVLRWMIVFVLALLLIVAAIYLVTGRALPIPQF* |
Ga0070730_100273742 | 3300005537 | Surface Soil | MWEVLRWMIVFVLAVLLIVAAIYLVLGQPLPIPQF* |
Ga0066661_101107623 | 3300005554 | Soil | MWEVLRWMIVFVLALLLIVAAIYLVTGRALPIPQF* |
Ga0066707_102333822 | 3300005556 | Soil | MWDVLRWFSVFVIAILLIVAGLFWIMGRPLPIPQF* |
Ga0066707_107726842 | 3300005556 | Soil | MWEVLRWMIVFVLALLLIVTAIYLVTGRPLPIPQF* |
Ga0066699_100058886 | 3300005561 | Soil | MWEVLRWMIVFVLALLLIVAAIYLVTGRTLPIPQF* |
Ga0066708_102790711 | 3300005576 | Soil | MWEVLRWMIVFVLALLLIVAAIYLVTGRPLPVPQF* |
Ga0068854_1003437823 | 3300005578 | Corn Rhizosphere | MWDVVRWFAVFVIAIIVIVAGLYWILDKPLPIPQF* |
Ga0068859_1027140042 | 3300005617 | Switchgrass Rhizosphere | VWEVLKWMAVFVIALLLIVAGLFWLMGRPLPIPQF* |
Ga0074470_1001022123 | 3300005836 | Sediment (Intertidal) | MWDVVRWFAVFVIAILVIVAGLFWIMGRSLPIPNF* |
Ga0075288_10022804 | 3300005874 | Rice Paddy Soil | MWEVLRWFLVFVLALLLIVAGLFWLMGRPLPIPNF* |
Ga0075293_10196572 | 3300005875 | Rice Paddy Soil | MWDVLRWFAVFVAAILVMVAGLYLLLGKPLPIPHLF* |
Ga0075284_10003324 | 3300005885 | Rice Paddy Soil | MWEVLRWMIVFVLALLLIVAGIYLVLGEPLPIPQF* |
Ga0081539_100393394 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MWEVLKWFAVFVIALLLIVAGLFWLMGRELPIPQF* |
Ga0066696_109669771 | 3300006032 | Soil | MWEVLRWMIVFVLALLLIVAAIYLVTGRPLPIPQF* |
Ga0070716_1008932291 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MWEVLRWMIVFVLALLLIVVAIYLVTGRPLPIPSF* |
Ga0066658_100705802 | 3300006794 | Soil | MWEVLRWMIVFVLALLLIVVAIYLATGRPLPIPSF* |
Ga0066660_101984062 | 3300006800 | Soil | MPYLGAEPMWEVLRWMIVFVLALLLIVVAIYLVTGRPLPIPQF* |
Ga0075428_1004483602 | 3300006844 | Populus Rhizosphere | MWEVLKWMAVFVIALLLIVAGLFWLMGRDLPIPQF* |
Ga0075433_113253292 | 3300006852 | Populus Rhizosphere | MWDVVRWFAVFVIAVFVLIAGLYWILGKPLPIPSLF* |
Ga0075425_1000139548 | 3300006854 | Populus Rhizosphere | VWDVIRWFAVFVIAVFVLIAGLYLILGKPLPIPHLF* |
Ga0075425_1008821172 | 3300006854 | Populus Rhizosphere | MWEVLRWMIVFVLALLLIVAAIYLVTGRSLPIPSF* |
Ga0079215_110600872 | 3300006894 | Agricultural Soil | MWEVLRWFAVFVLALLLMVAGLFWLMGRPLPIPDF* |
Ga0075436_1004122762 | 3300006914 | Populus Rhizosphere | MWEVLRWMIVFVLALLLIVAAIYIVDGRSLPIPSF* |
Ga0097620_1001414943 | 3300006931 | Switchgrass Rhizosphere | MWDVLRWFAVFVIAVLVLIAGVYLVLGKPLPIPSLF* |
Ga0079218_134092832 | 3300007004 | Agricultural Soil | MWEVLKWMIVFVLSLLLIVAGLFWLMGRPLPIPEF* |
Ga0102953_10216393 | 3300007775 | Soil | MWEVLRWFAVFVLALLLIVAGLFWLMGRPLPIPNF* |
Ga0102953_11234641 | 3300007775 | Soil | MWEVLRWMIVFIAALLLIVAGIYWVLGRPLPIPSF* |
Ga0104325_1160512 | 3300007822 | Soil | MWDVLRWFAVFVTAILVIVAGLYLVLGRPLPFPHLF* |
Ga0066710_1038505582 | 3300009012 | Grasslands Soil | MWDVLRWFAVFVIAVLVLVAGIYLVLGKPLPIPSLF |
Ga0105095_102853902 | 3300009053 | Freshwater Sediment | MWEVLRWFAVFVLALLLMVAGLFWLMGRPLPIPEF* |
Ga0066709_1016292342 | 3300009137 | Grasslands Soil | MWEVVRWMIVFVLALLLIVAAIYLVTGQPLPIPQF* |
Ga0114129_131721792 | 3300009147 | Populus Rhizosphere | VWEVLKWFAVFVIALLLIVAGLFWLMGRDLPIPTF* |
Ga0118657_127905951 | 3300009506 | Mangrove Sediment | VWEVLKWFLVFVIALLLLVAGLFWLMGRPLPIPNF* |
Ga0126308_109345252 | 3300010040 | Serpentine Soil | MGWEVLRWFAMFVIALLLIVAGLFVLMGQPLPIPQF* |
Ga0136847_130915621 | 3300010391 | Freshwater Sediment | MWDVLRWFAVFAAAVLVMVAGLYLILGRPLPIPHLF* |
Ga0138514_1000138122 | 3300011003 | Soil | MWDVLRWFAVFVIAVFVIVIGLFWILDKPFPWPQLF* |
Ga0138514_1000152982 | 3300011003 | Soil | MWEVLRWMIVFVLALLLIVVAIYLVTGRPLPIPQF* |
Ga0137458_10515502 | 3300011436 | Soil | MWEVLKWMAVFVAAILVMVAGLYIILGKPLPIPQLF* |
Ga0120148_10001102 | 3300011999 | Permafrost | MWDVLRWFFVFVLAVLILVAGLYWILGKSLPIPHLF* |
Ga0137364_106927532 | 3300012198 | Vadose Zone Soil | MWEVLRWMIVFVFALLLIVAAIYLVTGRPLPIPQF* |
Ga0137383_113018981 | 3300012199 | Vadose Zone Soil | MWEVVRWMIVFVLALLLIVAAIYLVTGQPLSIPQF* |
Ga0137374_106031071 | 3300012204 | Vadose Zone Soil | MAWEVLRWFLVFVLALLLIVAGLFWLMGRPLPFPNF* |
Ga0137381_103663361 | 3300012207 | Vadose Zone Soil | MWEVVRWMIVFVLALLLIVAAIYLVTGRPLPIPQF* |
Ga0137375_103071523 | 3300012360 | Vadose Zone Soil | MGAEAMWDVLRWFAVFVVAVLLIVAGLFLLFGKPLPIPSLF* |
Ga0157216_104032522 | 3300012668 | Glacier Forefield Soil | MWEVLRWFSVFVIAVLVMVAGLYWILGKPLPIPSLF* |
Ga0157305_100841571 | 3300012891 | Soil | MWEVLKWMAVFVIALLLIVAGLFWLMGRPLPIPQF* |
Ga0153915_100264565 | 3300012931 | Freshwater Wetlands | MWDVLRWFAVFVIAILLLVAGLFWIMGRPLPIPNF* |
Ga0153915_108480492 | 3300012931 | Freshwater Wetlands | MWDVLRWFAVFVVAILLLVAGLFWIMGRPLPIPNF* |
Ga0162651_1000969542 | 3300012938 | Soil | MWEVLKWFGVFMLALLLIVAGLFWLMGRPLPIPQF* |
Ga0120181_11309542 | 3300013766 | Permafrost | MWDVLRWFFVFVLAVLILVAGRYGILGKPLPIPHLF* |
Ga0120158_102329851 | 3300013772 | Permafrost | MWDVLRWFAVFVLAVLVLVAGLYWVLGKPLPIPHSSDSLPGH |
Ga0120125_11018882 | 3300014056 | Permafrost | MWDVLRWFSVFVIAILLIVAGLFWIMGRPLPIPSF* |
Ga0075320_10543081 | 3300014255 | Natural And Restored Wetlands | VWEVLKWFAVFVIALLLIVAGLFWLMGRPLPLIPSF* |
Ga0075316_11595782 | 3300014314 | Natural And Restored Wetlands | MWEVLRWFFVFVLALLLMVAGLFWLMGRPLPIPNF* |
Ga0167632_10021244 | 3300015085 | Glacier Forefield Soil | MWDVLRWFAVFVAAILVMVAGLYLILGKPLPVPHLF* |
Ga0167629_11966002 | 3300015209 | Glacier Forefield Soil | MWDVLRWFAVFVLAVLALVAGLYWILGKPLPIPNLF* |
Ga0132258_110674644 | 3300015371 | Arabidopsis Rhizosphere | MWEVLKWFAVFVIALLLIVAGLFWLMGRPLPIPQF* |
Ga0132258_137251832 | 3300015371 | Arabidopsis Rhizosphere | MWEVLKWFAVFVIALLLIVAGLFWLMGRPLPIPSF* |
Ga0132256_1033508621 | 3300015372 | Arabidopsis Rhizosphere | MWEVLKWFAVFVIALLLIVAGLFWLMGRPLPIPTF* |
Ga0132255_1003749363 | 3300015374 | Arabidopsis Rhizosphere | VWNVLKWMAVFVIALLLIVAGLFWLMGRPLPIPQF* |
Ga0184610_10525482 | 3300017997 | Groundwater Sediment | MWDVLRWFAVFVAAVLVIVLGLFWLLDKPFPWPQLF |
Ga0184605_103604442 | 3300018027 | Groundwater Sediment | MWDVLRWFAVFVIAIIVIVVGLYWILDKPLPIPQF |
Ga0184634_105381762 | 3300018031 | Groundwater Sediment | MWDVLRWFAVFVVAVLVLIWGLYLILGQPFPWPELPF |
Ga0184638_10170104 | 3300018052 | Groundwater Sediment | MAWEVLRWFLVFVLALLLIVAGLFWLMGRPLPIPSF |
Ga0184638_11480152 | 3300018052 | Groundwater Sediment | MWDVLRWFAVFVVAILVIVFGLYLILGKPLPIPPLPWF |
Ga0184626_102549942 | 3300018053 | Groundwater Sediment | MWDVLRWFAVFVVAVLVIVVGLFWIFDKPFPWPQLF |
Ga0184623_100148512 | 3300018056 | Groundwater Sediment | MTWEVLRWMALFVIALLLIVAGLFWLMGRPLPIPNF |
Ga0184623_101472872 | 3300018056 | Groundwater Sediment | MWDVLRWFAVFVVAVLVIVAGLFLLFGKPLPIPSLF |
Ga0184623_101738233 | 3300018056 | Groundwater Sediment | MWDVLRWFAVFVAAVLVIVAGLFLLFGKPLPIPSLF |
Ga0184637_102212402 | 3300018063 | Groundwater Sediment | MWEVLKWFGMFVVAMLVIVFGLFWLMGRPIPIPNIF |
Ga0184617_10196523 | 3300018066 | Groundwater Sediment | MWDVVRWFAVFVIAIIVIVVGLYWILDKPLPIPQF |
Ga0184618_100052116 | 3300018071 | Groundwater Sediment | MWDVLRWFAVFVIAILVIVAGLFWILGKPLPIPQLF |
Ga0184618_104016161 | 3300018071 | Groundwater Sediment | MWDVLRWFAVFVIAVLVIVMGLFWLFNKPFPWPQLF |
Ga0184640_105274901 | 3300018074 | Groundwater Sediment | MWDVLRWFAVFVAAVLVIVAGLYIILGRPLPIPQLF |
Ga0184632_103935501 | 3300018075 | Groundwater Sediment | MWDVLRWFAVFVIAILVIVAGLFWIMGRPLPIPSF |
Ga0184609_100278704 | 3300018076 | Groundwater Sediment | MWDVLRWFAVFVAAVLVIVLGLFWLFDRPFPWPQLF |
Ga0184633_100063205 | 3300018077 | Groundwater Sediment | MWDVVRWFAVFVVAILVIVFGLYLILGKPFPWPQLPF |
Ga0184612_101757312 | 3300018078 | Groundwater Sediment | MWDVLRWFAVFVAAILVIVLGLFWLLDKPFPWPQLF |
Ga0184612_104522502 | 3300018078 | Groundwater Sediment | MWDVLRWFAVFVVAVLVLVVGLYWILGRPFPWPHLPF |
Ga0184625_102593332 | 3300018081 | Groundwater Sediment | MWDVLRWFAVFVVAVLVIVIGLFWLFDKPFPWPQLF |
Ga0184629_104496432 | 3300018084 | Groundwater Sediment | MWDVLRWFAVFVIAVLLIVAGLFLVFGKPLPIPQLF |
Ga0190272_118529432 | 3300018429 | Soil | MAWEVLRWFAVFVIAMLLIVAGIFWLLDRPLPFPRF |
Ga0066667_106406961 | 3300018433 | Grasslands Soil | SRAMWEVLRWMIVFVLALLLIVAAIYLVTGRPLPIPQF |
Ga0066662_114457222 | 3300018468 | Grasslands Soil | MWEVVRWMIVFVLALLLIVAAIYLVTGQPLPIPQF |
Ga0190270_132169381 | 3300018469 | Soil | MWDVVRWFAVFVIAVFVLIAGLYWILGKPLPIPSLF |
Ga0184643_12127212 | 3300019255 | Groundwater Sediment | MWDVLRWFAVFVIAVLLIVAGIYFVLGRPLPLPQLF |
Ga0193741_11062201 | 3300019884 | Soil | MWDVLRWFAVFVVAVLVIVAGLFLLFGKPLPIPSF |
Ga0193751_100029842 | 3300019888 | Soil | MWDVLRWFSVFVIAILLIVAGLFWIMGRPLPIPQF |
Ga0210382_100302093 | 3300021080 | Groundwater Sediment | MGWEVMRWFAMFIIAILLIVAGLFWLMGRPLPFPQF |
Ga0193719_100830862 | 3300021344 | Soil | VWDVLKWMLVFVAAVSVLVAGLYLILGKPLPIPHLF |
Ga0193719_101248252 | 3300021344 | Soil | MWDVLRWFAVFVIAVLVIVAGLFWIMGRPLPIPQLF |
Ga0193695_10397901 | 3300021418 | Soil | MWDVLRWFAVFVIAVLVIVAGIFWIFGKPLPIPQLF |
Ga0224500_100465812 | 3300022213 | Sediment | MWDVLRWFAVFVIAVLVMVAGLYWILGKPLPIPNLF |
Ga0222623_103741721 | 3300022694 | Groundwater Sediment | ESAMTWEVLRWMALFVIALLLIVAGLFWLMGRPLPIPNF |
Ga0209618_10318703 | 3300025001 | Soil | MWDVLRWFSVFVIAVLVMVAGLYWILGKPLPIPSLF |
Ga0209109_100296153 | 3300025160 | Soil | MWDVLRWFAVFIAAVLVLVFGLYLILGKPLPLPQIF |
Ga0209109_102403662 | 3300025160 | Soil | MWDVLRWFAVFVAAILVIVAGLYIILGKPLPIPQLF |
Ga0209108_101482542 | 3300025165 | Soil | MWDVLRWFAVFVAAILVIVAGLYIILGKPLPIPHLF |
Ga0209431_101898123 | 3300025313 | Soil | MWEVLKWFGLFVLAMLTIVAGLFWLMGRPITIPNLF |
Ga0209431_102197322 | 3300025313 | Soil | MWDVLRWFAVFVVAILVIVFGLYLILGQPLPIPGLPWF |
Ga0209431_102903052 | 3300025313 | Soil | MWDVLRWFAVFVAAVLVIVFGLYLILGKPLPIPQIF |
Ga0210132_10257601 | 3300025538 | Natural And Restored Wetlands | MWDVVRWFAVFVIAILVIVAGLFWIMGRSLPIPNF |
Ga0210076_10152682 | 3300025567 | Natural And Restored Wetlands | VWEVLKWFAVFVIALLLIVAGLFWLMGRPLPFIPSF |
Ga0207684_100140581 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LGSRAMWEVLRWMIVFVLALLLIVAAIYLVTGRPLPIPQF |
Ga0207684_100515615 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGSRAMWEVLRWMIVFVLALLLIVAAIYLVTGRALPIPQF |
Ga0207646_1000191310 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MWEVLRWMIVFILALLLIVAAIYLVAGRPLPIPQF |
Ga0207646_101368742 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MWDVLRWFAVFVIAVLVIVIGLFWLFNKPFPWPQLF |
Ga0207646_104566462 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MWDVLRWFAVFVIAILVIVAGLFWIFGKPLPIPQF |
Ga0207646_104766132 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MWDVFRWFAVFVIAMLVMVAGLYFVLGKPLPIPSLF |
Ga0207644_118310002 | 3300025931 | Switchgrass Rhizosphere | VWEVLKWMAVFVLALLLIVAGLFWLMGRPLPIPNF |
Ga0208415_10111612 | 3300025993 | Rice Paddy Soil | MWEVLRWFLVFVLALLLIVAGLFWLMGRPLPIPNF |
Ga0208529_10252112 | 3300026008 | Rice Paddy Soil | MWEVLRWMIVFVLALLLIVAGIYLVLGEPLPIPQF |
Ga0207708_103670162 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VWEVLKWMAVFVIALLLIVAGLFWLMGRPLPIPQF |
Ga0209919_10096622 | 3300026196 | Soil | MWEVLRWFAVFVLALLLIVAGLFWLMGRPLPIPNF |
Ga0209919_12306621 | 3300026196 | Soil | MWEVLRWMIVFIAALLLIVAGIYWVLGRPLPIPSF |
Ga0209159_10938802 | 3300026343 | Soil | MWEVLRWMIVFVLALLLIVTAIYLVTGRPLPIPQF |
Ga0256867_102775612 | 3300026535 | Soil | MWEVLRWFAVFVLALLLMVAGLFWLMGRPLPIPDF |
Ga0209805_13438512 | 3300026542 | Soil | MWEVLRWMIVFVLALLLIVAAIYLVTGRTLPIPQF |
Ga0209577_100397873 | 3300026552 | Soil | MWEVLRWMIVFVLALLLIVVAIYLVTGRPLPIPQF |
Ga0209999_10394103 | 3300027543 | Arabidopsis Thaliana Rhizosphere | WDVVRWFAVFVIAVFVLIAGLYWILGKPLPIPSLF |
Ga0214468_10502603 | 3300027647 | Soil | GAQPMWEVLRWFAVFVLALLLIVAGLFWLMGRPLPIPNF |
Ga0256866_10029783 | 3300027650 | Soil | MWEVLKWFAVFVIALLLMVAGLFWLMGRPLPIPEF |
Ga0209166_100191685 | 3300027857 | Surface Soil | MWEVLRWMIVFVLAVLLIVAAIYLVLGQPLPIPQF |
Ga0268264_111087182 | 3300028381 | Switchgrass Rhizosphere | MWDVLRWFAVFVIAVLVLIAGVYLVLGKPLPIPSLF |
Ga0307303_100042852 | 3300028713 | Soil | MWEVLKWFAVFVIALLLIVAGLFWLMGRPLPFLPQF |
Ga0307320_104566921 | 3300028771 | Soil | AMTWEVLRWMALFVIALLLIVAGLFWLMGRPLPIPNF |
Ga0307282_101706102 | 3300028784 | Soil | MWDVLRWFAVFVLAVLLLVAGLYWILGKPLPIPHLF |
Ga0307282_101785462 | 3300028784 | Soil | MWDVLRWFAVFVVAVLVIVLGLFWLFDKPFPWPQLF |
Ga0307504_100100922 | 3300028792 | Soil | MWDVLRWFAVFIAAILVLVAGLYLILGKPLPIPHLF |
Ga0307281_103655342 | 3300028803 | Soil | SIGAEAMWDVLRWFLVFVVAVLVIVTGLFLLFGKPLPIPQLF |
Ga0307281_103742431 | 3300028803 | Soil | MWDVLRWFLVFVVAVLVIVTGLFLLFGKPLPIPQLF |
Ga0307296_100553353 | 3300028819 | Soil | MWDVLRWFAVFVAAILVIVLGLFWLMDKPFPWPQLF |
Ga0307312_100189373 | 3300028828 | Soil | MWDVLRWFAVFVVAVLVIVLGLFWLLDKPFPWPQLF |
Ga0299907_100395895 | 3300030006 | Soil | MWEVLKWMIVFVLSLLLIVAGLFWLMGRPLPIPEF |
Ga0247826_104700871 | 3300030336 | Soil | NRSAMWDVVRWFAVFVIAVFVLIAGLYWILGKPLPIPSLF |
Ga0299914_101724324 | 3300031228 | Soil | MWEVLRWFAVFVFALLLIVAGLFWLMGRPLPIPQF |
Ga0299914_104664302 | 3300031228 | Soil | MWEVLRWLGVFAIALLLIVAGLFWLMGRPLPIPQF |
Ga0299913_105777562 | 3300031229 | Soil | MWEVLRWFAVFVIALLLIVAGLFWLMGRPLPIPQF |
Ga0315556_10731252 | 3300031256 | Salt Marsh Sediment | MWEVLRWMIVFVLAVLLIVMGIYLLLGRPLPIPQF |
Ga0310813_101126732 | 3300031716 | Soil | MWDVLRWFAVFVIAVLLIVAGLFLVLGKPLPIPSLF |
Ga0310813_111837372 | 3300031716 | Soil | MWEVLKWFAVFVIALLLIVAGLFWLMGRPLPIPQF |
Ga0307468_1009602862 | 3300031740 | Hardwood Forest Soil | MWEVLKWFGVFMLALLLIVAGLFWLMGRPLPIPQF |
Ga0214473_100601785 | 3300031949 | Soil | MWDVLRWFLVFVVAVLVIVMGLFLLFGKPLPIPSLF |
Ga0315540_100220482 | 3300032061 | Salt Marsh Sediment | MWEVLRWMIVFVLALLLIVAGIYLVLGQPLPIPQF |
Ga0315281_1000423722 | 3300032163 | Sediment | MWDVLRWFAVFVAAILVIVAILYLIMGRPLPIPNF |
Ga0214472_1000430618 | 3300033407 | Soil | MWDVLRWFAVFVIAVLVIVAGLFLVFGKPLPIPQLF |
Ga0326726_118790362 | 3300033433 | Peat Soil | MWDVLRWFAVFAAAVLIMIAGLYWVLGKPLPIPHLF |
Ga0326731_10753651 | 3300033502 | Peat Soil | MWDVLRWFAVFAAAVLIIIAGLYWVLGKPLPIPHLF |
Ga0364930_0065469_777_890 | 3300033814 | Sediment | MWDVLRWFAVFVAAIIMIVFGLYWVMGKPLPIPQLPF |
Ga0370484_0014174_938_1048 | 3300034125 | Untreated Peat Soil | MWDVLRWFAVFLAAIMVMVAGLYLVLGRPLPIPHLF |
⦗Top⦘ |