Basic Information | |
---|---|
Family ID | F037368 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 43 residues |
Representative Sequence | RQDVNLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI |
Number of Associated Samples | 144 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.61 % |
% of genes near scaffold ends (potentially truncated) | 97.62 % |
% of genes from short scaffolds (< 2000 bps) | 88.69 % |
Associated GOLD sequencing projects | 138 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.238 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.714 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.762 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.048 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 20.29% Coil/Unstructured: 55.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF00330 | Aconitase | 17.86 |
PF00072 | Response_reg | 14.29 |
PF00486 | Trans_reg_C | 13.10 |
PF01169 | UPF0016 | 5.95 |
PF08521 | 2CSK_N | 4.17 |
PF10129 | OpgC_C | 3.57 |
PF01263 | Aldose_epim | 1.79 |
PF00694 | Aconitase_C | 1.79 |
PF04966 | OprB | 1.79 |
PF13432 | TPR_16 | 1.79 |
PF13561 | adh_short_C2 | 1.19 |
PF00210 | Ferritin | 1.19 |
PF07732 | Cu-oxidase_3 | 1.19 |
PF14803 | Nudix_N_2 | 0.60 |
PF01968 | Hydantoinase_A | 0.60 |
PF00482 | T2SSF | 0.60 |
PF04828 | GFA | 0.60 |
PF03721 | UDPG_MGDP_dh_N | 0.60 |
PF03446 | NAD_binding_2 | 0.60 |
PF00005 | ABC_tran | 0.60 |
PF00211 | Guanylate_cyc | 0.60 |
PF04324 | Fer2_BFD | 0.60 |
PF02705 | K_trans | 0.60 |
PF04542 | Sigma70_r2 | 0.60 |
PF00383 | dCMP_cyt_deam_1 | 0.60 |
PF14833 | NAD_binding_11 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 5.95 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 4.17 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 1.79 |
COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 1.79 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 1.19 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.60 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.60 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.60 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.60 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.60 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.60 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.60 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.60 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.60 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.83 % |
Unclassified | root | N/A | 29.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_101094715 | Not Available | 683 | Open in IMG/M |
3300004081|Ga0063454_100465004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 875 | Open in IMG/M |
3300004092|Ga0062389_102763299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
3300004157|Ga0062590_100684203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300005436|Ga0070713_100115642 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
3300005458|Ga0070681_10339782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1411 | Open in IMG/M |
3300005524|Ga0070737_10328006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 601 | Open in IMG/M |
3300005534|Ga0070735_10224107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1145 | Open in IMG/M |
3300005545|Ga0070695_100778060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
3300005568|Ga0066703_10345833 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005764|Ga0066903_100690088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1797 | Open in IMG/M |
3300006173|Ga0070716_101140285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
3300006797|Ga0066659_11624172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300006804|Ga0079221_11259641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 579 | Open in IMG/M |
3300006903|Ga0075426_11369204 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300007265|Ga0099794_10557158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
3300009038|Ga0099829_10602012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 914 | Open in IMG/M |
3300009089|Ga0099828_10167965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1947 | Open in IMG/M |
3300009089|Ga0099828_11095617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
3300009090|Ga0099827_11846966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
3300009094|Ga0111539_12295295 | Not Available | 626 | Open in IMG/M |
3300009137|Ga0066709_101124239 | Not Available | 1155 | Open in IMG/M |
3300009551|Ga0105238_12767778 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300009792|Ga0126374_11695814 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300009824|Ga0116219_10236271 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300010048|Ga0126373_10737619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1045 | Open in IMG/M |
3300010112|Ga0127458_1041414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
3300010323|Ga0134086_10284702 | Not Available | 638 | Open in IMG/M |
3300010358|Ga0126370_12660771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300010361|Ga0126378_11863727 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300010364|Ga0134066_10316113 | Not Available | 566 | Open in IMG/M |
3300010366|Ga0126379_12454249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 620 | Open in IMG/M |
3300010398|Ga0126383_10138204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2253 | Open in IMG/M |
3300010398|Ga0126383_11783271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
3300010398|Ga0126383_13596444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
3300011271|Ga0137393_10086678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2530 | Open in IMG/M |
3300011444|Ga0137463_1203789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
3300012189|Ga0137388_10092987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2572 | Open in IMG/M |
3300012198|Ga0137364_10867070 | Not Available | 683 | Open in IMG/M |
3300012212|Ga0150985_102275636 | Not Available | 500 | Open in IMG/M |
3300012212|Ga0150985_106931163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1397 | Open in IMG/M |
3300012212|Ga0150985_118364305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
3300012350|Ga0137372_10372147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
3300012362|Ga0137361_10363688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1328 | Open in IMG/M |
3300012469|Ga0150984_106491765 | Not Available | 1202 | Open in IMG/M |
3300012469|Ga0150984_106541244 | Not Available | 505 | Open in IMG/M |
3300012469|Ga0150984_114044156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
3300012927|Ga0137416_11594162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
3300014168|Ga0181534_10293665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 874 | Open in IMG/M |
3300016270|Ga0182036_11033839 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300016319|Ga0182033_10098875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2140 | Open in IMG/M |
3300016319|Ga0182033_10292139 | Not Available | 1342 | Open in IMG/M |
3300016341|Ga0182035_10683104 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300016357|Ga0182032_10134191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1807 | Open in IMG/M |
3300016371|Ga0182034_11018485 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 716 | Open in IMG/M |
3300016387|Ga0182040_11452757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
3300016404|Ga0182037_10545244 | Not Available | 978 | Open in IMG/M |
3300016404|Ga0182037_12157898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300016445|Ga0182038_10929311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Aliidongia → Aliidongia dinghuensis | 768 | Open in IMG/M |
3300017822|Ga0187802_10372555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 563 | Open in IMG/M |
3300017822|Ga0187802_10431444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
3300017933|Ga0187801_10363917 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300018085|Ga0187772_10394186 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300018085|Ga0187772_11271102 | Not Available | 544 | Open in IMG/M |
3300019786|Ga0182025_1171755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3451 | Open in IMG/M |
3300019883|Ga0193725_1076574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 819 | Open in IMG/M |
3300020068|Ga0184649_1126186 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 667 | Open in IMG/M |
3300020581|Ga0210399_10001397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18857 | Open in IMG/M |
3300020583|Ga0210401_10141314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2252 | Open in IMG/M |
3300021170|Ga0210400_11331910 | Not Available | 574 | Open in IMG/M |
3300021388|Ga0213875_10151895 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1085 | Open in IMG/M |
3300021388|Ga0213875_10264411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
3300021403|Ga0210397_10384267 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300021406|Ga0210386_11815767 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300021420|Ga0210394_10162914 | Not Available | 1939 | Open in IMG/M |
3300021420|Ga0210394_11705060 | Not Available | 528 | Open in IMG/M |
3300021433|Ga0210391_10454441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1006 | Open in IMG/M |
3300021474|Ga0210390_11434666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
3300021475|Ga0210392_10314091 | Not Available | 1126 | Open in IMG/M |
3300021478|Ga0210402_10544990 | Not Available | 1076 | Open in IMG/M |
3300021479|Ga0210410_10748562 | Not Available | 860 | Open in IMG/M |
3300021559|Ga0210409_11291938 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300021560|Ga0126371_10748437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1124 | Open in IMG/M |
3300021560|Ga0126371_12362741 | Not Available | 643 | Open in IMG/M |
3300021860|Ga0213851_1801391 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300022507|Ga0222729_1070036 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300022525|Ga0242656_1074306 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
3300022531|Ga0242660_1025278 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300022533|Ga0242662_10068690 | Not Available | 954 | Open in IMG/M |
3300025901|Ga0207688_10719703 | Not Available | 632 | Open in IMG/M |
3300025912|Ga0207707_10289662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1417 | Open in IMG/M |
3300025929|Ga0207664_10078597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2676 | Open in IMG/M |
3300025930|Ga0207701_10152135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2050 | Open in IMG/M |
3300026335|Ga0209804_1317301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
3300026359|Ga0257163_1053449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
3300026552|Ga0209577_10557018 | Not Available | 725 | Open in IMG/M |
3300027110|Ga0208488_1060427 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300027297|Ga0208241_1011233 | Not Available | 1263 | Open in IMG/M |
3300027701|Ga0209447_10072369 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300027737|Ga0209038_10077388 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300027783|Ga0209448_10077934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1112 | Open in IMG/M |
3300027812|Ga0209656_10376426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
3300027903|Ga0209488_11125991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300027905|Ga0209415_10809058 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300027907|Ga0207428_10892004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
3300027968|Ga0209061_1182088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 657 | Open in IMG/M |
3300027986|Ga0209168_10113062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1395 | Open in IMG/M |
3300029907|Ga0311329_11033987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Aliidongia → Aliidongia dinghuensis | 507 | Open in IMG/M |
3300029944|Ga0311352_10294806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1353 | Open in IMG/M |
3300030741|Ga0265459_14109686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 511 | Open in IMG/M |
3300030843|Ga0075392_10605047 | Not Available | 562 | Open in IMG/M |
3300030937|Ga0138302_1823181 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300031469|Ga0170819_13030857 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300031543|Ga0318516_10194658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1170 | Open in IMG/M |
3300031544|Ga0318534_10398030 | Not Available | 791 | Open in IMG/M |
3300031545|Ga0318541_10026555 | All Organisms → cellular organisms → Bacteria | 2830 | Open in IMG/M |
3300031546|Ga0318538_10371554 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300031549|Ga0318571_10427846 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
3300031572|Ga0318515_10407012 | Not Available | 728 | Open in IMG/M |
3300031679|Ga0318561_10164013 | Not Available | 1197 | Open in IMG/M |
3300031681|Ga0318572_10399226 | Not Available | 817 | Open in IMG/M |
3300031723|Ga0318493_10119539 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300031724|Ga0318500_10115981 | Not Available | 1233 | Open in IMG/M |
3300031724|Ga0318500_10669399 | Not Available | 528 | Open in IMG/M |
3300031736|Ga0318501_10548442 | Not Available | 633 | Open in IMG/M |
3300031748|Ga0318492_10228582 | Not Available | 958 | Open in IMG/M |
3300031748|Ga0318492_10358529 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300031753|Ga0307477_10390569 | Not Available | 954 | Open in IMG/M |
3300031753|Ga0307477_10526674 | Not Available | 801 | Open in IMG/M |
3300031753|Ga0307477_10922520 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300031763|Ga0318537_10276884 | Not Available | 621 | Open in IMG/M |
3300031770|Ga0318521_10005436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5002 | Open in IMG/M |
3300031770|Ga0318521_10850923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
3300031770|Ga0318521_10971854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
3300031782|Ga0318552_10285802 | Not Available | 838 | Open in IMG/M |
3300031792|Ga0318529_10435449 | Not Available | 610 | Open in IMG/M |
3300031796|Ga0318576_10154390 | Not Available | 1071 | Open in IMG/M |
3300031798|Ga0318523_10276972 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300031798|Ga0318523_10320206 | Not Available | 773 | Open in IMG/M |
3300031823|Ga0307478_10946819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 720 | Open in IMG/M |
3300031823|Ga0307478_11506374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
3300031845|Ga0318511_10008250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3418 | Open in IMG/M |
3300031879|Ga0306919_10432114 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300031880|Ga0318544_10016080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2448 | Open in IMG/M |
3300031893|Ga0318536_10695244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
3300031896|Ga0318551_10160362 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300031910|Ga0306923_12148514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
3300031941|Ga0310912_10713615 | Not Available | 777 | Open in IMG/M |
3300031945|Ga0310913_10395964 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300032041|Ga0318549_10032233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2071 | Open in IMG/M |
3300032042|Ga0318545_10058306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1315 | Open in IMG/M |
3300032043|Ga0318556_10219574 | Not Available | 990 | Open in IMG/M |
3300032064|Ga0318510_10158367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
3300032066|Ga0318514_10749730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
3300032068|Ga0318553_10016549 | All Organisms → cellular organisms → Bacteria | 3357 | Open in IMG/M |
3300032091|Ga0318577_10332384 | Not Available | 726 | Open in IMG/M |
3300032094|Ga0318540_10147033 | Not Available | 1128 | Open in IMG/M |
3300032205|Ga0307472_100660075 | Not Available | 934 | Open in IMG/M |
3300032205|Ga0307472_100834915 | Not Available | 846 | Open in IMG/M |
3300032205|Ga0307472_101692426 | Not Available | 625 | Open in IMG/M |
3300032515|Ga0348332_10854037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1106 | Open in IMG/M |
3300032805|Ga0335078_11313123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
3300033158|Ga0335077_11646683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
3300033290|Ga0318519_10235906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
3300033407|Ga0214472_11749710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.36% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.38% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.38% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.79% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.79% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.79% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.79% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.19% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.19% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.19% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.19% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.19% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.60% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.60% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.60% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.60% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.60% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.60% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.60% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030843 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1010947151 | 3300002245 | Forest Soil | YWRHHGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0063454_1004650041 | 3300004081 | Soil | QPDIAPTIDRRQDVNLLYWRHRGRSYALAGQTDVGYLWGIANDVGWQLNAL* |
Ga0062389_1027632991 | 3300004092 | Bog Forest Soil | RQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV* |
Ga0062590_1006842031 | 3300004157 | Soil | DIAPTFERRQDVNMLYWRHQGRAYALAGQTDIGWLWGIANDVAWQLDAI* |
Ga0070713_1001156421 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI* |
Ga0070681_103397823 | 3300005458 | Corn Rhizosphere | PTFDKRQDLNLLYWRHQGRASVLVGQTEIGWLWGIANDVAWQLDAI* |
Ga0070737_103280061 | 3300005524 | Surface Soil | DRREDLNILYWRHHGHAYALVGAADIGYLWNIYNDIAWQLDAI* |
Ga0070735_102241073 | 3300005534 | Surface Soil | PTTAQRQDLKLLYWRHQGRASVLVGQSDLGYLWNIANDVAWQLDAI* |
Ga0070695_1007780601 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DVNMLYWRHHGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0066703_103458331 | 3300005568 | Soil | VNLLYWRHEGRAYALVGQAEIGYLWGIANDVAWQLDAI* |
Ga0066903_1006900883 | 3300005764 | Tropical Forest Soil | YWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV* |
Ga0070716_1011402852 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | YWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0066659_116241721 | 3300006797 | Soil | PPTLARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI* |
Ga0079221_112596411 | 3300006804 | Agricultural Soil | SSKADLAPTFDRREDLNILYWRHHGHAYALVGAADIGYLWNIYNDIAWQLDAI* |
Ga0075426_113692041 | 3300006903 | Populus Rhizosphere | DISPTLARRQDVNLLYWRHQGRAYALAGQADVGYLWGIANDVAWQLDAI* |
Ga0099794_105571583 | 3300007265 | Vadose Zone Soil | LARRQDVNLLYWRHQGRSYALVGQSDVGYLWGIANDVAWQLDAI* |
Ga0099829_106020122 | 3300009038 | Vadose Zone Soil | LLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0099828_101679654 | 3300009089 | Vadose Zone Soil | QDVNMLYWRHQGRAYALVGQTYIGYLWGIANDVAWQLDAI* |
Ga0099828_110956172 | 3300009089 | Vadose Zone Soil | LYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0099827_118469662 | 3300009090 | Vadose Zone Soil | LYWRHQGRAYALVGQSDIGYLWGIANDVAWQLDAI* |
Ga0111539_122952952 | 3300009094 | Populus Rhizosphere | SPTIERRQDVNLLYWRNQGRAYALVGQADIGYLWGIANDIAWQLRAL* |
Ga0066709_1011242391 | 3300009137 | Grasslands Soil | DRRQDVNLLYWRHDGRAYALVGQADIGYLWGIANEVAWQLDAI* |
Ga0105238_127677782 | 3300009551 | Corn Rhizosphere | YWRHQGRAYVLTGQTDIGYLWGIANDVAWQLAAI* |
Ga0126374_116958141 | 3300009792 | Tropical Forest Soil | QPDISPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV* |
Ga0116219_102362711 | 3300009824 | Peatlands Soil | QPDMAPTPGKRQDLNLLYWRHQGRASVLVGASEIGYLWGIANDVAWQLDAI* |
Ga0126373_107376192 | 3300010048 | Tropical Forest Soil | DLNILYWRHHGHAYALVGTADIGYLWNIYNDIAWQLDAI* |
Ga0127458_10414141 | 3300010112 | Grasslands Soil | TPPTLARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI* |
Ga0134086_102847021 | 3300010323 | Grasslands Soil | RQDVNLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0126370_126607711 | 3300010358 | Tropical Forest Soil | PDLAPTLARRQDVNLLYWRHQGRAYALVGQADTGYLWGIANDVAWQLDAI* |
Ga0126378_118637272 | 3300010361 | Tropical Forest Soil | FERRQDLNLLYWRHQGRASVLVGQSEIGYLWGIANDVAWRLDAI* |
Ga0134066_103161132 | 3300010364 | Grasslands Soil | VNMLYWRHHGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0126379_124542491 | 3300010366 | Tropical Forest Soil | KEPDIPPTLARRQDVNLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0126383_101382041 | 3300010398 | Tropical Forest Soil | TFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV* |
Ga0126383_117832712 | 3300010398 | Tropical Forest Soil | SKQPDISPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV* |
Ga0126383_135964441 | 3300010398 | Tropical Forest Soil | RRQDVNLLYWRHQGRSYALVGQCDIGYLWGIANDVAWQLDAV* |
Ga0137393_100866781 | 3300011271 | Vadose Zone Soil | VNLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0137463_12037892 | 3300011444 | Soil | KQPDISPTFDRRQDVNMLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0137388_100929871 | 3300012189 | Vadose Zone Soil | QDVNLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0137364_108670701 | 3300012198 | Vadose Zone Soil | ASKQPDIQPTFDRRQDVNMLYWRHHGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0150985_1022756361 | 3300012212 | Avena Fatua Rhizosphere | QDVNLLYWRNQGRAYALVGQADIGYLWGIANDIAWQLRAI* |
Ga0150985_1069311631 | 3300012212 | Avena Fatua Rhizosphere | QPDLSPTIERRQDVNLLYWRNQGRAYALVGQADIGYLWGIANDIAWQLRTL* |
Ga0150985_1183643051 | 3300012212 | Avena Fatua Rhizosphere | LLYWRHHGRSYALVGQTDIGYLWGIANDVGWQLNAL* |
Ga0137372_103721472 | 3300012350 | Vadose Zone Soil | LYWRHQGRAYTLVGQTDIGYLWGIANDVAWQLDAI* |
Ga0137361_103636881 | 3300012362 | Vadose Zone Soil | DIAPTFDRRQDVNMLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0134057_12740792 | 3300012396 | Grasslands Soil | GSSKLPNISPTFDRRQDVNLLYWRHQGRAYALVGQAEIGYLWGIANDVAWQLDAI* |
Ga0150984_1064917652 | 3300012469 | Avena Fatua Rhizosphere | LARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVGWQLDAI* |
Ga0150984_1065412442 | 3300012469 | Avena Fatua Rhizosphere | KQPDLSPTIERRQDVNLLYWRNQGRAYALVGQADIGYLWGIANDIAWQLRTL* |
Ga0150984_1140441563 | 3300012469 | Avena Fatua Rhizosphere | IDRKQDVNLLYWRHHGRSYALVVQTDIGYLWGIANDVGWQLNAL* |
Ga0137416_115941621 | 3300012927 | Vadose Zone Soil | RRQDVNMLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI* |
Ga0181534_102936652 | 3300014168 | Bog | KPDLAPTFDRRGDLNLLYWRHHGHEYALVGTADIGYLWNISNDIAWQLDAI* |
Ga0182036_110338392 | 3300016270 | Soil | PTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQMDAV |
Ga0182033_100988751 | 3300016319 | Soil | SPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0182033_102921391 | 3300016319 | Soil | KQPDISPTFDRRQDVNLLYWRHQGRAYALVGQAEIGYLWGIANDVAWQLDAV |
Ga0182035_106831042 | 3300016341 | Soil | FDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0182032_101341913 | 3300016357 | Soil | TFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0182034_110184851 | 3300016371 | Soil | SSKQPDISPTFDRRQDVNLLYWRHQGRAYALVGQAEIGYLWGIANDVAWQLDAV |
Ga0182040_114527572 | 3300016387 | Soil | LLYWRHQGRAYALVGQADIGYLWGIGNDVAWQLDAI |
Ga0182037_105452442 | 3300016404 | Soil | QDVNLLYWRHQGRAYALVGQADTGYLWGIANDVAWQLDAI |
Ga0182037_121578982 | 3300016404 | Soil | DRRQDVNLLYWRHQGRAYALVGQANIGYLWGIANDVAWQLDAV |
Ga0182038_109293112 | 3300016445 | Soil | FDQRQGVNQLYWRHHGHAYVLVGQANVGYLWGIANDVAWQLDAI |
Ga0187802_103725551 | 3300017822 | Freshwater Sediment | AESSKSDLAPTFDRREDLNILYWRHHGHAYALVGTADIGYLWNIYNDIAWQLDAI |
Ga0187802_104314441 | 3300017822 | Freshwater Sediment | TKQPDLAPTPGQRQDLKLLYWRHQGRASVLVGQSDLGYLWGIANDVAWQLDAI |
Ga0187801_103639171 | 3300017933 | Freshwater Sediment | QDLNLLYWRHQGRASVLVGQSEIGYLWGIANDVAWQLDAI |
Ga0187772_103941862 | 3300018085 | Tropical Peatland | PTFERRQDLNLLYWRHQGRASVLVGQSEIGYLWGIANDVAWQLDAI |
Ga0187772_112711022 | 3300018085 | Tropical Peatland | RRPDIPPTFNRRQDVNLLYWRHQGRAYALVGQTDIGYLWGIGNDVAWQLDAI |
Ga0182025_11717557 | 3300019786 | Permafrost | LYWRHQGHAYGLVGQTDIGYLWNLGNDIAWQLDAI |
Ga0193725_10765742 | 3300019883 | Soil | RQDVNMLYWRHQGRAYALVGQTDIGWLWGIANDVAWQLDAI |
Ga0184649_11261862 | 3300020068 | Groundwater Sediment | LYWRHQGRAYALAGQTDIGYLWGIANDVAWQLDAI |
Ga0210399_1000139720 | 3300020581 | Soil | SSKLPNISPTFDRRQDVNLLYWRHEGRAYALVGQAEIGYLWGIANDVAWQLDAI |
Ga0210401_101413141 | 3300020583 | Soil | SQRQDLKLLYWRHAGRASVLIGASEIGYLWNIANDVAWQLDAI |
Ga0210406_111432071 | 3300021168 | Soil | GSSKQPDIPPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0210400_113319101 | 3300021170 | Soil | KQPDIQPTFDRRQDVNMLYWRHHGRAYALVGQTDIGYLWGIANDVAWQLDAI |
Ga0213875_101518953 | 3300021388 | Plant Roots | QDVNLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI |
Ga0213875_102644113 | 3300021388 | Plant Roots | AELQPTFGRRQDVNLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI |
Ga0210397_103842671 | 3300021403 | Soil | MLYWRHQGRAYVLVGQADAGYLWGIGNDVAWQLDAI |
Ga0210386_118157672 | 3300021406 | Soil | QPDIEPTPGKRQDLNLLYWRHQGRASVLVGASEIGYLWNIARDVAWQLDAI |
Ga0210394_101629142 | 3300021420 | Soil | LYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0210394_117050601 | 3300021420 | Soil | RQDVNLLYWRHQDRAYALVGQTDIGYLWGIANDVAWQLDAI |
Ga0210391_104544411 | 3300021433 | Soil | RRGDLNLLYWRYHGHEYALVGAADIGYLWNISKDIAWQLDAI |
Ga0210390_114346661 | 3300021474 | Soil | QDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0210392_103140911 | 3300021475 | Soil | ARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0210402_105449901 | 3300021478 | Soil | NLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0210410_107485621 | 3300021479 | Soil | LLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0210409_112919382 | 3300021559 | Soil | DTPPTLARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0126371_107484371 | 3300021560 | Tropical Forest Soil | IAPTFDRRQDVNMLYWRHQGRAYVLAGQADVGYLWGIGNDVAWQLDAI |
Ga0126371_123627412 | 3300021560 | Tropical Forest Soil | PTPARRQDINLLYWRHQGRAYALVGQSDIGYLWGIANDVAWQLDAI |
Ga0213851_18013911 | 3300021860 | Watersheds | RQDVNLIYWRHQGRAYALVGQANIGYLWGIGNDVAWQLDAI |
Ga0222729_10700361 | 3300022507 | Soil | PTFDRRQDVNLLYWRHEGRAYALVGQAEIGYLWGIANDVAWQLDAI |
Ga0242656_10743061 | 3300022525 | Soil | PPTLARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0242660_10252782 | 3300022531 | Soil | SKEPDTPPTLARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0242662_100686902 | 3300022533 | Soil | DVNLLYWRHQGRAYALVGQTAVGYLWGIANDVAWQLDAI |
Ga0207688_107197032 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | IERRQDVNLLYWRNQGRAYALVGQADIGYLWGIANDIAWQLRAL |
Ga0207707_102896623 | 3300025912 | Corn Rhizosphere | PTFDKRQDLNLLYWRHQGRASVLVGQTEIGWLWGIANDVAWQLDAI |
Ga0207664_100785973 | 3300025929 | Agricultural Soil | NLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLNAI |
Ga0207701_101521353 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | DKRQDLNMLYWRHQGRAYVLTGQTDIGYLWGIANDVAWQLAAI |
Ga0209804_13173011 | 3300026335 | Soil | LARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0257163_10534491 | 3300026359 | Soil | QDVNLLYWRHQGRSYALVGQSDVGYLWGIANDVAWQLDAI |
Ga0209577_105570181 | 3300026552 | Soil | MLYWRHHGRAYALVGQTDIGYLWGIANDVAWQLDAI |
Ga0208488_10604272 | 3300027110 | Forest Soil | TKQSDIAPTFERRQDLNLLYWRHQGRASVLVGQSEIGYLWGIANDIAWQLDAI |
Ga0208241_10112332 | 3300027297 | Forest Soil | PTLARRQDVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0209447_100723691 | 3300027701 | Bog Forest Soil | SPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAI |
Ga0209038_100773882 | 3300027737 | Bog Forest Soil | PDISPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAI |
Ga0209448_100779343 | 3300027783 | Bog Forest Soil | RQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0209656_103764261 | 3300027812 | Bog Forest Soil | PDISPTFDRRQDVNLLYWRHQGRAYALVGQANIGYLWGIANDVAWQLDAV |
Ga0209488_111259911 | 3300027903 | Vadose Zone Soil | ALARRQDVNLLYWRHQGRSYALVGQSDVGYLWGIANDVAWQLDAI |
Ga0209415_108090581 | 3300027905 | Peatlands Soil | DILPTSDKRQGLNLLYWRHQGRASVLVGQSEIGYLWGIANDVAWQLDAI |
Ga0207428_108920043 | 3300027907 | Populus Rhizosphere | TLLYWRHAGRAYALVGRGDLGYLWGIAKDLAYQLDPI |
Ga0209061_11820881 | 3300027968 | Surface Soil | PPTFARRQQVNLLYWRHQGRSYVLAGQADIGYLWGIANDIAWQLDAI |
Ga0209168_101130621 | 3300027986 | Surface Soil | LPTTAQRQDLKLLYWRHQGRASVLVGQSDLGYLWNIANDVAWQLDAI |
Ga0311329_110339872 | 3300029907 | Bog | EGVNLLYWRHQGHGYALVGSADKGWMWGIANDIEFQLKAI |
Ga0311352_102948061 | 3300029944 | Palsa | NLLYWRHQGRASVLVGQSDIGYLWGIANDVAWQLDAI |
Ga0265459_141096861 | 3300030741 | Soil | SKQSDIAPTYDRRQDVNMLYWRHQGRAYTLVGQADVGYLWGIANDVAGQLDAI |
Ga0075392_106050472 | 3300030843 | Soil | QDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0138302_18231812 | 3300030937 | Soil | LLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0170819_130308572 | 3300031469 | Forest Soil | VNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318516_101946583 | 3300031543 | Soil | VNLLYWRHQGRAYALVGQANIGYLWGIANDVAWQLDAV |
Ga0318534_103980301 | 3300031544 | Soil | ISPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV |
Ga0318541_100265553 | 3300031545 | Soil | TKQPDIPPTSDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318538_103715542 | 3300031546 | Soil | NLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318571_104278461 | 3300031549 | Soil | NLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV |
Ga0318515_104070123 | 3300031572 | Soil | QDVNLLYWRHQGRAYALAGQSDIGYLWGIANDVAWQLDAI |
Ga0318561_101640132 | 3300031679 | Soil | DIPPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV |
Ga0318572_103992262 | 3300031681 | Soil | LYWRHQGRAYALVGQAEIGYLWGIANDVAWQLDAV |
Ga0307469_124666712 | 3300031720 | Hardwood Forest Soil | GATKQADVHPTLDRRQDVNELYWRHGGRAYVLVGQTDVGYLWGIANDVAWQLDAI |
Ga0318493_101195393 | 3300031723 | Soil | LYWRHQGRAYALVGQADIGYLWGIANDVAWQMDAV |
Ga0318500_101159811 | 3300031724 | Soil | VNLLYWRHQGRAYALVGQAEIGYLWGIANDVAWQLDAV |
Ga0318500_106693991 | 3300031724 | Soil | VNLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV |
Ga0318501_105484421 | 3300031736 | Soil | LYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV |
Ga0318492_102285821 | 3300031748 | Soil | VNLLYWRHQGRAFVLVGQTDIGYLWGIANDVAWQLDAV |
Ga0318492_103585292 | 3300031748 | Soil | LYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0307477_103905692 | 3300031753 | Hardwood Forest Soil | DVNLLYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0307477_105266742 | 3300031753 | Hardwood Forest Soil | RQDVNLPYWRHQGRAYALVGQTDVGYLWGIANDVAWQLDAI |
Ga0307477_109225201 | 3300031753 | Hardwood Forest Soil | LYWRHQGRASVLVGQSEIGYLWGIANDVAWQLDAI |
Ga0318537_102768841 | 3300031763 | Soil | RRQDVNLLYWRHQGRAYALAGQSDIGYLWGIANDVAWQLDAI |
Ga0318521_100054366 | 3300031770 | Soil | TLTRRQDVNLLYWRHQGRAYALVGQADTGYLWGIANDVAWQLDAI |
Ga0318521_108509231 | 3300031770 | Soil | VNLLYWRHQGHAYALVGQADVGYLWGIAKDVAWQLDAI |
Ga0318521_109718541 | 3300031770 | Soil | QPDISPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318552_102858022 | 3300031782 | Soil | LAPTLARRQDVNLLYWRHQGRAYALVGQADTGYLWGIANDVAWQLDAI |
Ga0318529_104354491 | 3300031792 | Soil | QDVNLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV |
Ga0318576_101543902 | 3300031796 | Soil | VNLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI |
Ga0318523_102769722 | 3300031798 | Soil | RRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318523_103202061 | 3300031798 | Soil | LLYWRHQGRAYALAGQSDIGYLWGIANDVAWQLDAI |
Ga0307478_109468192 | 3300031823 | Hardwood Forest Soil | KQPDIAPTFDKRQDLNLLYWRHQGRASVLVGQSEIGWLWGIANDVAWQLDAI |
Ga0307478_115063742 | 3300031823 | Hardwood Forest Soil | PTFERRQDLNLLYWRHQGRASVLVGQSEIGYLWGIANDIAWQLDAI |
Ga0318511_100082501 | 3300031845 | Soil | PPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV |
Ga0306919_104321141 | 3300031879 | Soil | PTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318544_100160803 | 3300031880 | Soil | DRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318536_106952442 | 3300031893 | Soil | PPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318551_101603623 | 3300031896 | Soil | TFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQMDAV |
Ga0306923_121485141 | 3300031910 | Soil | NLLYWRHQGRAYALVGQTDIGYLWGIANDVAWQLDAI |
Ga0310912_107136152 | 3300031941 | Soil | VNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAI |
Ga0310913_103959642 | 3300031945 | Soil | QDVNLLYWRHQGRAYVLVGQADIGYLWGIANDVAWQLDAV |
Ga0318549_100322331 | 3300032041 | Soil | SSKQPDISPTFDRRHDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318545_100583061 | 3300032042 | Soil | DVNLLYWRHQGRAYALVGQADIGYLWGIANDIAWQLDAV |
Ga0318556_102195741 | 3300032043 | Soil | SSKEPDISPTLARRQDVNLLYWRHQGRAYALAGQSDIGYLWGIANDVAWQLDAI |
Ga0318510_101583673 | 3300032064 | Soil | ISPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318514_107497302 | 3300032066 | Soil | LATRQDVNLLYWRHQGHAYALVGQADVGYLWGIAKDVAWQLDAI |
Ga0318553_100165491 | 3300032068 | Soil | IPPTSDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQLDAV |
Ga0318577_103323841 | 3300032091 | Soil | LYWRHQGRAYALVGQADTGYLWGIANDVAWQLDAI |
Ga0318540_101470331 | 3300032094 | Soil | LYWRHQGRAYALVGQSDIGYLWGIANDVAWQLDAI |
Ga0307472_1006600751 | 3300032205 | Hardwood Forest Soil | DRRQDVNLLYWRYQGRAYALVGQTDIGYLWGIANDVAWQLDAI |
Ga0307472_1008349151 | 3300032205 | Hardwood Forest Soil | DRRQDVNLLYWRHQGRAYALVGQAEIGYLWGIANDVAWQLDAI |
Ga0307472_1016924261 | 3300032205 | Hardwood Forest Soil | IPPTFDRRQDVNMLYWRHHGRAYALAGQTDIGYLWGIANDVAWQLDAI |
Ga0348332_108540371 | 3300032515 | Plant Litter | NLIYWRHQGRAYALVGQANIGYLWGIGNDVAWQLDAI |
Ga0335078_113131231 | 3300032805 | Soil | DIAPTFERRQDLNLLYWRHQGRASVLVGQSEIGYLWGIANDVAWQLDAI |
Ga0335077_116466831 | 3300033158 | Soil | LYWRHHGHAYALVGTADIGYLWNIANDIAWQLDAI |
Ga0318519_102359063 | 3300033290 | Soil | PDIPPTFDRRQDVNLLYWRHQGRAYALVGQADIGYLWGIANDVAWQMDAV |
Ga0214472_117497101 | 3300033407 | Soil | SKQPDIPRTFERRQDVNLLYWRHQGRAYVLVGQTDIGWLWGIANDVAWQLDAI |
⦗Top⦘ |