| Basic Information | |
|---|---|
| Family ID | F037362 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTDNNGYVLAPLPVAPVNETDMVLLPEGLKALKQVAKEVGLDLRGA |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.63 % |
| % of genes near scaffold ends (potentially truncated) | 91.07 % |
| % of genes from short scaffolds (< 2000 bps) | 95.83 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (13.095 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.595 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.03% β-sheet: 0.00% Coil/Unstructured: 72.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF13340 | DUF4096 | 59.52 |
| PF13586 | DDE_Tnp_1_2 | 2.98 |
| PF13359 | DDE_Tnp_4 | 1.79 |
| PF01609 | DDE_Tnp_1 | 1.19 |
| PF01526 | DDE_Tnp_Tn3 | 1.19 |
| PF02518 | HATPase_c | 0.60 |
| PF13683 | rve_3 | 0.60 |
| PF01610 | DDE_Tnp_ISL3 | 0.60 |
| PF13358 | DDE_3 | 0.60 |
| PF01844 | HNH | 0.60 |
| PF13533 | Biotin_lipoyl_2 | 0.60 |
| PF02452 | PemK_toxin | 0.60 |
| PF01348 | Intron_maturas2 | 0.60 |
| PF01979 | Amidohydro_1 | 0.60 |
| PF00296 | Bac_luciferase | 0.60 |
| PF13701 | DDE_Tnp_1_4 | 0.60 |
| PF13546 | DDE_5 | 0.60 |
| PF13613 | HTH_Tnp_4 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.19 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.19 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.19 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 1.19 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.19 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.19 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.19 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.60 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.60 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.26 % |
| Unclassified | root | N/A | 7.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01AWNAO | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300000955|JGI1027J12803_101379790 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300000955|JGI1027J12803_105242006 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300000956|JGI10216J12902_116630107 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300003373|JGI25407J50210_10109737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 681 | Open in IMG/M |
| 3300004633|Ga0066395_10750425 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005177|Ga0066690_10635138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 712 | Open in IMG/M |
| 3300005178|Ga0066688_10075009 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300005178|Ga0066688_10599628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 708 | Open in IMG/M |
| 3300005187|Ga0066675_10679387 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005295|Ga0065707_10160027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1572 | Open in IMG/M |
| 3300005332|Ga0066388_101676100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1123 | Open in IMG/M |
| 3300005332|Ga0066388_104269680 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005338|Ga0068868_102322452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 512 | Open in IMG/M |
| 3300005341|Ga0070691_11104748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 500 | Open in IMG/M |
| 3300005440|Ga0070705_101305628 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005459|Ga0068867_101641053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 602 | Open in IMG/M |
| 3300005471|Ga0070698_100594728 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300005471|Ga0070698_101764364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300005536|Ga0070697_100873945 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005546|Ga0070696_101852397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia tuberum | 522 | Open in IMG/M |
| 3300005557|Ga0066704_10467723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 833 | Open in IMG/M |
| 3300005557|Ga0066704_11001395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 516 | Open in IMG/M |
| 3300005617|Ga0068859_101696901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 698 | Open in IMG/M |
| 3300005713|Ga0066905_101903496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 550 | Open in IMG/M |
| 3300005719|Ga0068861_102677697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 503 | Open in IMG/M |
| 3300005764|Ga0066903_101534629 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300005764|Ga0066903_106966896 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005764|Ga0066903_108661573 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005844|Ga0068862_101459151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 689 | Open in IMG/M |
| 3300005983|Ga0081540_1265856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 595 | Open in IMG/M |
| 3300006173|Ga0070716_101855365 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006194|Ga0075427_10116211 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006796|Ga0066665_10981955 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006797|Ga0066659_10134961 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300006844|Ga0075428_101849751 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006847|Ga0075431_100574317 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300006852|Ga0075433_10355821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1294 | Open in IMG/M |
| 3300006853|Ga0075420_101754938 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006853|Ga0075420_101894708 | Not Available | 510 | Open in IMG/M |
| 3300006871|Ga0075434_101643373 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006880|Ga0075429_100056500 | All Organisms → cellular organisms → Bacteria | 3416 | Open in IMG/M |
| 3300006880|Ga0075429_101081755 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006880|Ga0075429_101957304 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006904|Ga0075424_101426064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata | 735 | Open in IMG/M |
| 3300009012|Ga0066710_104861010 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009036|Ga0105244_10298689 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009038|Ga0099829_11039514 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300009088|Ga0099830_11118262 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300009090|Ga0099827_10481632 | Not Available | 1065 | Open in IMG/M |
| 3300009090|Ga0099827_11920634 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009100|Ga0075418_10695716 | Not Available | 1096 | Open in IMG/M |
| 3300009100|Ga0075418_10821946 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300009100|Ga0075418_11677589 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300009157|Ga0105092_10154995 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300009162|Ga0075423_10350616 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1548 | Open in IMG/M |
| 3300009168|Ga0105104_10009404 | All Organisms → cellular organisms → Bacteria | 6278 | Open in IMG/M |
| 3300009168|Ga0105104_10802271 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009792|Ga0126374_10986103 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009806|Ga0105081_1090134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 508 | Open in IMG/M |
| 3300009820|Ga0105085_1032691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 921 | Open in IMG/M |
| 3300010041|Ga0126312_10926511 | Not Available | 636 | Open in IMG/M |
| 3300010042|Ga0126314_10666427 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300010043|Ga0126380_11535174 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300010043|Ga0126380_11649562 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010046|Ga0126384_11238920 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010047|Ga0126382_10434933 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300010047|Ga0126382_11350422 | Not Available | 647 | Open in IMG/M |
| 3300010047|Ga0126382_12391479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300010048|Ga0126373_12940305 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010166|Ga0126306_11750537 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010358|Ga0126370_11171438 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010358|Ga0126370_11655888 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010359|Ga0126376_10545732 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300010360|Ga0126372_13185662 | Not Available | 510 | Open in IMG/M |
| 3300010361|Ga0126378_12026213 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300010361|Ga0126378_13159316 | Not Available | 524 | Open in IMG/M |
| 3300010362|Ga0126377_10959479 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300010366|Ga0126379_10585892 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1199 | Open in IMG/M |
| 3300010366|Ga0126379_10877210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 999 | Open in IMG/M |
| 3300011270|Ga0137391_10211435 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300012199|Ga0137383_10583866 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012200|Ga0137382_10327310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1072 | Open in IMG/M |
| 3300012202|Ga0137363_10774158 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300012206|Ga0137380_10827918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 798 | Open in IMG/M |
| 3300012206|Ga0137380_11632561 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 529 | Open in IMG/M |
| 3300012209|Ga0137379_11573185 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012212|Ga0150985_102248615 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300012212|Ga0150985_110871819 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300012469|Ga0150984_111398942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
| 3300012469|Ga0150984_123572162 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012473|Ga0157340_1021472 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012507|Ga0157342_1017013 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300012582|Ga0137358_10396220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300012582|Ga0137358_10896337 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012923|Ga0137359_10182465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1874 | Open in IMG/M |
| 3300012929|Ga0137404_11021302 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012930|Ga0137407_11271776 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012948|Ga0126375_10834145 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012948|Ga0126375_11386377 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012948|Ga0126375_11789563 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012948|Ga0126375_11824499 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012971|Ga0126369_12839961 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012989|Ga0164305_10802003 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300013306|Ga0163162_10156686 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
| 3300014326|Ga0157380_13120146 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300014487|Ga0182000_10282778 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300015264|Ga0137403_10004760 | All Organisms → cellular organisms → Bacteria | 15911 | Open in IMG/M |
| 3300015264|Ga0137403_10828736 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300015264|Ga0137403_11451499 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300015371|Ga0132258_13847447 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300015372|Ga0132256_103424011 | Not Available | 533 | Open in IMG/M |
| 3300015373|Ga0132257_100755703 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300015373|Ga0132257_104469245 | Not Available | 509 | Open in IMG/M |
| 3300015374|Ga0132255_103790336 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300016387|Ga0182040_11185632 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300016387|Ga0182040_11279132 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300018056|Ga0184623_10170479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
| 3300018465|Ga0190269_11572452 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018466|Ga0190268_11925703 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300018482|Ga0066669_11784556 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018482|Ga0066669_12239477 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300021073|Ga0210378_10259194 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300021081|Ga0210379_10239968 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300025910|Ga0207684_10266023 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300025922|Ga0207646_11456956 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300025927|Ga0207687_10273967 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300025933|Ga0207706_11373564 | Not Available | 581 | Open in IMG/M |
| 3300026023|Ga0207677_10955833 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300026075|Ga0207708_11122971 | Not Available | 686 | Open in IMG/M |
| 3300026089|Ga0207648_11135223 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300026118|Ga0207675_101649943 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300026118|Ga0207675_101975362 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300026328|Ga0209802_1208302 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300026340|Ga0257162_1029424 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026497|Ga0257164_1053392 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300026532|Ga0209160_1148884 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300027646|Ga0209466_1027959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1160 | Open in IMG/M |
| 3300027718|Ga0209795_10146178 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300027874|Ga0209465_10322781 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300027880|Ga0209481_10661648 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027907|Ga0207428_10880503 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300027909|Ga0209382_11458529 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300028589|Ga0247818_10747403 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300031122|Ga0170822_13591835 | Not Available | 565 | Open in IMG/M |
| 3300031740|Ga0307468_102092200 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031858|Ga0310892_11319774 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031911|Ga0307412_11928516 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031912|Ga0306921_12109495 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031945|Ga0310913_10815223 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031947|Ga0310909_10101351 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300031947|Ga0310909_10940121 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031947|Ga0310909_11586681 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300032000|Ga0310903_10203673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 928 | Open in IMG/M |
| 3300032005|Ga0307411_11424960 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300032035|Ga0310911_10797631 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300032180|Ga0307471_100969183 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300032205|Ga0307472_102729364 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032261|Ga0306920_101943019 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300032782|Ga0335082_11337602 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300033004|Ga0335084_11608068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 640 | Open in IMG/M |
| 3300033550|Ga0247829_11554394 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300033551|Ga0247830_11602415 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300034147|Ga0364925_0260210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 646 | Open in IMG/M |
| 3300034660|Ga0314781_088104 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300034663|Ga0314784_149954 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300034667|Ga0314792_179252 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.19% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.19% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.19% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.19% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_1884790 | 2035918004 | Soil | MTDNNGYVLAPLLVAPVNETDMVLLPKGLQALKQVAKEVGLDLRGAY |
| JGI1027J12803_1013797902 | 3300000955 | Soil | VLAPVPVAPVNETDMVLFPEGLKALKQVAKEVGVDLKGSY* |
| JGI1027J12803_1052420061 | 3300000955 | Soil | EKGEKVIAMTDNNGYV*APVPVAPVNETEMVLFPDGLKALKRVAKEVGLDLRGA |
| JGI10216J12902_1166301071 | 3300000956 | Soil | VLAPLPVAPVNEADMVLLPQGLQALKKVAKEIGVDLRGAYLNL |
| JGI25407J50210_101097372 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLNALKQVAKEVGLDLRG |
| Ga0066395_107504252 | 3300004633 | Tropical Forest Soil | MTDNHGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLDLR |
| Ga0066690_106351382 | 3300005177 | Soil | MTDNNGYVLAPLPVAPVNETDIALFPEGLKALKKVAKEVGLDLRGAYVNLDGGFDSR |
| Ga0066688_100750094 | 3300005178 | Soil | MTDNHGYVLAPLPVAPVNETDIVLLPKGLKALKQVAKEVDLDLRGAYVNLDG |
| Ga0066688_105996282 | 3300005178 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPEGLHALKQVAKEVGLDLRGAYVNLDGGFD |
| Ga0066675_106793871 | 3300005187 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLNALKQVAKEVGLDLR |
| Ga0065707_101600274 | 3300005295 | Switchgrass Rhizosphere | MTDNNGYVLAPVPVAPVNETDMVLFPDGLKALKRVAKEVGLDLTGA* |
| Ga0066388_1016761004 | 3300005332 | Tropical Forest Soil | VLAPVPVAPVNETDMVLLPQGLKALKQVAKEVGLDLKGAYLNLDGGFDS |
| Ga0066388_1042696803 | 3300005332 | Tropical Forest Soil | MTDNHGYVLAPLPVAPVNETDMVLLPKGLTALKQVAKEVGLD |
| Ga0068868_1023224521 | 3300005338 | Miscanthus Rhizosphere | VLAPVPVAPVNETDMVLLPESLQALKKVAKDVGLDLRGAYLNLDGGFDSAH |
| Ga0070691_111047481 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKALTALKQVAKEVGLDLRG |
| Ga0070705_1013056281 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDNHGYVLAPLPVAPINETDMVLFPEGLKALKKVAKEVG |
| Ga0068867_1016410532 | 3300005459 | Miscanthus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLTALKQVAKEVGLDLRGAYGNL |
| Ga0070698_1005947281 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAPVPVAPVNATDMVLLPDGLKALKRVAKEVGLDLKGAYLHL |
| Ga0070698_1017643641 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDNNGYVLALLPVAPVNETDMVLLPQGLQALKKLAKKVGLDLRGASLNLDGGFDS |
| Ga0070697_1008739451 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLDLRG |
| Ga0070696_1018523971 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTENQGYVLAPVPVAPVNETDMVLFPEGLKALKQVAKEVGLDLRGAYLNLDGGFDS |
| Ga0066704_104677231 | 3300005557 | Soil | IIAITDNNGDVLSPCPVAPVNETDMVLLPDGLKALKDVAKKTGFVLEGAYLN* |
| Ga0066704_110013952 | 3300005557 | Soil | MTDNNGYVLAPLPVAPVNETDIVLFPEGLKALKKVAKEVGLDLRGAYVNLD |
| Ga0068859_1016969011 | 3300005617 | Switchgrass Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLTALKQVAKEVGLDLRGAYVNLDG |
| Ga0066905_1019034961 | 3300005713 | Tropical Forest Soil | MTDNHGYVLAPLPVAPVNETDMVLLPESLKALKKVAKEVGLDLR |
| Ga0068861_1026776971 | 3300005719 | Switchgrass Rhizosphere | MTENQGYVLAPVPVAPVNETDMVLFPEGLKALKKVAKEVGLDLKGAYLNLDG |
| Ga0066903_1015346293 | 3300005764 | Tropical Forest Soil | MTDNHGSVLAPVPVAPVHETDMVLFPDGLKALKRVAKEVGLDLRGA |
| Ga0066903_1069668962 | 3300005764 | Tropical Forest Soil | MTENQGYVLAPVPVAPVNETDMVLFPEGLKALKKVTKEVG |
| Ga0066903_1086615731 | 3300005764 | Tropical Forest Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLDLR |
| Ga0068862_1014591512 | 3300005844 | Switchgrass Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLFPEGLKALKQVAKEVGLDLRGAYVN |
| Ga0081540_12658561 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLLPKGLNALKQVAKEVGLDLRGAYVNLDGGFDSQAN |
| Ga0070716_1018553652 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSITDNNGYVLSPMPVAPVNEADMVLLPDGLRSLKLVAKMV |
| Ga0075427_101162112 | 3300006194 | Populus Rhizosphere | VLAPVPVAPVNETDMVLLPEGLQALKRVAQEVGVDLRGAYLNLD |
| Ga0066665_109819551 | 3300006796 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEVGLDL |
| Ga0066659_101349611 | 3300006797 | Soil | MSDNNGYVLAPLPVAPVNETDMVLLPEGLKALKKVAKEVGLDLRGA* |
| Ga0075428_1018497512 | 3300006844 | Populus Rhizosphere | MENHGYVLAPLPVAPVNETDMVLLPESLQALKRVAKQV |
| Ga0075431_1005743171 | 3300006847 | Populus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEVGL |
| Ga0075433_103558213 | 3300006852 | Populus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLFPEGLKALKKVAKEVGLDLRGAYVNLDGGFDSRAN |
| Ga0075420_1017549381 | 3300006853 | Populus Rhizosphere | MTDNHGSILAPLPVASVNETDMVLLPKGLHALQQGAKEVGLDLRGVDVHLDGGFDA |
| Ga0075420_1018947081 | 3300006853 | Populus Rhizosphere | DNDGSVLAPVPVAPGNETDMVLLPKGLQALKKVAKEVG* |
| Ga0075434_1016433732 | 3300006871 | Populus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLNALKQV |
| Ga0075429_1000565001 | 3300006880 | Populus Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEVG |
| Ga0075429_1010817552 | 3300006880 | Populus Rhizosphere | MTDNHGYVLAPLPVAPVNETDIVLFPEGLKALKKVAKEVGLDLRGAYVNLDGGFDS |
| Ga0075429_1019573041 | 3300006880 | Populus Rhizosphere | MTDNHGSVLAPVPVAPVNETEMVLFPDGLKALKRVAKEVGLDLRGA |
| Ga0075424_1014260641 | 3300006904 | Populus Rhizosphere | LDTLFPDVNLAPVPVAPVNETDMVLLPESLHALKQVAKEVH* |
| Ga0066710_1048610102 | 3300009012 | Grasslands Soil | MTDNNGYGLAPLPVAPVNETDMVLLPKGLQALKQVAKEVGLDLRDAYV |
| Ga0105244_102986891 | 3300009036 | Miscanthus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLTALKQVAKEVGLDLRGAYVN |
| Ga0099829_110395141 | 3300009038 | Vadose Zone Soil | MTDNNGYVLAPLPVAPVNETDMVLLPEGLHALKQVATEVGVDLRGA* |
| Ga0099830_111182621 | 3300009088 | Vadose Zone Soil | VLAPLSVAPVDETDRVLLPQGLKALKQVAKQVGLDLR |
| Ga0099827_104816322 | 3300009090 | Vadose Zone Soil | MFPDSLLAPVPVAPVNETDMVLLPESLKALKKVAKEVGLDLRGAYL |
| Ga0099827_119206341 | 3300009090 | Vadose Zone Soil | MTDNHGSVLAPLPVAPVNATDMVLVPKGLKALKQVAKEVGLDLRGAYVNLDGG |
| Ga0075418_106957161 | 3300009100 | Populus Rhizosphere | MAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLGLRGAY |
| Ga0075418_108219461 | 3300009100 | Populus Rhizosphere | MTDNNGYVLSPLPVAPVNETDMVLLPDGLKALKRVAKMVGLDLRGAY |
| Ga0075418_116775892 | 3300009100 | Populus Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLLPKSLNALKQVAQEVGLDLRGAYVNL |
| Ga0105092_101549953 | 3300009157 | Freshwater Sediment | MTDNHGYVLAPLPVAPVNETDMALLPKGLQALKKLAKKVGLDLRGAYLNLD |
| Ga0075423_103506161 | 3300009162 | Populus Rhizosphere | VITSTDNDGSVLAPVPVAPGNETDMVLLPKGLQALKKVAKEVG* |
| Ga0105104_1000940412 | 3300009168 | Freshwater Sediment | MTDNHGYVLAPLPVAPVNETDMALLPKGLQALKKLAKKVGLD |
| Ga0105104_108022711 | 3300009168 | Freshwater Sediment | MTDNNGYVLSPLPVAPVNETDMILLPEGLKALKRVAKTVGLTLTGAYLNLDAGF |
| Ga0126374_109861032 | 3300009792 | Tropical Forest Soil | MTDNNGFVLAPLPVAPVNKTDMVLLPEGLKALKKVAKEV |
| Ga0105081_10901341 | 3300009806 | Groundwater Sand | MTDNNGYVLAPLPVAPVNETDMVLLPKGLNALKQVAKEVGLDLRGAYVNL |
| Ga0105085_10326911 | 3300009820 | Groundwater Sand | PVPVAPVNETDIVLLPESLKALKQVATEVGLDLKGACLNLDGGFDSTYNRKLVD* |
| Ga0126312_109265111 | 3300010041 | Serpentine Soil | KGEKVIAITDNHGYVLSPLPVAPVNETDMVLLPEGLKALKRVAKTVGLTLEQFYALAA* |
| Ga0126314_106664271 | 3300010042 | Serpentine Soil | MTENQGYVLAPVPVAPVNETDMVLFPEGLNALKQVAKEVGLDLRGAYVNLDGGFD |
| Ga0126380_115351741 | 3300010043 | Tropical Forest Soil | VLAPVPVAPVNETDMVLFPEGLKALKDVAKEVGLDLRGAYCHLDGGFDSTYNRKCI |
| Ga0126380_116495622 | 3300010043 | Tropical Forest Soil | MTDNHGYVLAPLPVAPINETDMVLLPKGLQALKQVAKEV |
| Ga0126384_112389203 | 3300010046 | Tropical Forest Soil | MTDNNGSVLAPVPVAPVNETDMVLFPDGLKALKRVAKEVGLDLRGAYVNLDGGFDSR |
| Ga0126382_104349333 | 3300010047 | Tropical Forest Soil | MTDNQGSIISPCPVASVNETDMILLPEGLKALKRVAKTVGLELGGAYLNL |
| Ga0126382_113504222 | 3300010047 | Tropical Forest Soil | MTDNNGDVWSPLPVAPVHETAMLLLPDSLNALKQAAKMTGLVLTGAYRNLDSGFDSMHNRQYIFMPA* |
| Ga0126382_123914791 | 3300010047 | Tropical Forest Soil | MTDNHGHVLSPLPVAPVNETDMVLLPKGLQALKQVAKQVGLDLRGAYLNLDAG |
| Ga0126373_129403052 | 3300010048 | Tropical Forest Soil | MTDNNGYVLAPLPVAPVNETDMVLFPDGLKALKRVAKEVGLDLRGAYVNLDGGFDSR |
| Ga0126306_117505372 | 3300010166 | Serpentine Soil | MTDNHGYVLAPLPVAPVNETDMALLPKGLQALKKVAQQGELDLRGAYLNLDGGF |
| Ga0126370_111714381 | 3300010358 | Tropical Forest Soil | MTENQGYVLAPVPVAPGNETDMVLFPEGLQALKKVAKEVGLDLKGAYLNLDGGFDSA |
| Ga0126370_116558883 | 3300010358 | Tropical Forest Soil | MTDNNGFVLAPLPVAPVNKTDMVLLPEGLKALKKVAKEVGLDLR |
| Ga0126376_105457321 | 3300010359 | Tropical Forest Soil | MTDNNGYVLAPLPVAPVNETDMGLLPEGLHALKQVAK |
| Ga0126372_131856621 | 3300010360 | Tropical Forest Soil | MTATHGSVCAPVPVAPVHETARGLFPEGRHALQRVAQEVGLDLRGA |
| Ga0126378_120262133 | 3300010361 | Tropical Forest Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLDL |
| Ga0126378_131593162 | 3300010361 | Tropical Forest Soil | MTDNHGDVLAPLPVAPVNETDMVLFPESLKALQKVA |
| Ga0126377_109594793 | 3300010362 | Tropical Forest Soil | MTDNHGDVLSPLPVAPVNETDMVLLPEGRQAFKKVAQQVSLDRRDAYVNLD |
| Ga0126379_105858921 | 3300010366 | Tropical Forest Soil | IAIIDNHGYVLAPVPVVPVNETDMVLLTEGLKGLKEVAKEVGLDVRDV* |
| Ga0126379_108772101 | 3300010366 | Tropical Forest Soil | MLAPLPVAPVNETDMVLLPKELTALKQVAKEVGLDLRGA |
| Ga0137391_102114353 | 3300011270 | Vadose Zone Soil | MTDNNGYVLAPLPVAPVNTADMVLFPEGLKALKKVAK |
| Ga0137388_117675881 | 3300012189 | Vadose Zone Soil | MAITDNNGYVLSPMPVAPVNEADMVLLPDGLKSLKLVAKMVGVILVGAYLNLDCGFDSKQNRKI |
| Ga0137383_105838662 | 3300012199 | Vadose Zone Soil | MIAITDKHGYVLSPCPVAPVNETDMILLPEGLKALKRVAQLVGLDLG |
| Ga0137382_103273103 | 3300012200 | Vadose Zone Soil | MTDNNGYVLAPLPMAPVNETDMILLPQGLKALKQVAEQVGLDLRGAYLNLDGGFDST |
| Ga0137363_107741583 | 3300012202 | Vadose Zone Soil | MTDNHGYVLAPLPVAPVNETDMVLLPEGLHALKQVATEVGVDLRGA* |
| Ga0137380_108279181 | 3300012206 | Vadose Zone Soil | MGNAQVNEADTVLLPKGLKALKRVAKLTGFELQGA |
| Ga0137380_116325612 | 3300012206 | Vadose Zone Soil | MTDNPGDVLSPLPVAPVNQTDMVLFPEGLQTLKRVAKQTGLVLTGA* |
| Ga0137379_115731852 | 3300012209 | Vadose Zone Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLNALKQVAKEVGLDLRG |
| Ga0150985_1022486152 | 3300012212 | Avena Fatua Rhizosphere | MTDNHGDVLSPCPGAPVHETEMILLPEGLKALKKVAKQVG* |
| Ga0150985_1108718192 | 3300012212 | Avena Fatua Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLDLRGAYVNLDGGFDSNR* |
| Ga0150984_1113989422 | 3300012469 | Avena Fatua Rhizosphere | MTDNHGDVLSPCPVAPVHETDMILLPEGLKALKKVAKQVG* |
| Ga0150984_1235721621 | 3300012469 | Avena Fatua Rhizosphere | MTDNHGYIISPCSVAPVNETDMILLPEGLKALKRVAKTVGLDLGGAYLNLDAGFD |
| Ga0157340_10214722 | 3300012473 | Arabidopsis Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEVGLDLRGAYVNLDG |
| Ga0157342_10170133 | 3300012507 | Arabidopsis Rhizosphere | VAPVNETDMVLLPESLHALKQVAKEVGLDLRGAYL |
| Ga0137358_103962201 | 3300012582 | Vadose Zone Soil | MTDNNGYVLSPLPVAPVHETDMILLPEGLNALKRVAKTVGLTRTGAYLNLDAGFDA |
| Ga0137358_108963371 | 3300012582 | Vadose Zone Soil | MTDNHGYVLAPLPVAPVNETDMVLLPEGLHALKQVATEVG |
| Ga0137359_101824651 | 3300012923 | Vadose Zone Soil | MTDNHGYVLAPLPVAPVNETDMVLLPEGLHALKQVATEVGVDLRGAEVN |
| Ga0137404_110213022 | 3300012929 | Vadose Zone Soil | MTDNHGDRLSAFPVAPVNATDMVRLPEGRNALKKVATMVGLDLGGAYLNLDAGFDST |
| Ga0137407_112717761 | 3300012930 | Vadose Zone Soil | MTDNHGDVLSPLPVAPVHETDMVLLPEGRKALKKVATQVGLDLRDAYVNLDA |
| Ga0126375_108341452 | 3300012948 | Tropical Forest Soil | MTDNNGYVLSPLPVAPVHETAMVLLPNGLKALKRVAKIVGVD |
| Ga0126375_113863772 | 3300012948 | Tropical Forest Soil | MTENQGYVLAPVPVAPVNETDMLLFPEGLKALKKVAKEVGVDLQ |
| Ga0126375_117895631 | 3300012948 | Tropical Forest Soil | VLAPVPVAPVNETDMVLFPEGLKALKDVAKEVGLDLRGAYCHLDGGFD |
| Ga0126375_118244991 | 3300012948 | Tropical Forest Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLNVLKQVAKEVGLDLRGA |
| Ga0126369_128399611 | 3300012971 | Tropical Forest Soil | MTDNNGYVLAPLPVAPVNETDMVLLPEGLKALKKVAKEVGLD |
| Ga0164305_108020031 | 3300012989 | Soil | MTDNHGDMLSAFPVAPVNATEMVLLPEGLKAVKQVAKMV |
| Ga0163162_101566866 | 3300013306 | Switchgrass Rhizosphere | MTENQGYVLAPVPVAPVNETDILLFPEGLKALKKVTKEVGVDLQGAYLTNPAMTDSVG* |
| Ga0157380_131201462 | 3300014326 | Switchgrass Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLTALKQV |
| Ga0182000_102827781 | 3300014487 | Soil | MTDNNGYVLAPVPVAPVNETDMVLFPDGLQALKRVATEVGLDLRGADVNLDGG |
| Ga0137403_100047601 | 3300015264 | Vadose Zone Soil | MTDNHGDVLSPLPVAPVNETDMVLLPEGLQALKKVATQVGLDLRDAYVNLDAGFD |
| Ga0137403_108287362 | 3300015264 | Vadose Zone Soil | MTDNHGDRLSAFPVAPVNATDMVRLPEGRNALKKVATMVGLDLGRAYLN |
| Ga0137403_114514991 | 3300015264 | Vadose Zone Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLNALKQVAKEVGLDLRGAYVNLDG |
| Ga0132258_138474471 | 3300015371 | Arabidopsis Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLLPEGLKALKEVAKEV |
| Ga0132256_1034240111 | 3300015372 | Arabidopsis Rhizosphere | QKGDKVIAIIDNHGYVLAPVPVAPVNETNMVLLPESLQALKKVAKEVGLDLRGAY* |
| Ga0132257_1007557034 | 3300015373 | Arabidopsis Rhizosphere | DHHGYVLAPVPVAPVNETDMVLFPEGLKALKKVAKEVSVDLRGA* |
| Ga0132257_1044692451 | 3300015373 | Arabidopsis Rhizosphere | MIAQPYPRKKGDKVIAITDNHGYACPPVPVAPVNETDMVLLPESLHALKQVAKEVGLDLRGA* |
| Ga0132255_1037903361 | 3300015374 | Arabidopsis Rhizosphere | MTDNNGYVLAPVPVAPVNETDMVLLPQGLKALKQVAKQVG |
| Ga0182040_111856322 | 3300016387 | Soil | MTDNNGYVLAPLPVAPINETDMVLLPEGLKALKKVAKEVGLD |
| Ga0182040_112791321 | 3300016387 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGL |
| Ga0184623_101704791 | 3300018056 | Groundwater Sediment | VLAPVPVAPVNEADMVLLPKGLKALKQVAKEVGLDLRG |
| Ga0190269_115724521 | 3300018465 | Soil | VSILSIDNHGYVLAPVAVAPVNETDMVLFPEGLKALKEVAKE |
| Ga0190268_119257031 | 3300018466 | Soil | MTDNNGYVLSPLPVAPVNETDMVLLPDGLNALKKVAKQVSLDLRDAYVNL |
| Ga0066669_117845561 | 3300018482 | Grasslands Soil | MAITDNNGYVLSPMPVAPVNEADMVLLPDGLNILKLVAKMVGLI |
| Ga0066669_122394771 | 3300018482 | Grasslands Soil | VLSPLPVAPVNKSDMVLLADGLKALKMVAKMIGLVLVGAYLNLDSGFVSK |
| Ga0210378_102591941 | 3300021073 | Groundwater Sediment | KVIAIIDNHGYVLAPVPVAPVNETDMILLPKGLKALQQVAKKVGLDLRGA |
| Ga0210379_102399683 | 3300021081 | Groundwater Sediment | MTAKNGDVLAPGPVAPVHETAMVLLPDGLKALKDVAQKTGFVLEGAYLNLDGG |
| Ga0207684_102660231 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMTDNHGYGLAPLPVAPVHQTDMVLFPEGLKALKQVAKKVGLHLKGAYVNLDGGFDSKHNRKLI |
| Ga0207646_114569562 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIIDNHGYVLAPVPVAPVNETDMVLLPQGLQALKQVAKEVGL |
| Ga0207687_102739671 | 3300025927 | Miscanthus Rhizosphere | MSNGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEV |
| Ga0207706_113735642 | 3300025933 | Corn Rhizosphere | AIAITDNNGDGLAPLHVAPVNETALVLLPQGLKAWKQVAKKGA |
| Ga0207677_109558331 | 3300026023 | Miscanthus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLTALKQVAK |
| Ga0207708_111229711 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFWTIREKVIAMTDNHGYVLAPLPVAPVNETDLVLLPKGLHALKQVATEVGLGLRGA |
| Ga0207648_111352231 | 3300026089 | Miscanthus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLTALKQVAKEVGLDLRGAYGNLDGGF |
| Ga0207675_1016499431 | 3300026118 | Switchgrass Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLDLRGAYVN |
| Ga0207675_1019753622 | 3300026118 | Switchgrass Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLLPKGLNALKQVATEVGLDLRGAY |
| Ga0209802_12083021 | 3300026328 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEVGLDLRGAY |
| Ga0257162_10294241 | 3300026340 | Soil | MDNHGSVLAPVPVAPVNETDMVLLPESLQALKKVAKEVGLDLRGAYLNLDGGFDSAHN |
| Ga0257164_10533921 | 3300026497 | Soil | MTDHHGSVLAPLPVAPVNETDMVLLPEGLPALKQVATEVGVDLRGAEVNLDGGFDARAN |
| Ga0209160_11488841 | 3300026532 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPEGLHALKQVAKEVGLDLRG |
| Ga0209466_10279591 | 3300027646 | Tropical Forest Soil | ANPGYILAPVPVAPVNETDLVLFPQGLHALKQVAKQVGLDLRGASEPR |
| Ga0209795_101461782 | 3300027718 | Agave | MTDNNGYVLAPLPVAPVNETDMVLLPKGLKALKQVAKEVGLDLRGA |
| Ga0209465_103227813 | 3300027874 | Tropical Forest Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLTALKQVAKEV |
| Ga0209481_106616482 | 3300027880 | Populus Rhizosphere | VLAPVPVAPVNATDMVLFPEGLKALQDVATEVGLDLRGAYLHR |
| Ga0207428_108805031 | 3300027907 | Populus Rhizosphere | MTDNNGYVLAPVPVAPVNETDMVLFPDGLKALKRVAKEVGLD |
| Ga0209382_114585291 | 3300027909 | Populus Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEVGLDLRGAS |
| Ga0247818_107474032 | 3300028589 | Soil | MTDNHGYVLAPLPVAPVNETDMLLLPEGLKALKQVAKEVGLDLRGAYVNLDGGFDSR |
| Ga0170822_135918351 | 3300031122 | Forest Soil | MVDNNGFVLAPLPVAPVNETDTVLLPEGLNTLKRVARLTALKIGGSYLNLDGGFDS |
| Ga0307468_1020922002 | 3300031740 | Hardwood Forest Soil | MTDNNGYVLAPLPVAPVNETDMVLFPEGLKALKKVAKEVGLDLRGAYVNLDGGFD |
| Ga0310892_113197741 | 3300031858 | Soil | MTDNHGYVLAPVPVAPVNETDMVLLPESLQALKKVAKEVGLDLRGAHLNLDGG |
| Ga0307412_119285161 | 3300031911 | Rhizosphere | MTDNHGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLDL |
| Ga0306921_121094951 | 3300031912 | Soil | MTDNHGYVLAPLPVAPVNETDMILLPKGLHALKQVAKEVGLDLRGAYVNLDGGFDSR |
| Ga0310913_108152232 | 3300031945 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPEGLKALKQVAKEVGLDLRGA |
| Ga0310909_101013513 | 3300031947 | Soil | VPFYEKFRLAPVPVAPVNETDMVLLPEGLKALKQVAKEAGVDLRG |
| Ga0310909_109401211 | 3300031947 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPEGLKALKKVAKEVGLDLRGAYVNL |
| Ga0310909_115866812 | 3300031947 | Soil | MTDNHGDVLAPLPVAPVNETDMVLFPESLKALQKVAQEVGLDLRGAS |
| Ga0310903_102036731 | 3300032000 | Soil | MTDNHGYVLAPLPVAPVNETDMVLLPKGLTALKQVAKEVGLDLRG |
| Ga0307411_114249602 | 3300032005 | Rhizosphere | MTDNNGYVLAPLPVAPVNETDMVLLPKGLHALKQVAKEVGLDLRDAYVNLDGGFDSS |
| Ga0310911_107976311 | 3300032035 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPEGLKALKKVAKEV |
| Ga0307471_1009691831 | 3300032180 | Hardwood Forest Soil | MTENQGYVLAPVPVAPVNETDMVLFPEGLQALKKVAKE |
| Ga0307472_1027293641 | 3300032205 | Hardwood Forest Soil | MTDNHGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEVGLDLRGAYVNLDGGFD |
| Ga0306920_1019430191 | 3300032261 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPEGLKALKQVAKEVGLDLRG |
| Ga0335082_113376021 | 3300032782 | Soil | MAITDHHGSVLALVPVAPVHETDMVLFPEGLKALKEVATEAGLDRRGAYRNLDGGCDSIH |
| Ga0335084_116080682 | 3300033004 | Soil | LLYCGYVLAPLPVAPVNETDMVLFPEGLKALKKVAKEVGLDLRG |
| Ga0247829_115543941 | 3300033550 | Soil | MTDNHGYVLAPLPVAPVNETDMVLLPKGLQALKQVAKEVGLDLR |
| Ga0247830_116024151 | 3300033551 | Soil | MTDNHGYVVAPLPVAPVNETDMVLLPKGLNALKQVAKEVGLDLRGAYVNLDGGFDSRA |
| Ga0364925_0260210_483_644 | 3300034147 | Sediment | MWAPLPVAPVNETDMVLLPKGLQTLKHVAKNVGVDLRGAYLNLDGGFDSTHNRK |
| Ga0314781_088104_3_158 | 3300034660 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLQALKQGAKEVGLDLRGADVNLDG |
| Ga0314784_149954_3_170 | 3300034663 | Soil | MTDNNGYVLAPLPVAPVNETDMVLLPKGLNALKQVAKEVGLDLRGAYVNLDGGFDS |
| Ga0314792_179252_417_581 | 3300034667 | Soil | MTDNNGYVLAPVPVAPVNETDMVLFPDGLKALKRVAKEVGLDLTGAYVNLDGGFD |
| ⦗Top⦘ |