| Basic Information | |
|---|---|
| Family ID | F037336 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREQEDESDRG |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 167 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.69 % |
| % of genes near scaffold ends (potentially truncated) | 31.55 % |
| % of genes from short scaffolds (< 2000 bps) | 91.07 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.452 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.071 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.095 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.214 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 167 Family Scaffolds |
|---|---|---|
| PF14224 | DUF4331 | 34.13 |
| PF00196 | GerE | 8.98 |
| PF00210 | Ferritin | 1.20 |
| PF07730 | HisKA_3 | 0.60 |
| PF00011 | HSP20 | 0.60 |
| PF08734 | GYD | 0.60 |
| PF13229 | Beta_helix | 0.60 |
| PF03992 | ABM | 0.60 |
| PF00005 | ABC_tran | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.60 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.60 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.60 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.60 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.05 % |
| Unclassified | root | N/A | 5.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02GO052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101917552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1532 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101918043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300000956|JGI10216J12902_102742107 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300001535|A3PFW1_10436648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
| 3300004022|Ga0055432_10214393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300004114|Ga0062593_100115786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1938 | Open in IMG/M |
| 3300004114|Ga0062593_103297147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300004153|Ga0063455_100279321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
| 3300004156|Ga0062589_102249481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300004463|Ga0063356_103321358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300004463|Ga0063356_104057189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300004479|Ga0062595_100022768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 2412 | Open in IMG/M |
| 3300004479|Ga0062595_100110021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1493 | Open in IMG/M |
| 3300004479|Ga0062595_102439286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300004633|Ga0066395_10385759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300004643|Ga0062591_101064074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
| 3300005093|Ga0062594_100636879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
| 3300005093|Ga0062594_100640142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300005093|Ga0062594_100869179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 846 | Open in IMG/M |
| 3300005093|Ga0062594_101508567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300005093|Ga0062594_101545081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300005146|Ga0066817_1006706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300005162|Ga0066814_10071385 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005164|Ga0066815_10127358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300005329|Ga0070683_100880644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300005332|Ga0066388_100451062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1928 | Open in IMG/M |
| 3300005332|Ga0066388_100511423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1836 | Open in IMG/M |
| 3300005332|Ga0066388_101693270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300005332|Ga0066388_107649855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300005337|Ga0070682_100041523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2836 | Open in IMG/M |
| 3300005337|Ga0070682_100334988 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300005344|Ga0070661_101530573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300005347|Ga0070668_100396464 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300005347|Ga0070668_101401654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300005355|Ga0070671_100519886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
| 3300005364|Ga0070673_100690401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300005441|Ga0070700_100659502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
| 3300005445|Ga0070708_101959136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300005457|Ga0070662_100231356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1479 | Open in IMG/M |
| 3300005457|Ga0070662_100963269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300005526|Ga0073909_10557631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300005529|Ga0070741_10009282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19204 | Open in IMG/M |
| 3300005539|Ga0068853_100652330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300005544|Ga0070686_100312091 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300005560|Ga0066670_10480144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300005564|Ga0070664_102147496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300005578|Ga0068854_101149044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300005764|Ga0066903_100140161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3436 | Open in IMG/M |
| 3300005764|Ga0066903_100434061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2184 | Open in IMG/M |
| 3300005764|Ga0066903_100520804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2024 | Open in IMG/M |
| 3300005764|Ga0066903_104547258 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005937|Ga0081455_10033045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4653 | Open in IMG/M |
| 3300006034|Ga0066656_10811896 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006046|Ga0066652_100051462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3104 | Open in IMG/M |
| 3300006175|Ga0070712_100671842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 881 | Open in IMG/M |
| 3300006175|Ga0070712_101735139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300006575|Ga0074053_11550651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300006806|Ga0079220_11240750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300006854|Ga0075425_100072010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3894 | Open in IMG/M |
| 3300006881|Ga0068865_101560499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300006954|Ga0079219_11115620 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300007076|Ga0075435_100321926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1323 | Open in IMG/M |
| 3300009012|Ga0066710_102826750 | Not Available | 685 | Open in IMG/M |
| 3300009036|Ga0105244_10550225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300009038|Ga0099829_11208116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300009090|Ga0099827_11237072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300009098|Ga0105245_10698945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1047 | Open in IMG/M |
| 3300009101|Ga0105247_10591338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300009147|Ga0114129_10270297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2274 | Open in IMG/M |
| 3300009148|Ga0105243_12034468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300009148|Ga0105243_12034468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300009148|Ga0105243_12123509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300009156|Ga0111538_13620338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300009162|Ga0075423_11666639 | Not Available | 686 | Open in IMG/M |
| 3300009174|Ga0105241_10109958 | Not Available | 2205 | Open in IMG/M |
| 3300009176|Ga0105242_11194629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300009176|Ga0105242_12016752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300009176|Ga0105242_12068064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300009177|Ga0105248_11258840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300009553|Ga0105249_10339484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1518 | Open in IMG/M |
| 3300009553|Ga0105249_10754265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
| 3300009792|Ga0126374_11844967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300010362|Ga0126377_10115062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2476 | Open in IMG/M |
| 3300010362|Ga0126377_10934175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300010371|Ga0134125_11050874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300010375|Ga0105239_12211769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300010403|Ga0134123_11670565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
| 3300010403|Ga0134123_13018046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300011119|Ga0105246_10924422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
| 3300012204|Ga0137374_10269830 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300012209|Ga0137379_11083753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300012685|Ga0137397_10307740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300012955|Ga0164298_10152769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1298 | Open in IMG/M |
| 3300012955|Ga0164298_10463556 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012957|Ga0164303_10737925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300012958|Ga0164299_10016812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2898 | Open in IMG/M |
| 3300012958|Ga0164299_10489833 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012958|Ga0164299_11144026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300012960|Ga0164301_10060197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2005 | Open in IMG/M |
| 3300012960|Ga0164301_10344378 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300012961|Ga0164302_11307564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300012984|Ga0164309_10153676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1533 | Open in IMG/M |
| 3300012986|Ga0164304_10151845 | Not Available | 1460 | Open in IMG/M |
| 3300012986|Ga0164304_10307198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1090 | Open in IMG/M |
| 3300012988|Ga0164306_10124906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1718 | Open in IMG/M |
| 3300012989|Ga0164305_10101697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1846 | Open in IMG/M |
| 3300013306|Ga0163162_10367597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1571 | Open in IMG/M |
| 3300013306|Ga0163162_13252148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300013308|Ga0157375_10352303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1638 | Open in IMG/M |
| 3300013308|Ga0157375_12632447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300013764|Ga0120111_1108577 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300014326|Ga0157380_12676431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300014969|Ga0157376_12339291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300015201|Ga0173478_10307519 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300015372|Ga0132256_102296448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300015373|Ga0132257_101752748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300015373|Ga0132257_102989294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300015374|Ga0132255_101395047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300015374|Ga0132255_106032447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300017944|Ga0187786_10043628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1320 | Open in IMG/M |
| 3300017947|Ga0187785_10333480 | Not Available | 708 | Open in IMG/M |
| 3300017974|Ga0187777_10789944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300018029|Ga0187787_10422853 | Not Available | 530 | Open in IMG/M |
| 3300018032|Ga0187788_10010827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2819 | Open in IMG/M |
| 3300018056|Ga0184623_10191506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300018060|Ga0187765_10134849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
| 3300018089|Ga0187774_10997623 | Not Available | 584 | Open in IMG/M |
| 3300018089|Ga0187774_11278846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300019361|Ga0173482_10027439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1688 | Open in IMG/M |
| 3300019362|Ga0173479_10615285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300025535|Ga0207423_1098128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300025899|Ga0207642_10205955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1090 | Open in IMG/M |
| 3300025901|Ga0207688_10548491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300025911|Ga0207654_11283688 | Not Available | 534 | Open in IMG/M |
| 3300025918|Ga0207662_10221016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300025927|Ga0207687_11236618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300025930|Ga0207701_11719554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300025933|Ga0207706_11252625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300025944|Ga0207661_10432455 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Telmatocola → Telmatocola sphagniphila | 1197 | Open in IMG/M |
| 3300025944|Ga0207661_11154381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300025972|Ga0207668_11180304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300025981|Ga0207640_10945435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300025986|Ga0207658_11842479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300025986|Ga0207658_11896616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300026023|Ga0207677_12174092 | Not Available | 516 | Open in IMG/M |
| 3300026067|Ga0207678_11946490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300026078|Ga0207702_10288029 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300026121|Ga0207683_10228440 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300026121|Ga0207683_11562872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300027401|Ga0208637_1024001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 679 | Open in IMG/M |
| 3300027821|Ga0209811_10175010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300028587|Ga0247828_10897411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300028718|Ga0307307_10137615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300028771|Ga0307320_10046154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1604 | Open in IMG/M |
| 3300028807|Ga0307305_10246239 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300028807|Ga0307305_10395907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
| 3300028819|Ga0307296_10409826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300028828|Ga0307312_10196066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300028828|Ga0307312_10548579 | Not Available | 764 | Open in IMG/M |
| 3300031226|Ga0307497_10123163 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300031366|Ga0307506_10396260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300031847|Ga0310907_10861896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300032782|Ga0335082_10715110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
| 3300033004|Ga0335084_11134220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300033004|Ga0335084_11560193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300033412|Ga0310810_11105734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300033551|Ga0247830_11636144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.19% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.19% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.19% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.60% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005146 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_02770400 | 2170459003 | Grass Soil | MTLLAHGGIPGLIAETSIVIAVLVVFGYFVRRSAKKEQEREEKTDKPD |
| INPhiseqgaiiFebDRAFT_1019175522 | 3300000364 | Soil | MSLILAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKERDREDDPKG* |
| INPhiseqgaiiFebDRAFT_1019180431 | 3300000364 | Soil | MILAHGGIPGLIAETGSVFLGLAIFGYFIRRSAKKEREREKDSXR* |
| JGI10216J12902_1027421072 | 3300000956 | Soil | VSLVLAHGGIPGLIGETGSVFIALAIFGYFIRRSAKKEREREDDPKR* |
| A3PFW1_104366482 | 3300001535 | Permafrost | MGPVAGLILAHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKERERENDREGR* |
| Ga0055432_102143932 | 3300004022 | Natural And Restored Wetlands | MTTILAHGGIPGLIGETGSVFVALVIFGYFIRRSAKKERERDDKSDREGS* |
| Ga0062593_1001157862 | 3300004114 | Soil | VIANTQLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREREDESDRGRG* |
| Ga0062593_1032971472 | 3300004114 | Soil | MNFVLAHGGIPGLIAETGSVFLGLAIFGYFIRRSAKKERKKEE* |
| Ga0063455_1002793212 | 3300004153 | Soil | MSLVLAHGGIPGLIAETGSVFLGLAIFGYFLRRSAKKDRERDRDS* |
| Ga0062589_1022494811 | 3300004156 | Soil | MTLLAHGGIPGLIAETSIVIAGLAVFGYFVRRSAKKEQESERRDDSSL* |
| Ga0063356_1033213582 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTTLLAHGGIPGLIGETGSVFVALVIFGYFIRRSAKKERDREEKSDREES* |
| Ga0063356_1040571891 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VGPLAGLSLILAHGGIPGLIAETGSVFVALAIFGYFIRRSAKKERDNKSDHERG |
| Ga0062595_1000227683 | 3300004479 | Soil | MTLLAHGGIPGLIGEVGSVFVALAIFGYFIRRSAKREKEQERNRKS* |
| Ga0062595_1001100212 | 3300004479 | Soil | MSLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREQEDESDRG* |
| Ga0062595_1024392861 | 3300004479 | Soil | MSLVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKEREREDKKP* |
| Ga0066395_103857592 | 3300004633 | Tropical Forest Soil | MTLLAHGGIPGLIGETGSVFVALAIFGYFIRRSAKKEKEREKDRKD* |
| Ga0062591_1010640741 | 3300004643 | Soil | MTLLAHGGIPGLIAETSIVIAGLAVFGYFVRRSAKKEQERERHDDSSL* |
| Ga0062594_1006368791 | 3300005093 | Soil | MILAHGGIPGLIAETGSVFVALAVFGFFIRRSAKKEREAEKNDDRKS* |
| Ga0062594_1006401421 | 3300005093 | Soil | VSLVLAHGGIPGLIAETGGVVVALVVFGYFIRRSAKKERERERDS* |
| Ga0062594_1008691792 | 3300005093 | Soil | VTLLAHGGIPGLIAETGSVIVALAVFGYFVRRSAKREKEREEKDQTRR* |
| Ga0062594_1015085672 | 3300005093 | Soil | VTLLAHGGIPGLIAETSIVIVALVVFGYFVRRSAKKEQAEDQDRK* |
| Ga0062594_1015450812 | 3300005093 | Soil | MSLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREQEDESDRGPG* |
| Ga0066817_10067061 | 3300005146 | Soil | MTPVLAHGGIPGLIAETGIVVVGLLIFGYFIRRSAKKERERERDS* |
| Ga0066814_100713852 | 3300005162 | Soil | MSLVLAHGGIPGLIGETGSVVVGLLVFGYFIRRSAKKEREREKNGKKQGQA* |
| Ga0066815_101273581 | 3300005164 | Soil | MSPVLAHGGIPGLIAETGGVVVCLVIFGYFIRRSAKKERERERDS* |
| Ga0070683_1008806442 | 3300005329 | Corn Rhizosphere | MNFVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKERDRENKEKKRGRT* |
| Ga0066388_1004510622 | 3300005332 | Tropical Forest Soil | MIGNTQLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREEEKADRDGG* |
| Ga0066388_1005114233 | 3300005332 | Tropical Forest Soil | MTTILAHGGIPGLIGETGSVFVALVIFGYLIRRSAKKEREREDKSDGEGS* |
| Ga0066388_1016932702 | 3300005332 | Tropical Forest Soil | MGLVARLSLVLAHGGIPGLIGETGSVFLALAVFGYFIRRSAKKERENDEREHDSKRS* |
| Ga0066388_1076498551 | 3300005332 | Tropical Forest Soil | VGPLAGLSLILAHGGIPGLIAETGSVFVALAIFGYFIRRSAKREKEEEKNRKS* |
| Ga0070682_1000415231 | 3300005337 | Corn Rhizosphere | VIANTQLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKERE |
| Ga0070682_1003349882 | 3300005337 | Corn Rhizosphere | MNFVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKERDQENKEKKRGRT* |
| Ga0070661_1015305732 | 3300005344 | Corn Rhizosphere | MSAILAHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQERERDP* |
| Ga0070668_1003964642 | 3300005347 | Switchgrass Rhizosphere | HGGIPGLIGETGSVFLALLVFGYFIRRSAKKEKERERDP* |
| Ga0070668_1014016542 | 3300005347 | Switchgrass Rhizosphere | VIANTQLVLAHGGISGLIAETGSVFVALAVFGYFIRRSAKKEREQEDESDRDRR* |
| Ga0070671_1005198862 | 3300005355 | Switchgrass Rhizosphere | VTLLAHGGIPGLIAETSIVIVALVVFGYFVRRSAKKEREQEADTRRDD* |
| Ga0070673_1006904012 | 3300005364 | Switchgrass Rhizosphere | MNLVLAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEREQERERD |
| Ga0070700_1006595021 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLVLAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEQEQERERDP* |
| Ga0070708_1019591362 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAGLDLIVAHGGIPGLIAETGSVFLGLAVFGYFIRRSAKKEREREEDSNRS* |
| Ga0070662_1002313562 | 3300005457 | Corn Rhizosphere | MNLVLAHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQERERDP* |
| Ga0070662_1009632691 | 3300005457 | Corn Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALVVFGYFIRRSAKKEREQEDESDRG* |
| Ga0073909_105576312 | 3300005526 | Surface Soil | MTLLAHGGIPGLIGEVGSVFVALAIFGYFIRRSAKREKEQE |
| Ga0070741_1000928223 | 3300005529 | Surface Soil | MIANTQLVLAHGGIPGLIAETGSVFVALGVFGYFIRRSAKKERESEHDDDSQRG* |
| Ga0068853_1006523302 | 3300005539 | Corn Rhizosphere | MNLVLAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEREQERERDP* |
| Ga0070686_1003120911 | 3300005544 | Switchgrass Rhizosphere | AHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQERERDP* |
| Ga0066670_104801442 | 3300005560 | Soil | MTLLAHGGIPGLIAETGSVFLGLAVFGYFIRRSAKKEKEKEKRESRE* |
| Ga0070664_1021474962 | 3300005564 | Corn Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREQEDESDRGRS* |
| Ga0068854_1011490442 | 3300005578 | Corn Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREQEDE |
| Ga0066903_1001401612 | 3300005764 | Tropical Forest Soil | MTTILAHGGIPGLIGETGSVFVALVIFGYFIRRSAKKEREREDRSDREES* |
| Ga0066903_1004340612 | 3300005764 | Tropical Forest Soil | MTTLLAHGGIPGLIAETGSVFVALAIFGYFIRRSAKRERERERESDQKDS* |
| Ga0066903_1005208043 | 3300005764 | Tropical Forest Soil | MSLILAHGGIPGLIAETGSVFVALAVFGYFIRRSAKREREEEKRTDRD* |
| Ga0066903_1045472581 | 3300005764 | Tropical Forest Soil | LGAEPGMSLVLAHGGIPGLIAETGSVFLGLAIFGYFIRRSAKKERERERDS* |
| Ga0081455_100330456 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTTILAHGGIPGLIGETGSVFVALVIFGFFIRRSAKKEREREDKSDREGS* |
| Ga0066656_108118962 | 3300006034 | Soil | VGPVTALILAHGGIPGLIAETGSVFVVLAVFGYFIRRSAKKEREREKDDP* |
| Ga0066652_1000514622 | 3300006046 | Soil | MSFVLAHGGIPGLIAETGSVFLGLAIFGYFIRRSAKKERERDRDS* |
| Ga0070712_1006718423 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GIPGLIAETGSVFVALAVFGYFIRRSAKKEREREDESDRGRG* |
| Ga0070712_1017351392 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LAHGGIPGLIAETGSVVVGLLIFGYFIRRSAKREREKDHE* |
| Ga0074053_115506511 | 3300006575 | Soil | MSVILAHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREKERDSERS* |
| Ga0079220_112407502 | 3300006806 | Agricultural Soil | MGPFAGLIVAHGGIPGLIAETGSVFLGLAIFGYFIRRSAKKEKEQEGRRDGS* |
| Ga0075425_1000720102 | 3300006854 | Populus Rhizosphere | MSLVLAHGGIPGLIGETGSVFIALAVFGYFIRRSAKKEREREDDQKP* |
| Ga0068865_1015604991 | 3300006881 | Miscanthus Rhizosphere | RRALGAEPGMSVVLAHGGIPGLIGETGSVFLALLVFGYFIRRSAKKEKERERDP* |
| Ga0079219_111156201 | 3300006954 | Agricultural Soil | GAVAGLIVAHGGIPGLIAETGSVFLGLAIFGYFIRRSAKKEREREGGPNRK* |
| Ga0075435_1003219261 | 3300007076 | Populus Rhizosphere | MSLVLAHGGIPGLIGETGSVFIALAVFGYFIRRSAKKE |
| Ga0066710_1028267501 | 3300009012 | Grasslands Soil | MSLVLAHGGIPGLIAETGSVFLGLAVFGYFIRRSAKKEREREDDSKPS |
| Ga0105244_105502252 | 3300009036 | Miscanthus Rhizosphere | MTLLAHGGIPGLIAETGSVVVALVVFGYFVRRSAKKERDRENKEKKRGRT* |
| Ga0099829_112081162 | 3300009038 | Vadose Zone Soil | MGPVAGLDLIVAHGGIPGLIAETGSVFLGLAVFGYFIRRSAKKERERKEDSNRS* |
| Ga0099827_112370721 | 3300009090 | Vadose Zone Soil | MGPVAGLDVVLAHGGIPGLIAETGSVFLGLAVFGYFIRRSAKKEREREGNDSND* |
| Ga0105245_106989452 | 3300009098 | Miscanthus Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALVVFGYFIRRSAKKEREQEDESDRDRR* |
| Ga0105247_105913382 | 3300009101 | Switchgrass Rhizosphere | MNFVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKERDRENKDKKRGRA* |
| Ga0114129_102702972 | 3300009147 | Populus Rhizosphere | MSLVLAHGGIPGLIGETGSVFIALAVFGYFIRRSAKKEREREDKER* |
| Ga0105243_120344681 | 3300009148 | Miscanthus Rhizosphere | LAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEREQERERDP* |
| Ga0105243_120344683 | 3300009148 | Miscanthus Rhizosphere | MNLVLAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEREQERE |
| Ga0105243_121235092 | 3300009148 | Miscanthus Rhizosphere | MSVVLAHGGIPGLIGETGSVFLALLVFGYFIRRSAKKE |
| Ga0111538_136203381 | 3300009156 | Populus Rhizosphere | MTLLAHGGIPGLIAETGSVIVALVVFGYFVRRSAKKEREQEADTRRDD* |
| Ga0075423_116666391 | 3300009162 | Populus Rhizosphere | GVIANTQLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKERERDDESDREHG* |
| Ga0105241_101099581 | 3300009174 | Corn Rhizosphere | LLAHGGIPGLIAETGSVFVALVVFGFFIRRSARKEREREDESDRGAR* |
| Ga0105242_111946292 | 3300009176 | Miscanthus Rhizosphere | MNLVIAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEREQERERDP* |
| Ga0105242_120167522 | 3300009176 | Miscanthus Rhizosphere | MTLLAHGGIPGLIAETSIVIAGLVIFGYFVRRSAK |
| Ga0105242_120680641 | 3300009176 | Miscanthus Rhizosphere | MSFVLAHGGIPGLIAETGSVFVGLLIFGYFIRRSAKKEKEREKGP* |
| Ga0105248_112588401 | 3300009177 | Switchgrass Rhizosphere | VTLLAHGGIPGLIAETSIVIAGLVVFGYFVRRSAK |
| Ga0105249_103394842 | 3300009553 | Switchgrass Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREQEDESDRDRR* |
| Ga0105249_107542652 | 3300009553 | Switchgrass Rhizosphere | MNLILAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEQEQERERDP* |
| Ga0126374_118449671 | 3300009792 | Tropical Forest Soil | VGAVTGLSLILAHGGIPGLIAETGSVFVALAIFGYFIRRSAKKEREREKESDQKRG* |
| Ga0126377_101150622 | 3300010362 | Tropical Forest Soil | VGPVAGLSLILAHGGIPGLIAETGSVFVALAVFGYFIRRSAKREREEEKKADRDRG* |
| Ga0126377_109341752 | 3300010362 | Tropical Forest Soil | MSLILAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREAEDDDRKS* |
| Ga0134125_110508742 | 3300010371 | Terrestrial Soil | MSFVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKERERDESERDSKRS* |
| Ga0105239_122117692 | 3300010375 | Corn Rhizosphere | MTLLAHGGIPGLIAETSCVVAALVVFGYFVRRSAK |
| Ga0134123_116705652 | 3300010403 | Terrestrial Soil | MSVVLAHGGIPGLIGETGSVFLALLVFGYFIRRSAKKEKERERDP* |
| Ga0134123_130180461 | 3300010403 | Terrestrial Soil | MTLLAHGGIPGLLAETGIAIAALAVFGYFVTRSAKKEKEQETADSHPD* |
| Ga0105246_109244222 | 3300011119 | Miscanthus Rhizosphere | MTLLAHGGIPGLIAETGSVVVALVVFGYFVRRSAKKEREQEADTRRDD* |
| Ga0137374_102698301 | 3300012204 | Vadose Zone Soil | PGLVLAHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEREREEGPDRRSH* |
| Ga0137379_110837532 | 3300012209 | Vadose Zone Soil | MSLVLAHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEQEQEREDDSKR* |
| Ga0137397_103077402 | 3300012685 | Vadose Zone Soil | MLAHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEREREEKSDRG* |
| Ga0164298_101527692 | 3300012955 | Soil | MILAHGGIPGLIAETGSVFVALAVFGFFIRRSAKKEREVEKNDDRKS* |
| Ga0164298_104635561 | 3300012955 | Soil | RALGAEPGMSVVLAHGGIPGLIGETGSVFLALLVFGYFIRRSAKKEREQERERDP* |
| Ga0164303_107379252 | 3300012957 | Soil | MSVVLAHGGIPGLIGETGSVFLALLVFGYFISRSAKKEKERERDT* |
| Ga0164299_100168121 | 3300012958 | Soil | MSLVLAHGGIPGLIAETGSVLLGLLIFGYFIRRSAKKERE |
| Ga0164299_104898332 | 3300012958 | Soil | AHGGIPGLIAETGSVVVGLLIFGYFIRRSAKRERERDHE* |
| Ga0164299_111440262 | 3300012958 | Soil | MILAHGGIPGLIAETGSVFLGLAIFGYFIRRSAKKEREREKDGKKQGQA* |
| Ga0164301_100601972 | 3300012960 | Soil | MILAHGGIPGLIAETGSVFIALAVFGFFIRRSAKKEREVEKNDDRKS* |
| Ga0164301_103443782 | 3300012960 | Soil | MSLVLAHGGIPGLIAETGSVVVGLLIFGYFIRRSAKRERERDHE* |
| Ga0164302_113075642 | 3300012961 | Soil | MILAHCGIPGLIAETGSVFVALAVFGFFIRRSAKKEREAEKNDDRKS* |
| Ga0164309_101536762 | 3300012984 | Soil | MILAHGGIPGLIAETGSVFIALAVFGFFIRRSAKKEREAEKNDDRKS* |
| Ga0164304_101518452 | 3300012986 | Soil | LIVAHGGIPGLIAETGSVFLGLAIFGYFIRRSAKKEKERERDP* |
| Ga0164304_103071982 | 3300012986 | Soil | MSLVLAHGGIPGLIAETGSVLLGLLIFGYFIRRSAKKEREQEKNGKKQGPA* |
| Ga0164306_101249062 | 3300012988 | Soil | MSVVLAHGGIPGLIGVTGSVFLALLVFGYFIRRSAKKEKERERDP* |
| Ga0164305_101016973 | 3300012989 | Soil | MSLVLAHGGIPGLIAETGSVVVGLLIFGYFIRRSAKRE |
| Ga0163162_103675972 | 3300013306 | Switchgrass Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALVVFGYFIRRSAKKEREQEDESDRGPG* |
| Ga0163162_132521482 | 3300013306 | Switchgrass Rhizosphere | MNLVLAHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQ |
| Ga0157375_103523032 | 3300013308 | Miscanthus Rhizosphere | MSVVLAHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQERERDP* |
| Ga0157375_126324472 | 3300013308 | Miscanthus Rhizosphere | MSFVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKERDRENKEKKRGRT* |
| Ga0120111_11085772 | 3300013764 | Permafrost | PVAGLIRAHGGIPDLIAETSLVFVGLGLFGYFIRRSAKKERERENDREGR* |
| Ga0157380_126764312 | 3300014326 | Switchgrass Rhizosphere | VIANTQLVLAHGGIPGLIAETGSVFIALAVFGYFIRRSAKKEREREDESDRGRG* |
| Ga0157376_123392912 | 3300014969 | Miscanthus Rhizosphere | MNFVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKERDRENKDKKRGRV* |
| Ga0173478_103075191 | 3300015201 | Soil | LVLAHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQERERDP* |
| Ga0132256_1022964482 | 3300015372 | Arabidopsis Rhizosphere | VGSLAELSLILAHGGIPGLIAETGSVFVALAIFGYFIRRSAKREREEEKNRKS* |
| Ga0132257_1017527481 | 3300015373 | Arabidopsis Rhizosphere | MNFVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKERDRENKEK |
| Ga0132257_1029892941 | 3300015373 | Arabidopsis Rhizosphere | VTLLAHGGIPGLIAETSCVIAALVVFGYFVRRSAKKEQEREEEDQ |
| Ga0132255_1013950472 | 3300015374 | Arabidopsis Rhizosphere | MSFVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKERDQENKEKKRGRT* |
| Ga0132255_1060324471 | 3300015374 | Arabidopsis Rhizosphere | VTLLAHGGIPGLIAETSCVIPALVVFGYFVRRSAKKE |
| Ga0187786_100436282 | 3300017944 | Tropical Peatland | MGALAGLSLILAHGGIPGLVAETGSVFVALGIFGYFIRRSAKRERERNDRPKN |
| Ga0187785_103334802 | 3300017947 | Tropical Peatland | GGIPGLIAETGSVFVALALFGYFIRRSAKKERDQEEKPGNDRS |
| Ga0187777_107899442 | 3300017974 | Tropical Peatland | MGALAGLSLVLAHGGIPGLIAETGSVFVALALFGYVIRRSAKKERDQEEKPGNDRS |
| Ga0187787_104228532 | 3300018029 | Tropical Peatland | MGALAGIAPTLLAHGGIPGLIGETGSVFLALGLFGYFIRRSAKKEKEREREEGGEPKE |
| Ga0187788_100108271 | 3300018032 | Tropical Peatland | VGALAGLSLILAHGGIPGLIAETGSVFVALGIFGYFIRRSAKRERERNDRPKN |
| Ga0184623_101915061 | 3300018056 | Groundwater Sediment | MGSQPGLAALFLAHGGITGLIAETSLVFVSLGLFGYFIRRLAKKEREREEH |
| Ga0187765_101348492 | 3300018060 | Tropical Peatland | MGALAGLSLVLAHGGIPGLIAETGSVFVALALFGYFIRRSAKKERDQEEKPGNDRS |
| Ga0187774_109976231 | 3300018089 | Tropical Peatland | MSLLLAHGGIPGLIGETGSVFVGLALFGYFIRRSAKKERAKEKEQKPPD |
| Ga0187774_112788462 | 3300018089 | Tropical Peatland | VGALAGLSLILAHGGIPGLIAETGSVFVALAIFGYFIHRSARKERKQDKREGD |
| Ga0173482_100274392 | 3300019361 | Soil | MNLVLAHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQERERDP |
| Ga0173479_106152852 | 3300019362 | Soil | VTLLAHGGIPGLIAETSIVIAGLVVFGYFVRRSAKKEEREEEDQGRK |
| Ga0207423_10981282 | 3300025535 | Natural And Restored Wetlands | MTTILAHGGIPGLIGETGSVFVALVIFGYFIRRSAKKERERDDKSDREGS |
| Ga0207642_102059552 | 3300025899 | Miscanthus Rhizosphere | MNLVLAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEREQERERDP |
| Ga0207688_105484912 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VIANTQLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREREDESDRGRG |
| Ga0207654_112836881 | 3300025911 | Corn Rhizosphere | LLAHGGIPGLIAETGSVFVALVVFGFFIRRSARKEREREDESDRGAR |
| Ga0207662_102210162 | 3300025918 | Switchgrass Rhizosphere | MNLVLAHGGIPGLIGETGSVFLGLVIFGYFIRRSAKKEKERERDP |
| Ga0207687_112366182 | 3300025927 | Miscanthus Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALVVFGYFIRRSAKKEREQEDESDRDRR |
| Ga0207701_117195542 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLLAHGGIPGLIAETGSVIVALAVFGYFVRRSAKREKE |
| Ga0207706_112526252 | 3300025933 | Corn Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALVVFGYFIRRSAKKE |
| Ga0207661_104324552 | 3300025944 | Corn Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREQEDESDRGRS |
| Ga0207661_111543812 | 3300025944 | Corn Rhizosphere | VTLLAHGGIPGLIAETGSVIVALAVFGYFVRRSAKRE |
| Ga0207668_111803042 | 3300025972 | Switchgrass Rhizosphere | MNLVLAHGGIPGLIGETGSVFLALLVFGYFIRRSAKKEREQERERDP |
| Ga0207640_109454351 | 3300025981 | Corn Rhizosphere | MSLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKEREQEDESDRGPG |
| Ga0207658_118424792 | 3300025986 | Switchgrass Rhizosphere | MSAILAHGGIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQERERDP |
| Ga0207658_118966162 | 3300025986 | Switchgrass Rhizosphere | GIPGLIGETGSVFLGLLIFGYFIRRSAKKEREQERERDP |
| Ga0207677_121740922 | 3300026023 | Miscanthus Rhizosphere | IPGLIAETGSVFVALVVFGFFIRRSARKEREREDESDRGAR |
| Ga0207678_119464902 | 3300026067 | Corn Rhizosphere | MSFVLAHGGIPGLIGETGSVFVALAVFGYFIRRSAKKEREREGGPNRK |
| Ga0207702_102880291 | 3300026078 | Corn Rhizosphere | LAHGGIPGLIAETGSVFVALAVFGFFIRRSAKKEREAEKNDDRKS |
| Ga0207683_102284402 | 3300026121 | Miscanthus Rhizosphere | IRFPMILAHGGIPGLIAETGSVFVALAVFGFFIRRSAKKEREAEKNDDRKS |
| Ga0207683_115628721 | 3300026121 | Miscanthus Rhizosphere | GGIPGLIGETGSVFVALAVFGYFIRRSAKKERDQENKEKKRGRT |
| Ga0208637_10240012 | 3300027401 | Soil | MSPVLAHGGIPGLIAETGGVVVCLVIFGYFIRRSAKKERERERDS |
| Ga0209811_101750101 | 3300027821 | Surface Soil | MSPVLAHGGIPGLIAETGGVVVCLVIFGYFIRRSAKKEQEQERDS |
| Ga0247828_108974112 | 3300028587 | Soil | MTLVLAHGGIPGLIAETGTVVVGLLIFGYFIRRSAKKEREREKDHE |
| Ga0307307_101376151 | 3300028718 | Soil | MLGHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEREREEKSDRG |
| Ga0307320_100461542 | 3300028771 | Soil | MGLVAGLILAHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEREKEEESKR |
| Ga0307305_102462392 | 3300028807 | Soil | GHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEREREEKSDRG |
| Ga0307305_103959072 | 3300028807 | Soil | PMGPVAGLILAHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEREREKGER |
| Ga0307296_104098261 | 3300028819 | Soil | PMGAVAGLILAHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEREREEKSDRG |
| Ga0307312_101960662 | 3300028828 | Soil | MGAVAGLILAHGGIPGLIAETSLVFVGLGLFGYFIRRSAKKEREREEKSDRG |
| Ga0307312_105485792 | 3300028828 | Soil | AIRFHLSLVLAHGGIPGLIAETGSVFVALVVFGYFIRRSAKKEREREDESDRRG |
| Ga0307497_101231632 | 3300031226 | Soil | MTLVLAHGGIPGLIAETGSVVVGLLIFGYFIRRSAKKERERERDS |
| Ga0307506_103962602 | 3300031366 | Soil | MTLLAHGGIPGLIAETSCVILGLAIFGYFIRRGAKKEQERDDDPSLRD |
| Ga0310907_108618962 | 3300031847 | Soil | VIANTQLVLAHGGIPGLIAETGSVFVALAVFGYFIRRSAKKERERDDESDREHG |
| Ga0335082_107151102 | 3300032782 | Soil | MGALPGLSLILAHGGIPGLIAETGSIFVALAIFGYFIRRSAKRERDKQRQQQDGER |
| Ga0335084_111342202 | 3300033004 | Soil | MGALPGLSLILAHGGIPGLIAETGSIFVALAIFGYFIRRSAKRERERNDRPKN |
| Ga0335084_115601932 | 3300033004 | Soil | MGALAGLSLILAHGGIPGLIAETGSVFVALAIFGYFIRRSAKREQEEE |
| Ga0310810_111057341 | 3300033412 | Soil | MGAVAGLIVAHGGIPGLIAETGSVFLGLAIFGYFVRRSAKKEREREGGPNRK |
| Ga0247830_116361441 | 3300033551 | Soil | MILAHGGIPGLIAETGSVFVALAVFGFFIRRSAKKEREAEKNDDRKS |
| ⦗Top⦘ |