| Basic Information | |
|---|---|
| Family ID | F037332 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLTKKALLVVFCSLVFPICPLLYGQATASFSGTVTDKTGSVVSG |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.14 % |
| % of genes near scaffold ends (potentially truncated) | 95.83 % |
| % of genes from short scaffolds (< 2000 bps) | 86.31 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.238 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.595 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.952 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 8.33% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF00294 | PfkB | 35.12 |
| PF00857 | Isochorismatase | 16.67 |
| PF01979 | Amidohydro_1 | 4.76 |
| PF00171 | Aldedh | 4.17 |
| PF03781 | FGE-sulfatase | 2.98 |
| PF01156 | IU_nuc_hydro | 1.19 |
| PF00795 | CN_hydrolase | 1.19 |
| PF07168 | Ureide_permease | 1.19 |
| PF04255 | DUF433 | 0.60 |
| PF13377 | Peripla_BP_3 | 0.60 |
| PF00133 | tRNA-synt_1 | 0.60 |
| PF01791 | DeoC | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 16.67 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 16.67 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 4.17 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 4.17 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 4.17 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 2.98 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 1.19 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.24 % |
| Unclassified | root | N/A | 29.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10179903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100490292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1106 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101763565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 519 | Open in IMG/M |
| 3300002907|JGI25613J43889_10051864 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300004092|Ga0062389_101983996 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300004152|Ga0062386_101600204 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005171|Ga0066677_10851130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 502 | Open in IMG/M |
| 3300005178|Ga0066688_10037376 | All Organisms → cellular organisms → Bacteria | 2731 | Open in IMG/M |
| 3300005294|Ga0065705_10534831 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300005337|Ga0070682_100745353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300005338|Ga0068868_101195799 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005434|Ga0070709_10511916 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005434|Ga0070709_10990010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 668 | Open in IMG/M |
| 3300005440|Ga0070705_101019623 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005455|Ga0070663_100596365 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005542|Ga0070732_10249986 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300005542|Ga0070732_10578193 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005555|Ga0066692_10029242 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
| 3300005591|Ga0070761_10666250 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005598|Ga0066706_11312633 | Not Available | 547 | Open in IMG/M |
| 3300005844|Ga0068862_100306071 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300005921|Ga0070766_10373327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 930 | Open in IMG/M |
| 3300006041|Ga0075023_100294749 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300006102|Ga0075015_100756592 | Not Available | 580 | Open in IMG/M |
| 3300006162|Ga0075030_100120617 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300006175|Ga0070712_101040806 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300006358|Ga0068871_101163964 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300006755|Ga0079222_10780112 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300006796|Ga0066665_10484027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1016 | Open in IMG/M |
| 3300006804|Ga0079221_11761423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300006893|Ga0073928_11048168 | Not Available | 554 | Open in IMG/M |
| 3300009088|Ga0099830_11496329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300009090|Ga0099827_10126172 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300009090|Ga0099827_11058940 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009137|Ga0066709_104539095 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009143|Ga0099792_10967567 | Not Available | 567 | Open in IMG/M |
| 3300009545|Ga0105237_10113653 | All Organisms → cellular organisms → Bacteria | 2700 | Open in IMG/M |
| 3300009547|Ga0116136_1131924 | Not Available | 638 | Open in IMG/M |
| 3300009631|Ga0116115_1134884 | Not Available | 628 | Open in IMG/M |
| 3300009643|Ga0116110_1256713 | Not Available | 559 | Open in IMG/M |
| 3300009683|Ga0116224_10507596 | Not Available | 575 | Open in IMG/M |
| 3300009759|Ga0116101_1125344 | Not Available | 614 | Open in IMG/M |
| 3300009762|Ga0116130_1113729 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300009764|Ga0116134_1174395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300010043|Ga0126380_10485306 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300010047|Ga0126382_10993120 | Not Available | 735 | Open in IMG/M |
| 3300010322|Ga0134084_10253649 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010335|Ga0134063_10611729 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010341|Ga0074045_10024471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4659 | Open in IMG/M |
| 3300010343|Ga0074044_10304077 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300010343|Ga0074044_10560807 | Not Available | 746 | Open in IMG/M |
| 3300010360|Ga0126372_12300814 | Not Available | 589 | Open in IMG/M |
| 3300010376|Ga0126381_104488992 | Not Available | 539 | Open in IMG/M |
| 3300010398|Ga0126383_11602480 | Not Available | 740 | Open in IMG/M |
| 3300010401|Ga0134121_11216294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300010880|Ga0126350_10867404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012189|Ga0137388_10963712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300012198|Ga0137364_10666224 | Not Available | 785 | Open in IMG/M |
| 3300012200|Ga0137382_10079041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2128 | Open in IMG/M |
| 3300012201|Ga0137365_11166163 | Not Available | 552 | Open in IMG/M |
| 3300012203|Ga0137399_10036936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3431 | Open in IMG/M |
| 3300012205|Ga0137362_11232418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300012205|Ga0137362_11577353 | Not Available | 543 | Open in IMG/M |
| 3300012208|Ga0137376_11669792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012917|Ga0137395_10437574 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300012976|Ga0134076_10333242 | Not Available | 664 | Open in IMG/M |
| 3300012976|Ga0134076_10429162 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012985|Ga0164308_10154088 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300014325|Ga0163163_11366979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300014489|Ga0182018_10671262 | Not Available | 541 | Open in IMG/M |
| 3300014501|Ga0182024_10636833 | Not Available | 1328 | Open in IMG/M |
| 3300014968|Ga0157379_11948382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300015242|Ga0137412_10565467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300015359|Ga0134085_10183014 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300016422|Ga0182039_11109627 | Not Available | 712 | Open in IMG/M |
| 3300016422|Ga0182039_11758000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300017936|Ga0187821_10087186 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300017959|Ga0187779_10805539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300018006|Ga0187804_10439177 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300018006|Ga0187804_10492488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300018038|Ga0187855_10024974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3866 | Open in IMG/M |
| 3300018038|Ga0187855_10277007 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300018038|Ga0187855_10510576 | Not Available | 700 | Open in IMG/M |
| 3300018043|Ga0187887_10004158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 10950 | Open in IMG/M |
| 3300018058|Ga0187766_10524270 | Not Available | 800 | Open in IMG/M |
| 3300018088|Ga0187771_10510409 | Not Available | 1017 | Open in IMG/M |
| 3300018090|Ga0187770_10042096 | All Organisms → cellular organisms → Bacteria | 3254 | Open in IMG/M |
| 3300018431|Ga0066655_11044138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300018433|Ga0066667_10599021 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300019786|Ga0182025_1093446 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300019887|Ga0193729_1197126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300020006|Ga0193735_1085981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300020579|Ga0210407_11479940 | Not Available | 501 | Open in IMG/M |
| 3300020580|Ga0210403_10840624 | Not Available | 727 | Open in IMG/M |
| 3300020581|Ga0210399_11607051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300020583|Ga0210401_10928916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300021178|Ga0210408_11399536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300021181|Ga0210388_10171978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1889 | Open in IMG/M |
| 3300021401|Ga0210393_10092086 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300021407|Ga0210383_11377748 | Not Available | 587 | Open in IMG/M |
| 3300021420|Ga0210394_10350470 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300021420|Ga0210394_10406240 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300021420|Ga0210394_10971980 | Not Available | 737 | Open in IMG/M |
| 3300021432|Ga0210384_10680253 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300021433|Ga0210391_10731816 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300021433|Ga0210391_11161229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300021474|Ga0210390_10188097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1746 | Open in IMG/M |
| 3300021478|Ga0210402_10272129 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300021478|Ga0210402_11405691 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021479|Ga0210410_11555972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300021559|Ga0210409_11225999 | Not Available | 626 | Open in IMG/M |
| 3300021560|Ga0126371_10149272 | Not Available | 2397 | Open in IMG/M |
| 3300021560|Ga0126371_13270483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300022557|Ga0212123_10187080 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300024225|Ga0224572_1007195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2033 | Open in IMG/M |
| 3300025320|Ga0209171_10123871 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300025414|Ga0208935_1038163 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025414|Ga0208935_1045228 | Not Available | 587 | Open in IMG/M |
| 3300025494|Ga0207928_1084387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300025898|Ga0207692_10187461 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300025906|Ga0207699_11331014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300025914|Ga0207671_10331787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300025916|Ga0207663_10863833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300025961|Ga0207712_11652307 | Not Available | 574 | Open in IMG/M |
| 3300025986|Ga0207658_10468673 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300026078|Ga0207702_11202061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300026314|Ga0209268_1176980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300026315|Ga0209686_1208442 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300026332|Ga0209803_1001112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17803 | Open in IMG/M |
| 3300026334|Ga0209377_1310436 | Not Available | 526 | Open in IMG/M |
| 3300026467|Ga0257154_1016451 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300026540|Ga0209376_1149451 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300027061|Ga0209729_1030158 | Not Available | 672 | Open in IMG/M |
| 3300027439|Ga0209332_1105339 | Not Available | 503 | Open in IMG/M |
| 3300027565|Ga0209219_1141863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300027567|Ga0209115_1134095 | Not Available | 558 | Open in IMG/M |
| 3300027590|Ga0209116_1037011 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300027609|Ga0209221_1091736 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300027825|Ga0209039_10177587 | Not Available | 875 | Open in IMG/M |
| 3300027829|Ga0209773_10070960 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300027853|Ga0209274_10202306 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300027875|Ga0209283_10200737 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300027889|Ga0209380_10724578 | Not Available | 569 | Open in IMG/M |
| 3300028047|Ga0209526_10371598 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300028788|Ga0302189_10185447 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300030002|Ga0311350_10525381 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300030494|Ga0310037_10268909 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300030507|Ga0302192_10163905 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300030518|Ga0302275_10145528 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300030617|Ga0311356_10345982 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300030659|Ga0316363_10306084 | Not Available | 634 | Open in IMG/M |
| 3300031027|Ga0302308_10574315 | Not Available | 653 | Open in IMG/M |
| 3300031708|Ga0310686_109616578 | Not Available | 684 | Open in IMG/M |
| 3300031720|Ga0307469_10537972 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300031820|Ga0307473_10132355 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300031823|Ga0307478_11508752 | Not Available | 556 | Open in IMG/M |
| 3300032205|Ga0307472_102658334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300032205|Ga0307472_102726059 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032783|Ga0335079_10152523 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
| 3300033158|Ga0335077_10268330 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300033290|Ga0318519_10861127 | Not Available | 559 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.36% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.79% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.79% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.19% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.19% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.60% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_101799032 | 3300000597 | Forest Soil | MLAKKALLVVFLGSLLVCPLLYGQANGSFSGTVVDKTGSVVTGAQIRVT |
| JGIcombinedJ26739_1004902922 | 3300002245 | Forest Soil | MLSKKTLLVLFCSLVFPICPLLYGQATGSFSGTVTDKTGSVLAGASVKA |
| JGIcombinedJ26739_1017635652 | 3300002245 | Forest Soil | MLTKRALLSAASAFVLLICPQLYGQANGSLSGTVSD |
| JGI25613J43889_100518641 | 3300002907 | Grasslands Soil | MLNKRALLVVVFFSLVASVCPLLHSQATGSLAGTVSDKGGAV |
| Ga0062389_1019839961 | 3300004092 | Bog Forest Soil | MLNKKALLVGCFCFLIFSLCPLLFGQATGSFSGTVSDKAGAVVS |
| Ga0062386_1016002041 | 3300004152 | Bog Forest Soil | MLHKRALLVVAVFSLAFSLCPLLYGQATGSFSGTVTDKAGAVVTGAT |
| Ga0066677_108511301 | 3300005171 | Soil | MLIKRTLIVVLFCSVVFSISPLLYGQANGSFLGTVSDKTGSVI |
| Ga0066688_100373761 | 3300005178 | Soil | MLNKKALLLVFCGSLLFTISPLLYGQATGSFSGTVTDKTGSVIS |
| Ga0065705_105348311 | 3300005294 | Switchgrass Rhizosphere | MLTKKTLLVLLCTLVFPICPLLYGQATGSFSGTVSDKTGSVITGAK |
| Ga0070682_1007453532 | 3300005337 | Corn Rhizosphere | MTKKALLVFFCCLVFPICPLLYGQASGSFSGTVTDKTGSVVSGASVK |
| Ga0068868_1011957991 | 3300005338 | Miscanthus Rhizosphere | MLNKMTLSRVFVCSLVLFACPLMFGQATGSFSGTISDKTGSVVSG |
| Ga0070709_105119162 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMKKALLVVFCSLVFPVCPLLYGQATGSFSGTVTDKTGSVVSGAN |
| Ga0070709_109900101 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTARLMTARKTLLVLFCLLVFFVCPLLYGQATGSFSGTVTDKTGSVVSGAS |
| Ga0070705_1010196232 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTKKALLVVFCSLVFPICPLLYGQATASFSGTVTDKTGSVVSG |
| Ga0070663_1005963651 | 3300005455 | Corn Rhizosphere | MLTKKALLVVLCSLVFPICPLLYGQATASFSGTVTDKTGSVVSGAA |
| Ga0070732_102499861 | 3300005542 | Surface Soil | MLNKKALLLVLCCSLFLTISPLVYGQATGSFSGTVSDKTGSVISGATVRVT |
| Ga0070732_105781931 | 3300005542 | Surface Soil | MLTKRTLLVVFCSVVFPICPLLYGQATGSFSGTVSDKTGS |
| Ga0066692_100292424 | 3300005555 | Soil | VVFLCSLVFSVSPLLFAQANGSFSGTVSDKTGSVVAGAT |
| Ga0070761_106662501 | 3300005591 | Soil | MLNKRALLAGVFCSIVFLVCPHLYGQATGSFSGTVSDKAGAVISGATVKA |
| Ga0066706_113126331 | 3300005598 | Soil | MLTKPTLLAIFCSLTFPICPLLYGQATGSLSGTVS |
| Ga0068862_1003060713 | 3300005844 | Switchgrass Rhizosphere | MLTKKTLLVLLCTLVFPICPLLYGQATGSFSGTVSDKTGSVITGAKVT |
| Ga0070766_103733272 | 3300005921 | Soil | MLNRRTLIVVFVSFVFPICPLLYGQATGSFSGTVSDKTGSVVSGATV |
| Ga0075023_1002947491 | 3300006041 | Watersheds | MLNRKALLLVFCCLLVLTTSPLVFGQATGSFEGTVSD |
| Ga0075015_1007565922 | 3300006102 | Watersheds | MLSKKALLIIFCSLFFPICPLLHGQATASFFGTVVDKTGSV |
| Ga0075030_1001206171 | 3300006162 | Watersheds | MLSKKALLIIFCSLFFPICPLLHGQATASFFGTVVDKTGSVIAGA |
| Ga0070712_1010408062 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTKKALLVVFCSLVFPICPLLYGQANGSFSGTVTDKTGSVVTGAEVKATAQ |
| Ga0068871_1011639642 | 3300006358 | Miscanthus Rhizosphere | LTKKALLVVFCSLVFPICPLLYGQATASFSGTVTDKTGSVVSGATVKAT |
| Ga0079222_107801122 | 3300006755 | Agricultural Soil | MVTKRTLLAVFFCFLVFSIQPLLYGQANGSFSGTVADKTGSV |
| Ga0066665_104840272 | 3300006796 | Soil | MLTKRTLIVVLFCSVVFSISPLLYGQANGSFLGTVSDKTGSVIS |
| Ga0079221_117614232 | 3300006804 | Agricultural Soil | MITRKSLLVLFCSVLFSCCPLLYGQASGSFSGTVSDKTGSVVSGASVK |
| Ga0073928_110481682 | 3300006893 | Iron-Sulfur Acid Spring | MLTKKALLAVFCSLVFPVCPLLYGQATASFAGTVTDKTGSVVVGASVKATAQG |
| Ga0099830_114963291 | 3300009088 | Vadose Zone Soil | MLKKKALLVAFFCSFVCPLLYGQATGSFSGTVTDKAGAVVSGAT |
| Ga0099827_101261721 | 3300009090 | Vadose Zone Soil | MTTRKTLLVLFCSLVFSCCPLLYGQATGSFSGTVADKTGSVLTGATVKLTS |
| Ga0099827_110589402 | 3300009090 | Vadose Zone Soil | MLTKKSLLVVFFCSILLPVCPLLLGQATGSFSGTVSDNSGAVVA |
| Ga0066709_1045390952 | 3300009137 | Grasslands Soil | MFTKRALIAAVFCAIAVSICCPLLYVQATGSFSGTVSDKTESV |
| Ga0099792_109675672 | 3300009143 | Vadose Zone Soil | MVNKKALLVVVFCSFAFSVCPLLYGQATGSLSGTVSDKGGAVVSGATVKATSRE |
| Ga0105237_101136531 | 3300009545 | Corn Rhizosphere | MLTKKVLLVVFCSLVFPICPLLYGQATASFSGTVTDK |
| Ga0116136_11319242 | 3300009547 | Peatland | MLNKRALLGVFFFSLVFAVCPLLYGQATGSFSGTVSDKAGLVISGATVTVASQ |
| Ga0116115_11348842 | 3300009631 | Peatland | MLNKRALLGVFFFSLVFAVCPLLYGQATGSFSGTVSDKAGLVISGATVTV |
| Ga0116110_12567131 | 3300009643 | Peatland | MLNKRALLGVVFFSLVFAVCPLLYGQATGSFSGTVSDK |
| Ga0116224_105075962 | 3300009683 | Peatlands Soil | MLNKKALRGVVFFSLLLTICPLLYGQATGSFSGTVSD |
| Ga0116101_11253442 | 3300009759 | Peatland | MLTKKVLLGCCCFLIFSLCPFLYSQATGSFSGTVSDNSGAVVAS |
| Ga0116130_11137291 | 3300009762 | Peatland | MLNKRALLVGAVCSLIFSICPMLHGQATGSFSGTVSDKAGAV |
| Ga0116134_11743952 | 3300009764 | Peatland | MLNKKALLGVVFLSLVFAVCPLMYGQATGSFSGTVSDKAGAVISGATV |
| Ga0126380_104853062 | 3300010043 | Tropical Forest Soil | MLNKKALLYVFCCLLLLTISPLLYGQATGSFSGTVTDKTGSVIAG |
| Ga0126382_109931201 | 3300010047 | Tropical Forest Soil | MLSKKALLYVFCRLLLSTISPLLYGQGTGSFEGTVSDKTGSVIPG |
| Ga0126373_119863442 | 3300010048 | Tropical Forest Soil | MFMLKRKALLLAFCGLLLLAISPLLLYGQATGSFAGTVSDKTGSVIANATIRITSQGTAQVREAK |
| Ga0134084_102536492 | 3300010322 | Grasslands Soil | MLTKRTLIVVLFCSVVFSVSPLLYGQANGSFSGTVS |
| Ga0134063_106117291 | 3300010335 | Grasslands Soil | LIKRTLIVVLFCSFALCVSPLLYGQANGNFSGTVADKTGS |
| Ga0074045_100244711 | 3300010341 | Bog Forest Soil | MSTKKVLLVAVMSFVLSLCPLLYGQANGSFSGTVADKT |
| Ga0074044_103040771 | 3300010343 | Bog Forest Soil | MLTKRVLLAVFFCSLIGSICPLLYGQASGSFSGTVSDKA |
| Ga0074044_105608072 | 3300010343 | Bog Forest Soil | MLNKRALLVVIVFSLIASLCPLLYGQASGSFSGTVSDKAGAVVPG |
| Ga0126372_123008141 | 3300010360 | Tropical Forest Soil | MLTKSALRVVVVCFLVVSVSQFLFSQANGSFSGTVADKTGS |
| Ga0126381_1044889921 | 3300010376 | Tropical Forest Soil | MFTKKALLVVLFCLMVVSASPLLFGQANGSFSGTISDKTGS |
| Ga0126383_116024802 | 3300010398 | Tropical Forest Soil | MLSKKALLYVFCCLLLSTISPLLYGQATGSFSGTV |
| Ga0134121_112162942 | 3300010401 | Terrestrial Soil | MTTRKILLVLFCTLLFPVCPLLYGQATGSFVGTVTDKTGSVISGADVKATVQGTGIT |
| Ga0126350_108674041 | 3300010880 | Boreal Forest Soil | MLHKKALLVVVVFSLAFPVCPLLYGQATGSFSGTVTDKAGAVVSGA |
| Ga0137388_109637121 | 3300012189 | Vadose Zone Soil | MRTARGILMLTKKALLVVFCSLVFPICPLLYGQATASFSGTVTDKTGSVVAG |
| Ga0137364_106662242 | 3300012198 | Vadose Zone Soil | MLMLTKRTLLAIFCSLTFPICPLLYGQATGSLSGTVSDKTGSVV |
| Ga0137382_100790413 | 3300012200 | Vadose Zone Soil | MVHRRALLVVVFCSFVFSTCSLLYGQANGSFSGTVTDKTGSVVSG |
| Ga0137365_111661631 | 3300012201 | Vadose Zone Soil | MLTKRTLIVAIFCSVTFFISPLLYGQANGSFLGTV |
| Ga0137399_100369361 | 3300012203 | Vadose Zone Soil | MLTKRTLLAMFCSLVFPIYPLLYGQATGSLSGTVSDKTGSVV |
| Ga0137362_112324181 | 3300012205 | Vadose Zone Soil | MLNKKALLLVFCGSLLFTISPLLYGQATGSFSGTVTDKTGS |
| Ga0137362_115773531 | 3300012205 | Vadose Zone Soil | MLTKRKLIVAVSSLLFSISPVVYSQATGSFLGTVSDKA |
| Ga0137376_116697922 | 3300012208 | Vadose Zone Soil | MLIKRMLIVVLFCSFALCVSPLLYGQANGNFSGTVADKTGSVISGA |
| Ga0137395_104375741 | 3300012917 | Vadose Zone Soil | MLKKKALLVAFFCSFISPLVYGQATGSFSGTVSDKAGAVVSGAT |
| Ga0134076_103332422 | 3300012976 | Grasslands Soil | MMTKRTLLAVFCSLIFPICPLLYGQATGSLSGTVSDKTGSVVTGAKVTVTS |
| Ga0134076_104291621 | 3300012976 | Grasslands Soil | MLTKRTLIVVLFCSVVFSVSPLLYGQANGVFLGTVS |
| Ga0164308_101540883 | 3300012985 | Soil | MLTKKALLVVFCSLVFPICPLLYGQANGGFSGTVTDKTGSVVTGAEVKATAHEPGVVRES |
| Ga0163163_113669792 | 3300014325 | Switchgrass Rhizosphere | MLTKKVLLVVLCSLVFPICPLLYGQATASFSGTVTDKTGSVVSGATVKATAQA |
| Ga0182018_106712622 | 3300014489 | Palsa | LFIIRRGAAEKGFLMLKLNKRALLVGVVCSLAFSICPMLHGQATGSFSGTVSDKAG |
| Ga0182024_106368331 | 3300014501 | Permafrost | MLKKRALLVAVVFSLVVSVWPLLYSQATGSFSGTVSDK |
| Ga0157379_119483821 | 3300014968 | Switchgrass Rhizosphere | MTKKALLVLFCCLVFPICPLLYGQASGSFSGTVTDKTGSVVS |
| Ga0137412_105654672 | 3300015242 | Vadose Zone Soil | MLTKKALLVVLCSLVFPICPLLYGQANGSFSGTVTDKTG |
| Ga0134085_101830142 | 3300015359 | Grasslands Soil | MLTKRTLIVVLFCSVVFSISPLLYGQANGSFLGTVSDKT |
| Ga0182039_111096272 | 3300016422 | Soil | MLKHKALLLAVCCFLMLAVSPMLFGQATGSFSGTVSDKTGSVI |
| Ga0182039_117580002 | 3300016422 | Soil | MPTKRTLLAAVFLSLVFSDCPLLYGQATGSFSGTV |
| Ga0187821_100871862 | 3300017936 | Freshwater Sediment | MLKRKALLLAVCCSLVFVVSPMLYGQATGSFAGTVSDKT |
| Ga0187779_108055392 | 3300017959 | Tropical Peatland | MLTKRTLLAAVFSSVVFFICPLLYGQATGSFSGTVT |
| Ga0187804_104391772 | 3300018006 | Freshwater Sediment | MLNGRTLLVVFVSLVFPICPLLYGQATGSFSGTVS |
| Ga0187804_104924881 | 3300018006 | Freshwater Sediment | MLTKRALLVVFCSLVFLICPLLYGQATGSFSGTVQDKTGSVISGAT |
| Ga0187855_100249741 | 3300018038 | Peatland | MHKKALLGVVFFSLVSMVCPFLYGQATGGFSGSVTDKAGAVISGATVKVSSTETGLSRE |
| Ga0187855_102770071 | 3300018038 | Peatland | MLNKRALLVGAVCSLIFSICPMLHGQATGSFSGTVSDK |
| Ga0187855_105105762 | 3300018038 | Peatland | MLNKKVLLIGCCCFLILALCPVLYGQVTGSFSGTVSDKAGAVVS |
| Ga0187887_100041589 | 3300018043 | Peatland | MNKKALLGVVFFSLVSMVCPFLYGQATGGFSGSVTDKAG |
| Ga0187766_105242702 | 3300018058 | Tropical Peatland | MLTKRTLLAAVFSSGVFFICPLLYGQATGSFSGTVTDKTGAAISGAT |
| Ga0187771_105104092 | 3300018088 | Tropical Peatland | MSTKKVLLVALVSVVLSFCPLIFGQANGSFSGTVADK |
| Ga0187770_100420964 | 3300018090 | Tropical Peatland | MLNKKALLVALFFSLVVSLCPLLHGQATGSFSGTVSDKAGAVISGATVK |
| Ga0066655_110441382 | 3300018431 | Grasslands Soil | MFTKRALIAAVFCAIAVSICCPLLYGQATGSFSGTVSDKTGSVITAANVTITAQS |
| Ga0066667_105990211 | 3300018433 | Grasslands Soil | MLIKRTLIVVLFCSVVFSISPLLYGQANGSFLGTVSDKTGSVIS |
| Ga0182025_10934463 | 3300019786 | Permafrost | MLTKGKLLVLLCSLVSVCPSLYGQATGSFSVTITDKTGSVIPGATVTAT |
| Ga0193729_11971261 | 3300019887 | Soil | MTARLMTARKTLLVLFCLLVFFVCPLLYGQATGSFSGTVSDKTGSVVSGASV |
| Ga0193735_10859812 | 3300020006 | Soil | MLTKRKLIVAVSSLLFSISPVVYSQATGSFSGTVSDKA |
| Ga0210407_114799401 | 3300020579 | Soil | MLTKKALLVVFCSLVFPICPLLYGQATASFSGTVTDKTGSVVAGASVKT |
| Ga0210403_108406241 | 3300020580 | Soil | MLNKKALLCGGCCFLVFSLCPLLYGQATGSFSGTVSDKAGAVVSGATVKATTQGT |
| Ga0210399_116070511 | 3300020581 | Soil | MLNKKALLCGGYCFLVFSLCPLLYGQATGSFSGTV |
| Ga0210401_109289161 | 3300020583 | Soil | MLTKKTLLVVICSLVFPACPLLHGQATGSFFGTVSDKTGSVIAGAA |
| Ga0210408_113995361 | 3300021178 | Soil | MLNKRALLVVVVFSLAFSVCPLLYGQATGSFSGTVSDKAGAVVSGAT |
| Ga0210388_101719783 | 3300021181 | Soil | MLSKRALPVVFCFVVVQICPLLYGQANGSFSGTVTDKTGSVI |
| Ga0210393_100920861 | 3300021401 | Soil | MLNKKALFVAVFSLAVSVCPVLYGQANGSFSGTVSDKS |
| Ga0210383_113777482 | 3300021407 | Soil | MLNKKALLVGCCCFLVFSLSPFLFGQATGSFSGTVSDNAGAVVSGATVRATS |
| Ga0210394_103504702 | 3300021420 | Soil | MLNKRALLGVVLCLLAFCVCPLLYGQASGSFSGTVS |
| Ga0210394_104062402 | 3300021420 | Soil | MLKKRALLVVVVLSLAFSICPLLYSQATGSFSGTVSDKA |
| Ga0210394_109719801 | 3300021420 | Soil | MFNKRALLVVVFFSISVVACPLLYGQATGSLSGTVSDKGGAVLTGAN |
| Ga0210384_106802531 | 3300021432 | Soil | MLNKRALLVVVVFSLAFSVCPLLYGQATGSFSGTVSDKAGAVVSGA |
| Ga0210391_107318161 | 3300021433 | Soil | MLTKKALLLAFCSLVLPICPLLHGQANGSFSGTVTDKTGSVISG |
| Ga0210391_111612292 | 3300021433 | Soil | MLNKKALLCGGYCFLVFSLCPLLYGQATGSFSGTVSDKAGAVVSGATVKATSQG |
| Ga0210390_101880973 | 3300021474 | Soil | MLNKRALLVAVFCWLGFSGVPFLHGQATGSFSGTVSDKAGAVVSGATVKVSS |
| Ga0210402_102721291 | 3300021478 | Soil | MLSKKTLLVVFCSLVFPISPLLYGQASGSFAGTVSDKTGSVISGAAVRATA |
| Ga0210402_114056911 | 3300021478 | Soil | MLSKRLLLVVFCSLVFPICPLLYGQASGSFSGTIADK |
| Ga0210410_115559723 | 3300021479 | Soil | MLNKKALLLVLCGSLFLTISPLVYGQATGSFEGTISDKTGSVITGANVRVTS |
| Ga0210409_112259992 | 3300021559 | Soil | MLNKRALLVAVVLSLAVSGCPVLHGQASGSFSGTVSDKAG |
| Ga0126371_101492721 | 3300021560 | Tropical Forest Soil | MLTNRTLLVVFGSLVFFISPLAHGQATGSFSGVVSDK |
| Ga0126371_132704832 | 3300021560 | Tropical Forest Soil | MPTKRTLLAAVFLSLVFSTCPLLYGQATGSFSGTVT |
| Ga0212123_101870801 | 3300022557 | Iron-Sulfur Acid Spring | MLNKKALLCGGCCFLVFSLCQLLYGQATGSFSGTVSDKAG |
| Ga0224572_10071951 | 3300024225 | Rhizosphere | MLNKKALLCGGCCFLVFSLCPLLYGQATGSFSGTVSDKAGAVVSGA |
| Ga0209171_101238713 | 3300025320 | Iron-Sulfur Acid Spring | MLNKKALLCGGCCFLVFSLCQLLYGQATGSFSGTVSDK |
| Ga0208935_10381632 | 3300025414 | Peatland | MLTKKALLLAFCSLVLPICPLLYGQANGSFSGTVTDKTGSVV |
| Ga0208935_10452281 | 3300025414 | Peatland | MLTKKVLLGCCCFLIFSLCPFLYSQATGSFSGTVS |
| Ga0207928_10843871 | 3300025494 | Arctic Peat Soil | MLTKKALLVVFCSLVFPICPLLYGQATGSFAGTVLDKTGSVVTGAS |
| Ga0207692_101874612 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEFLMLTKKVLLVFFCCLVFPICPLLYGQASGSFSGTITD |
| Ga0207699_113310142 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMKKALLVVFCSLVFPVCPLLYGQATGSFSGTVTDKTGSVVSGANV |
| Ga0207671_103317871 | 3300025914 | Corn Rhizosphere | MLTKKVLLVVFCSLVFPICPLLYGQATASFSGTVTDKTGSV |
| Ga0207663_108638332 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKKALLVLFCCLVFPICPLLYGQASGSFSGTVTD |
| Ga0207712_116523071 | 3300025961 | Switchgrass Rhizosphere | MLNKMTLSRVFVCSLVLFACPLMFGQATGSFSGTISDKTGSVVSGANVVVTSQG |
| Ga0207658_104686731 | 3300025986 | Switchgrass Rhizosphere | MLTKKTLLVLLCTLVFPICPLLYGQATGSFSGTVSDKTGSV |
| Ga0207702_112020611 | 3300026078 | Corn Rhizosphere | MLTKKTLLVLLCTLVFPICPLLYGQATGSFSGTVSDKTGS |
| Ga0209268_11769802 | 3300026314 | Soil | MLTKRTLIVVLFCSVVFSVSPLLYGQANGSFSGTVSDKTGSVISGA |
| Ga0209686_12084421 | 3300026315 | Soil | MTKKALLVFLFCCVVLSICPFMYGQANGSFSGTVSDNTG |
| Ga0209803_10011121 | 3300026332 | Soil | MLNKRALLVVFSCSLVFSVSPLLFAQANGSFSGTVSDKTGSVVA |
| Ga0209377_13104362 | 3300026334 | Soil | MLNKRALLVVFLCSLVFSVSPLLFAQANGSFSGTVSDKTGSVVAGAT |
| Ga0257154_10164511 | 3300026467 | Soil | MLNKRALLVAVFCSLVFSGGPFLHGQATGSFSGTVTDKAGA |
| Ga0209376_11494512 | 3300026540 | Soil | MSMLIKRTLIVVLFCSVVFSISPLLYGQANGSFSGTVSDK |
| Ga0209729_10301581 | 3300027061 | Forest Soil | MLSKKALLLVFCCPLLLTISPLLYGQATGSFSGTVSDKTGS |
| Ga0209332_11053391 | 3300027439 | Forest Soil | MLKRALLVVVFCSSAFSVCPFLHGQATGSLSGTVSDKAGAVLSGATVKATSQA |
| Ga0209219_11418631 | 3300027565 | Forest Soil | MLTKKALLVVFCSLVFPMCPLLYGQATASFSGTVTDKTGSVVV |
| Ga0209115_11340951 | 3300027567 | Forest Soil | MRRGAAERFAMLHKRALLVVFVVVFSLAFSICPLLYGQATGSFSGTVSDKAGAVVAG |
| Ga0209116_10370112 | 3300027590 | Forest Soil | MLNKKALLVGSCCFLVFSLCPLLFSQATGSFSGTISDNAGAVVSGATVRATSQGT |
| Ga0209221_10917361 | 3300027609 | Forest Soil | MLNKCALPVVVSFLLAVSACPLLQGQASGSFSGTASDKAGAVV |
| Ga0209039_101775871 | 3300027825 | Bog Forest Soil | MLTKKVLLVTAMSFVLSLCPLLYGQANGSLSGTVA |
| Ga0209773_100709601 | 3300027829 | Bog Forest Soil | MLKGVLMSNKKALLGVVFFALVFSVCPLLYSQATGSFSGTVSDKAGAVISGATVKATSQ |
| Ga0209274_102023061 | 3300027853 | Soil | MLTKKALLLAFCSLLLPICPLLYGQANGSFSGTVTDKTG |
| Ga0209283_102007372 | 3300027875 | Vadose Zone Soil | MLTKRTLFVVVFCSLVFSICPLLYGQANGSFLGTRF |
| Ga0209380_107245782 | 3300027889 | Soil | MLNKKALLVAVVFSIAVSACPRLYSQASGSFSGTVSDKAGAIVVGATVKVTSQ |
| Ga0209526_103715981 | 3300028047 | Forest Soil | MLNKRALLVVVFFSLVASVCPLLHGQATGSLAGTVSDKAGAVVSGATVR |
| Ga0302189_101854472 | 3300028788 | Bog | MLNKRALLVGAVCSLIFSICPMLHGQATGSFSGTVSDKAGAVVSG |
| Ga0311350_105253812 | 3300030002 | Fen | MLNKRSLLAVIFCSLLLPICPLLYGQATASFAGTVTDKTGGVISGATVKATSQ |
| Ga0302182_101556882 | 3300030054 | Palsa | MRCGAAERFAMLHKRALLVVVVFSLTSSLCPLLYGQASGSFSGTVSDKAGAVVAGATVKVLSQGT |
| Ga0310037_102689091 | 3300030494 | Peatlands Soil | MLTKRLLLVVFCSLVFPISPLLHGQATGSFSGTIADKTG |
| Ga0302192_101639051 | 3300030507 | Bog | MLNTRALVIFASSLLLTMCPLLQGQASGSFEGTVSDKAG |
| Ga0302275_101455282 | 3300030518 | Bog | MLNRSALFVVIVFSLVFSLCPLLSGQATASFSGTVADKA |
| Ga0311356_103459822 | 3300030617 | Palsa | MLNKKALLVGCCCFLVFSLCPLLYGQATGSFSGTVSDNS |
| Ga0316363_103060841 | 3300030659 | Peatlands Soil | MLTKRVLLAAFFSSLIGSICPLLYGQASGSFSGTVSDKAGAVVSA |
| Ga0302308_105743151 | 3300031027 | Palsa | MNKKSLLVGAFCSLVLSICPHLYGQATGSFSGTVSDKAGAVISGAT |
| Ga0310686_1096165781 | 3300031708 | Soil | MLNKKALIVGSCCFLVFFLCFLCPLLYGQATGSFSGTVSDKAGAVVSG |
| Ga0307469_105379722 | 3300031720 | Hardwood Forest Soil | MLNRKALLLFCCFSLSTISPLLYGQATGSFSGTVSDK |
| Ga0318501_102191851 | 3300031736 | Soil | MLKHKALLLAVCCFLMLAVSPMLFGQATGSFSGTVSDKTGSVIPNASVRITSQG |
| Ga0318521_106622802 | 3300031770 | Soil | MLKHKALLLAVCCFLMLAVSPMLFGQATGSFSGTVSDKTGSVIPNASVRI |
| Ga0307473_101323551 | 3300031820 | Hardwood Forest Soil | MSTKRTLLVFFSLLVLPICPLLYGQATASFSGTVTDKT |
| Ga0307478_115087521 | 3300031823 | Hardwood Forest Soil | MLIKKVLLVVVFSLGVSVCPLLYGQANGSFSGTVSDKSGAVVSGATV |
| Ga0306923_101311711 | 3300031910 | Soil | MLKHKALLLAVCCFLMLAVSPMLFGQATGSFSGTVSDKTGSVIPNASVRITSQGTAQV |
| Ga0318530_101473552 | 3300031959 | Soil | MLKHKALLLAVCCFLMLAVSPMLFGQATGSFSGTVSDKTGSVIPNASVR |
| Ga0307472_1021140671 | 3300032205 | Hardwood Forest Soil | MLNKKALLLVFCCSLLLTISPLLYGQATGSLSGTVSDKTGSVISGANVRVTSQGTGAERESKTD |
| Ga0307472_1026583342 | 3300032205 | Hardwood Forest Soil | MFTKRTLLVVFCSLVFPICPLLHGQANGSFFGTVYDQTGSVVSGADV |
| Ga0307472_1027260591 | 3300032205 | Hardwood Forest Soil | MTKKALLVFLFCCFVLSICPFMYGQANGSFSGTVSDKTGSVI |
| Ga0335079_101525233 | 3300032783 | Soil | MLTRTTLRVTLCSFVCFVCPLLYGQATGSFSGTVVDKTGSV |
| Ga0335077_102683301 | 3300033158 | Soil | MLSKRMLLRAVLCSVALSICPLVYGQATGSFSGTVTDKTGSVISGATVRVTSQ |
| Ga0318519_108611271 | 3300033290 | Soil | MLSQRTLLAAVVCSFVFCMCPLLYGQASGSFAGTVS |
| ⦗Top⦘ |