| Basic Information | |
|---|---|
| Family ID | F037330 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MATVLGLLAFVAYVALIVGFAAAITWLVVRLTPPQKKPGGPAGS |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.95 % |
| % of genes near scaffold ends (potentially truncated) | 23.21 % |
| % of genes from short scaffolds (< 2000 bps) | 88.10 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.167 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (7.738 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.024 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.214 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF01262 | AlaDh_PNT_C | 50.00 |
| PF05222 | AlaDh_PNT_N | 9.52 |
| PF01676 | Metalloenzyme | 5.95 |
| PF06831 | H2TH | 1.19 |
| PF01070 | FMN_dh | 0.60 |
| PF00293 | NUDIX | 0.60 |
| PF14016 | DUF4232 | 0.60 |
| PF09285 | Elong-fact-P_C | 0.60 |
| PF00326 | Peptidase_S9 | 0.60 |
| PF01149 | Fapy_DNA_glyco | 0.60 |
| PF00348 | polyprenyl_synt | 0.60 |
| PF00211 | Guanylate_cyc | 0.60 |
| PF12760 | Zn_Tnp_IS1595 | 0.60 |
| PF00462 | Glutaredoxin | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 1.79 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.60 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.60 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.60 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.17 % |
| Unclassified | root | N/A | 45.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.19% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.60% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.60% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_09092500 | 2170459013 | Grass Soil | VSNVLGLIGFVLYVASIIGVAAGVTWIVVKWTPTRQSKPKPDGEAGSVDRRERQ |
| 4NP_02412050 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | VSTVLSLLAFAAYVLVIVGLAAGITWLVVRLTPPEKKPKPGGSTGSSTT |
| FE1_00421390 | 2189573002 | Grass Soil | VSTVLGLLGFVLYVAAIVGVAAGVTWIVVRWTPTKKPSDPAQS |
| C688J35102_1177712982 | 3300002568 | Soil | VSNVLGLLAFAAYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQAGS* |
| C688J35102_1198179292 | 3300002568 | Soil | MANVLGLLAFVAYVALIVGFAASVTWLVVRLTPPQRKSRPPAQG* |
| C688J35102_1208827913 | 3300002568 | Soil | MANVLGLLAFVAYVVLIVGFAAAITWLVVRLTPPKKPGGSAQS* |
| soilH2_100953533 | 3300003324 | Sugarcane Root And Bulk Soil | MATVLGLLAFVVYVALIVGFAAAVTWLVVRLTPPQRKPKPPDPASS* |
| Ga0062593_1017772251 | 3300004114 | Soil | MATVLGLLAFVAYVALIVGFAAAITWLVVRLTPPQKKPGGPAGS* |
| Ga0062593_1032252211 | 3300004114 | Soil | MATVLGLLAFVAYVVLIVGFAAAITWLVVRMTPPKKPGGPAES* |
| Ga0062589_1016600611 | 3300004156 | Soil | MATVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQKKPKPPGPAGS* |
| Ga0062589_1024441802 | 3300004156 | Soil | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGGPPSS* |
| Ga0062590_1011244581 | 3300004157 | Soil | MATVLGLLAFVAYVALIVGFAAAITWLVVRMTPPKKPGGPAEN* |
| Ga0062595_1020477542 | 3300004479 | Soil | VSNVLGLIGFVLYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQAGS* |
| Ga0062591_1011309442 | 3300004643 | Soil | MATVLGLLAFVAYVVLIVGFAAAITWLVVRMTPPQKKPGGPTQS* |
| Ga0062594_1027774192 | 3300005093 | Soil | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGVPPGS* |
| Ga0066823_100748562 | 3300005163 | Soil | VSTVLGLLGFVLYVAAIVGVAAGVTWIVVRWTPTKKPGGQAQS* |
| Ga0066809_102356082 | 3300005168 | Soil | MADVLALLAFALYIILIVGFAAGITWVVVRLTPPQKKSGGGPAPS* |
| Ga0066673_103303502 | 3300005175 | Soil | MANVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPPSS* |
| Ga0066688_109586082 | 3300005178 | Soil | MANVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPPAQG* |
| Ga0066388_1000525274 | 3300005332 | Tropical Forest Soil | VSTVLSLLAFAAYVVAIVGLAAGITWVVVRLTPPQKKKSGDSAAS* |
| Ga0066388_1003020772 | 3300005332 | Tropical Forest Soil | VSSVLSLLGFVLYVAAIIGVAAGVTWIVVRYTPTKKPSGPAQS* |
| Ga0066388_1035084361 | 3300005332 | Tropical Forest Soil | VSTVLSLLAFAAYVVVIVGFAAGITWVVVRLTPPQKKSGGSAPS* |
| Ga0066388_1064844682 | 3300005332 | Tropical Forest Soil | MATLLGLLAFAAYVVAIVGLAAGVTWLVVRWTPPEKSPRGPAQS* |
| Ga0070680_1005183661 | 3300005336 | Corn Rhizosphere | MATVLGLLAFVAYVALIVGFAAAITWLVVRLTPPQKKPSGTPDG* |
| Ga0070709_114988432 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVLSLLAFAAYVLVIVGFAAGITWLVVRLTPPDKKPKPGSPTGS* |
| Ga0070714_1000613362 | 3300005435 | Agricultural Soil | MAAVLALLAFALYIILIVGFAAGITWVVVRLTPPQKKSGGGPAPS* |
| Ga0070714_1013288832 | 3300005435 | Agricultural Soil | MSTILSLLAFAAYVIVIVGLAASITWVVVRLTPPQKKPSDPAKS* |
| Ga0070714_1023296971 | 3300005435 | Agricultural Soil | MATVLALLAFALYIVLIVGFAAGITWVVVRLTPPQKKPGGGP |
| Ga0066687_106141481 | 3300005454 | Soil | MATVLGLLAFVAYVVLIVGFAAAITWLVVRLTPPKKKPGGPAST* |
| Ga0070706_1006814732 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVLGLLGFVVYVALIVGFAALITWFVVRLTPPQKKSGGSTPS* |
| Ga0070707_1021111972 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVLGLLAFAAYVALIVGFAAAVTWLVVRWTPPQSKPRRSSQS* |
| Ga0073909_103351771 | 3300005526 | Surface Soil | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGAPPSS* |
| Ga0070741_106851612 | 3300005529 | Surface Soil | VSTAFGLLAFVAYVLVIVGVAAAVTWLVVRLTPAKKPGGPAQS* |
| Ga0070739_105510142 | 3300005532 | Surface Soil | VSTLFGLLAFVAYVALIVGFAAAVTWVVVRWTPPQKKPGGTAGS* |
| Ga0070684_1005887291 | 3300005535 | Corn Rhizosphere | VSNVLGLIGFVLYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQTGS* |
| Ga0066707_106137652 | 3300005556 | Soil | VSNVLGLLAFAAYVASIIGVAAGVTWIVVKWTPPQKKPKPGGEAGS* |
| Ga0068856_1008030312 | 3300005614 | Corn Rhizosphere | MATVLGLLAFVAYVVLIVGFAAAITWLVVRMTPPKTKSGDTAGS* |
| Ga0066905_1021329412 | 3300005713 | Tropical Forest Soil | VSTVLSLLAFAAYVVAIVGLAAGITWVVVRLTPPQKKSGGSAPS* |
| Ga0066903_10000067410 | 3300005764 | Tropical Forest Soil | MATVFGLLGFVAYVVLIVGFAALITWFVVRLTPPQKKSGGSTPD* |
| Ga0066903_1000632562 | 3300005764 | Tropical Forest Soil | MSSVLGLLGFVLYVASIIGVAAAVTWIVVRYTPAKKPGGPTQS* |
| Ga0066903_1008214012 | 3300005764 | Tropical Forest Soil | MATALGLLGFVAYVVLIVGFAALITWFVVRLTPPQKKSGGSSPS* |
| Ga0066903_1010926222 | 3300005764 | Tropical Forest Soil | VSTVLSLLAFAAYVVAIVGLAAGITWVVVRLTPPQKKPGGSAPS* |
| Ga0066903_1049025552 | 3300005764 | Tropical Forest Soil | MATVLSLLAFALYILVIVGMAAGITWVVVKLTPPQKKAGGGPASS* |
| Ga0066903_1055334372 | 3300005764 | Tropical Forest Soil | MSNVLGLLAFALYVAVIVGTAAGVTWIVVRLTPSKKPKPSGPAQT* |
| Ga0075283_10967212 | 3300005891 | Rice Paddy Soil | VSNVLGLLAFVVYVLAIVGVAAGVTWIVVRLTPPQKKPSGQARG* |
| Ga0075270_10135812 | 3300005894 | Rice Paddy Soil | VSNVLGLLAFVVYVLAIVGVAAGVTWIVVRLTPPQKKP |
| Ga0070717_105557912 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAVLALLAFALYIVLIVGFAAGITWVVVRLTPPQKKPGGGPAST* |
| Ga0070717_110461412 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNVLGLIGFVLYVASIIGVAAGVTWIVVKWTPPQKKPKPGSPAGS* |
| Ga0066656_107095962 | 3300006034 | Soil | NVLGLLAFAAYVASIIGVAAGVTWIVVKWTPPQKKPKPGGEAGS* |
| Ga0075017_1003265742 | 3300006059 | Watersheds | MATILSLLAFAAYVAAIIGLAAGITWIVVKFTPTKKKPKSTDPASS* |
| Ga0070712_1012337651 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLAFALYIILIVGFAAGITWVVVRLTPPQKKSGGGPAPS* |
| Ga0074060_119932892 | 3300006604 | Soil | VSTVLGLLGFVLYVAAIVGVAAGVTWIVVRWTPTKKPGGPAQS* |
| Ga0068865_1008185441 | 3300006881 | Miscanthus Rhizosphere | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPG |
| Ga0079219_100909092 | 3300006954 | Agricultural Soil | MATILGLVAFVAYVVLIVGFAAAITWLVVRMTPPKTKSGDTAGS* |
| Ga0079219_118865871 | 3300006954 | Agricultural Soil | MANVLALLAFALYIVLIVGFAAGITWVVVRLTPPQKKPGGGPASN* |
| Ga0105245_106996922 | 3300009098 | Miscanthus Rhizosphere | MANVLGLLAFVVYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPPAQG* |
| Ga0099792_100718812 | 3300009143 | Vadose Zone Soil | VSSVLGLIGFVLYVASIIGVAAGVTWIVVKWTPAKKKPGGQTPS* |
| Ga0111538_124625261 | 3300009156 | Populus Rhizosphere | LLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGGPPSS* |
| Ga0105241_108207022 | 3300009174 | Corn Rhizosphere | VSNVLGLLAFVAYVALIVGFAAAITWLVVRLTPPQKKPGGPAGS* |
| Ga0126384_110206532 | 3300010046 | Tropical Forest Soil | MAAVLSLLAFVAYVLVIVGLAAGITWVVVRLTPPQKKPSGPSQS* |
| Ga0126382_123620542 | 3300010047 | Tropical Forest Soil | VSTVLSLLAFAAYVVAIVGLAAGITWVVVRLTPPQKKSGGSAPSSVQTANAI |
| Ga0126373_107600702 | 3300010048 | Tropical Forest Soil | MSTFLSLLAFAAYVIVIVGLAASITWVVVRLTPPKSSGPKPSGPKQT* |
| Ga0126373_119443051 | 3300010048 | Tropical Forest Soil | MSTFLSLLAFAAYVIVIVGLAASITWVVVRLTPPKSSGPKQS* |
| Ga0126319_11511762 | 3300010147 | Soil | VSNVFGLIGFVLYVASIIGVAAGVTWIVVKWTPRQKKPKPGGQAPS* |
| Ga0099796_100852442 | 3300010159 | Vadose Zone Soil | VSSVLGLIGFVLYVASIIGVAAGVTWIVVKWTPAKKKPGGQAPS* |
| Ga0126378_129111682 | 3300010361 | Tropical Forest Soil | MSTFLSMLAFAAYVIVIVGLAASITWVVVRLTPPKSSGPKPSGPKQT* |
| Ga0126379_133238402 | 3300010366 | Tropical Forest Soil | MENVLGLLAFTLYVLVIVGMAAGVTWVVVRFTPSRRKTDAAAKN* |
| Ga0126379_133663282 | 3300010366 | Tropical Forest Soil | YSRERMSNVLGLLAFALYVAVIVGTAAGVTWVVVRLTPSRKPKPSGPKQT* |
| Ga0126381_1001668492 | 3300010376 | Tropical Forest Soil | VSNVLGLLAFALYVAVIVGTAAGVTWIVVRLTPSKKPSGPAQS* |
| Ga0126381_1051340421 | 3300010376 | Tropical Forest Soil | TPWAPGYSREPMSTFLSLLAFAAYVIVIVGLAASITWVVVRLTPPKSSGPKQS* |
| Ga0137383_100879123 | 3300012199 | Vadose Zone Soil | MSSVLGLLGFVFYVAAIIGVAAGVTWIVVRYTPKKKPGGPAQS* |
| Ga0137382_100366295 | 3300012200 | Vadose Zone Soil | MANVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPP |
| Ga0137382_100848914 | 3300012200 | Vadose Zone Soil | AFVAYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPPSR* |
| Ga0150985_1117669491 | 3300012212 | Avena Fatua Rhizosphere | NVLGLLAFAAYVASIIGVAAGVTWIVVKWTPPQKKPGGQAGS* |
| Ga0150985_1228718491 | 3300012212 | Avena Fatua Rhizosphere | LGLLGFVAYVVLIVGFAAAITWLVVRLTPPKKPGGSAQS* |
| Ga0137386_109694302 | 3300012351 | Vadose Zone Soil | VASVLGLLCFVFYGAAIIVFAAGVTWIVVRYTPSKKPGGPAQS* |
| Ga0150984_1207637462 | 3300012469 | Avena Fatua Rhizosphere | VSNVLGLLAFAAFVASIIGVAAGVTWIVVKWTPPQKKPKPGGQAGS* |
| Ga0137398_105017471 | 3300012683 | Vadose Zone Soil | VSSVLGLIGFVLYVASIIGVAAGVTWIVVKWTPRQKKPKPGGQAPS* |
| Ga0126375_115001032 | 3300012948 | Tropical Forest Soil | MATVLGLLGFVLYVVLIVGFAALITWFVVRMSPPKKPGGPEPS* |
| Ga0164300_100605422 | 3300012951 | Soil | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRMPKPGAPPSS* |
| Ga0164298_110635581 | 3300012955 | Soil | MATVLGLLAFAAYVALIVGFAAAVTWLVVKWTPLQSKPRRSPQS* |
| Ga0164303_104157302 | 3300012957 | Soil | MANVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQKKPRPPAQG* |
| Ga0164299_104806071 | 3300012958 | Soil | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGAPSSS* |
| Ga0164301_107075532 | 3300012960 | Soil | MANVLGLLAFAAYVALIVGFAAAVTWLVVKWTPLQSKPRRSPQ |
| Ga0164302_103997842 | 3300012961 | Soil | FAAYVALIVGFAAAVTWLVVRLTPSQRKHKPGAPPRS* |
| Ga0134087_100673312 | 3300012977 | Grasslands Soil | MANVLGLLAFAAYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQAGS* |
| Ga0157370_117363321 | 3300013104 | Corn Rhizosphere | VSNILGLIGFVLYVASIIGVAAGVTWIVLKWTQPQKKPKPGSRAGG* |
| Ga0157369_116261131 | 3300013105 | Corn Rhizosphere | LLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGVPPGS* |
| Ga0157369_116661262 | 3300013105 | Corn Rhizosphere | VSNVLGLIGFVFYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQAGS* |
| Ga0157372_112127992 | 3300013307 | Corn Rhizosphere | AFVAYVALIVGFAAAITWLVVRLTPPQKKPGGPAGS* |
| Ga0134078_104600942 | 3300014157 | Grasslands Soil | EPMATVLGLLAFVAYVVLIVGFAAAITWLVVRLTPPKKKPGGPAST* |
| Ga0134078_105830811 | 3300014157 | Grasslands Soil | VLGLLAFAAYVASIIGVAAGVTWIVVKWTPPQKKPGGQAGS* |
| Ga0134079_106497702 | 3300014166 | Grasslands Soil | VSTVLSLLAFAAYVVAIVGFAAGITWFVVRLTPPQKKSGGSAPS* |
| Ga0182024_118668612 | 3300014501 | Permafrost | VSTILSLLGFVAYIIVIVGLAASLTWAVVRLTPPQKKPKPGGPAES* |
| Ga0134073_103496472 | 3300015356 | Grasslands Soil | VENVLGLLGFVAYVVLIVGFAAAITWLVVRLTPPKKKPGGPASS* |
| Ga0132258_105012542 | 3300015371 | Arabidopsis Rhizosphere | MSNVLGLLAFALYVAVIVGTAAGVTWVVVRLTPSRKPKPSGSAQS* |
| Ga0132258_121000742 | 3300015371 | Arabidopsis Rhizosphere | MATVLGLLGFAAYILLIVGLAAGVTWLVVRWTPPQKPGSSSQS* |
| Ga0132258_132877162 | 3300015371 | Arabidopsis Rhizosphere | MANVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQKKPRPPAPS* |
| Ga0182040_117610591 | 3300016387 | Soil | TVLSLLAFAAYVVAIVGLAAGITWVVVRLTPPQKKKSGDSAAS |
| Ga0163161_109868232 | 3300017792 | Switchgrass Rhizosphere | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPK |
| Ga0187809_101439542 | 3300017937 | Freshwater Sediment | MATVLSLLAFAAYVIVIVGLAAGITWVVVRLTPPQKKPSGPTQS |
| Ga0187809_104007772 | 3300017937 | Freshwater Sediment | MASVLALLAFALYIALIVGFAAGITWGVVRLTPPQKKSGGGPAPS |
| Ga0187785_106511452 | 3300017947 | Tropical Peatland | MANVLALLAFALYIVLIVGFAAGITWVVVRLTPPQKKPGGGPASS |
| Ga0066655_103363122 | 3300018431 | Grasslands Soil | VSNVLGLLAFAAYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQAGS |
| Ga0066667_102196932 | 3300018433 | Grasslands Soil | MANVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPPSS |
| Ga0066669_102438772 | 3300018482 | Grasslands Soil | VSNVLGLLAFAAYVASIIGVAAGVTWIVVKWTPPQKKPKPGGEAGS |
| Ga0173482_104662841 | 3300019361 | Soil | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGGPPSS |
| Ga0197907_108257801 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLGLLAFVAYVALIVGFAAAITWLVVRLTPPQKKPSGTPDG |
| Ga0206351_103204592 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVLGLLAFVAYVVLIVGFAAAITWLVVRMTPPKTKSGDTAGS |
| Ga0206354_100625522 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGVPPGS |
| Ga0206353_112035562 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGGPPSS |
| Ga0182009_104456592 | 3300021445 | Soil | MATVLGLLAFVAYVVLIVGFAAAITWLVVRMTPPQKKPGGPTQS |
| Ga0126371_104633842 | 3300021560 | Tropical Forest Soil | MATVLGLLAFVAYVVLIVGFAALITWFVVRLTPPQKKSGGSSPS |
| Ga0126371_106577972 | 3300021560 | Tropical Forest Soil | MATVLSLLAFALYILVIVGMAAGITWVVVKLTPPQKKQGGGPARS |
| Ga0126371_113766483 | 3300021560 | Tropical Forest Soil | MENVLGLLAFTLYVLVIVGMAAGVTWVVVRFTPSRRKTDAAAKN |
| Ga0224712_100048275 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVLGLLAFVAYVALIVGFAAAITWLVVRLTPPQKKPGGPAGS |
| Ga0224712_105885242 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGLIGFVLYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQTGS |
| Ga0247794_101888402 | 3300024055 | Soil | MATVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQKKPKPPGPAGS |
| Ga0247669_10111092 | 3300024182 | Soil | VSNVLGLIGFVFYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQAGS |
| Ga0247672_10093633 | 3300024187 | Soil | VSNVLGLIGFVFYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQTGS |
| Ga0247672_10784632 | 3300024187 | Soil | MATVLGLLGFAGYILLIVGLAAGVTWLVVRWTPPQKPGGSAPS |
| Ga0179591_11739001 | 3300024347 | Vadose Zone Soil | VSSILGLIGFVLYVASIIGVAAGVTWIVVKWTPAKKKPKPGGQAPS |
| Ga0207647_104800562 | 3300025904 | Corn Rhizosphere | MATVLGLLAFVAYVALIVGFAAAITWLVVRLTPPQKKPSGTPDG |
| Ga0207699_109411522 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKP |
| Ga0207684_104136022 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVLGLLGFVVYVALIVGFAALITWFVVRLTPPQKKSGGSTPS |
| Ga0207707_101108142 | 3300025912 | Corn Rhizosphere | MATVLGLLAFVAYVVLIVGFAAAITWLVVRMTPPKKPGGPAES |
| Ga0207663_101655602 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNVLGLIGFVLYVASIIGVAAGVTWIVVKWTPPQKKPKTGGQTGS |
| Ga0207660_105265082 | 3300025917 | Corn Rhizosphere | MATVLGLLAFVAYVVLIVGFAAAITWLVVRMTPPKKPGGPAQS |
| Ga0207662_108206832 | 3300025918 | Switchgrass Rhizosphere | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRK |
| Ga0207657_103203772 | 3300025919 | Corn Rhizosphere | MATVLGLLAFVAYVVLIVGFAAAITWLVVRMTPPKKPGGPAEN |
| Ga0207646_114182712 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVLGLLAFAAYVALIVGFAAAVTWLVVRWTPPQSKPRRSSQS |
| Ga0207687_104394722 | 3300025927 | Miscanthus Rhizosphere | MANVLGLLAFVVYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPPAQG |
| Ga0207664_100155382 | 3300025929 | Agricultural Soil | MAAVLALLAFALYIILIVGFAAGITWVVVRLTPPQKKSGGGPAPS |
| Ga0207664_102347862 | 3300025929 | Agricultural Soil | VSNVLGLIGFVLYVASIIGVAAGVTWIVVKWTAPQKKPKPGSPAGS |
| Ga0207664_108178801 | 3300025929 | Agricultural Soil | MATVLALLAFALYIVLIVGFAAGITWVVVRLTPPQKKPGGGPASS |
| Ga0207661_113917652 | 3300025944 | Corn Rhizosphere | VSNVLGLIGFVLYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQTGS |
| Ga0207702_117438952 | 3300026078 | Corn Rhizosphere | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGVPPG |
| Ga0209687_12362351 | 3300026322 | Soil | TVLGLLAFVAYVVLIVGFAAAITWLVVRLTPPKKKPGGPAST |
| Ga0209377_13425112 | 3300026334 | Soil | MSSVLGLLGFVFYVAAIIGVAAGVTWIVVRYTPKKKPGGPAQS |
| Ga0209810_13769142 | 3300027773 | Surface Soil | VSTLFGLLAFVAYVALIVGFAAAVTWVVVRWTPPQKKPGGTAGS |
| Ga0209177_101377032 | 3300027775 | Agricultural Soil | MATILGLVAFVAYVVLIVGFAAAITWLVVRMTPPKTKSGDTAGS |
| Ga0209811_102456712 | 3300027821 | Surface Soil | MANVLGLLAFAAYVALIVGFAAAVTWLVVRLTPSQRKPKPGAPPSS |
| Ga0209488_100612313 | 3300027903 | Vadose Zone Soil | VSSVLGLIGFVLYVASIIGVAAGVTWIVVKWTPAKKKPGGQAPS |
| Ga0307503_100034133 | 3300028802 | Soil | VSNVLGLIGFVFYVASIIGVAAGVTWIVVKWTPSRQKKPKPEGQAGS |
| Ga0307498_104390542 | 3300031170 | Soil | VSNVLGLIGFVFYVASIIGVAAGVTWIVVKWTPSKKKPNPGGQAGS |
| Ga0170820_170267882 | 3300031446 | Forest Soil | VSSVLGLLGFVLYVASIIGVAAGVTWIVVRYTPSKKPSGPPQS |
| Ga0318516_101321693 | 3300031543 | Soil | MSTILSLLAFVAYIIVIVGLAAGITWVVVRLTPPQKK |
| Ga0318534_100704623 | 3300031544 | Soil | MSTILSLLAFVAYIIVIVGLAAGITWVVVRLTPPQKKPKPSDSAKS |
| Ga0307475_115686342 | 3300031754 | Hardwood Forest Soil | VSSILGLLGFVLYVAAIIGVAAGVTWIVVRYTPSKKPGGPPAQS |
| Ga0318535_105256171 | 3300031764 | Soil | MANVLGLLGFVAYVVLIVGFAALITWFVVRLTPPQKKSGGSSPS |
| Ga0318565_102814292 | 3300031799 | Soil | MSTFLSLLAFAAYVIVIVGLAAGITWVVVRLTPPQKKPKPSDPAKG |
| Ga0318511_103693831 | 3300031845 | Soil | MSTILSLLAFVAYIIVIVGLAAGITWVVVRLTPPQKKPKPS |
| Ga0308175_10000709314 | 3300031938 | Soil | VSNVLGLLAFAAYVASIIGLAAGVTWIVVKWTPPQKKPKPGGQAGS |
| Ga0308175_1000665245 | 3300031938 | Soil | MANVLGLLAFVAYVVLIVGFAAAITWLVVRLTPPKKPGGSAQS |
| Ga0308175_1008127001 | 3300031938 | Soil | MANVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPPSG |
| Ga0308175_1015860662 | 3300031938 | Soil | MATVLGLLAFVAYVALIVGFAAAITWLVVRMTPPKKPGGPAQS |
| Ga0308175_1029104681 | 3300031938 | Soil | NVLGLIGFVLYVASIIGVAAGVTWIVVKWTPPQKKPKPGGQTGS |
| Ga0318558_106642332 | 3300032044 | Soil | MATVLSLLAFAAYVVAIVGLAAGITWVVVRLTPPQKKKSGDSAAS |
| Ga0318514_105675901 | 3300032066 | Soil | MANVLGLLGFVAYVVLIVGFAALITWFVVRLTPPQK |
| Ga0318518_104586862 | 3300032090 | Soil | MANVLGLLGFVAYVVLIVGFAALITWFVVRLTPPQKKSGGSSPT |
| Ga0307471_1024335961 | 3300032180 | Hardwood Forest Soil | NVLGLLAFVAYVALIVGFAAAVTWLVVRLTPPQRKPKPGGPPSS |
| Ga0335085_109302242 | 3300032770 | Soil | MANVLGLLAFAAYVVSIIGVAAGVTWIVVKWTPTKKKPSGQAPS |
| Ga0335079_104121742 | 3300032783 | Soil | VATILSLLAFAAYVLVIVGLAAGITWVVVRLTPPQKKPSSPSES |
| Ga0335069_103627212 | 3300032893 | Soil | MATILGLLAFVAYVAAIIGLAAGVTWIVVKVTPPQKKPKPTDPARS |
| Ga0335083_109956752 | 3300032954 | Soil | MANVLSLLAFAAYVIVIVGLAASITWVVVRLTPPQKKPKPNSPPQS |
| Ga0335083_111305532 | 3300032954 | Soil | VATVLSLLAFAAYVIVIVGLAASITWVVVRLTPPQKKPTAPPQS |
| Ga0335084_114294391 | 3300033004 | Soil | MANVLGLLAFAVYVASIIGVAAGVTWIVVKWTPTKKKPSGQAPS |
| Ga0310914_107963681 | 3300033289 | Soil | GYSRERMSTILSLLAFVAYIIVIVGLAAGITWVVVRLTPPQKKPKPSDSAKS |
| ⦗Top⦘ |