NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037319

Metagenome / Metatranscriptome Family F037319

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037319
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 45 residues
Representative Sequence MSNARLPVLEKFIGDLRTIWSAEADNQRRMEKAKPLLERLVK
Number of Associated Samples 147
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.81 %
% of genes near scaffold ends (potentially truncated) 97.62 %
% of genes from short scaffolds (< 2000 bps) 94.05 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.429 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.619 % of family members)
Environment Ontology (ENVO) Unclassified
(26.190 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.619 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.71%    β-sheet: 0.00%    Coil/Unstructured: 54.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF02668TauD 83.93
PF02738MoCoBD_1 5.95
PF03401TctC 1.19
PF09084NMT1 0.60
PF02627CMD 0.60
PF01557FAA_hydrolase 0.60
PF01970TctA 0.60
PF13618Gluconate_2-dh3 0.60
PF00378ECH_1 0.60
PF15579Imm52 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 83.93
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.19
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.60
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.60
COG1784TctA family transporterGeneral function prediction only [R] 0.60
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.60
COG3333TctA family transporterGeneral function prediction only [R] 0.60
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.43 %
UnclassifiedrootN/A3.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_12069255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300004633|Ga0066395_10552998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300005167|Ga0066672_10538799All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300005175|Ga0066673_10349432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria863Open in IMG/M
3300005332|Ga0066388_105838535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300005332|Ga0066388_108708101Not Available504Open in IMG/M
3300005337|Ga0070682_101778097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria537Open in IMG/M
3300005471|Ga0070698_102171864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300005538|Ga0070731_10885293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300005539|Ga0068853_101845952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria586Open in IMG/M
3300005542|Ga0070732_10340110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria903Open in IMG/M
3300005543|Ga0070672_100344120Not Available1270Open in IMG/M
3300005554|Ga0066661_10723024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300005602|Ga0070762_11044153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300005618|Ga0068864_102565186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300005712|Ga0070764_10441750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria774Open in IMG/M
3300005718|Ga0068866_11146864All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria559Open in IMG/M
3300005764|Ga0066903_100129148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3547Open in IMG/M
3300005764|Ga0066903_104565208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria738Open in IMG/M
3300005764|Ga0066903_104894615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria711Open in IMG/M
3300006028|Ga0070717_11183548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria696Open in IMG/M
3300006046|Ga0066652_101300372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria686Open in IMG/M
3300006176|Ga0070765_100219863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1731Open in IMG/M
3300006176|Ga0070765_101668477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales599Open in IMG/M
3300006844|Ga0075428_102088013All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006847|Ga0075431_101835194All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300009094|Ga0111539_12589316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300009100|Ga0075418_10828303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria999Open in IMG/M
3300009143|Ga0099792_10196850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1143Open in IMG/M
3300009523|Ga0116221_1065980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1647Open in IMG/M
3300009683|Ga0116224_10247829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria850Open in IMG/M
3300009792|Ga0126374_11247407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300010043|Ga0126380_12061305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300010046|Ga0126384_11241854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300010343|Ga0074044_10908038All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010358|Ga0126370_11324248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300010358|Ga0126370_11932342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300010361|Ga0126378_12763831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300010366|Ga0126379_11121725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria892Open in IMG/M
3300010366|Ga0126379_13618049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria518Open in IMG/M
3300010376|Ga0126381_103466776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria620Open in IMG/M
3300010868|Ga0124844_1014634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2087Open in IMG/M
3300011271|Ga0137393_11553848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300012089|Ga0153924_1084833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria632Open in IMG/M
3300012199|Ga0137383_10766403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300012208|Ga0137376_11123045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria672Open in IMG/M
3300012209|Ga0137379_10095663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2857Open in IMG/M
3300012351|Ga0137386_10099477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2055Open in IMG/M
3300012363|Ga0137390_10685747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria987Open in IMG/M
3300012683|Ga0137398_10420120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria912Open in IMG/M
3300012927|Ga0137416_10197351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1613Open in IMG/M
3300012957|Ga0164303_10719822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria675Open in IMG/M
3300012961|Ga0164302_11143972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria618Open in IMG/M
3300013306|Ga0163162_12233432All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium628Open in IMG/M
3300014311|Ga0075322_1204267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300014489|Ga0182018_10165391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1256Open in IMG/M
3300014501|Ga0182024_10249647All Organisms → cellular organisms → Bacteria → Proteobacteria2380Open in IMG/M
3300014657|Ga0181522_10089768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1766Open in IMG/M
3300014657|Ga0181522_10134559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1440Open in IMG/M
3300015371|Ga0132258_12408949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1318Open in IMG/M
3300015373|Ga0132257_104224588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300016270|Ga0182036_10230351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1376Open in IMG/M
3300016319|Ga0182033_11671979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300016341|Ga0182035_12181422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300016387|Ga0182040_11713386All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria537Open in IMG/M
3300016445|Ga0182038_10385333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1171Open in IMG/M
3300016702|Ga0181511_1037061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1728Open in IMG/M
3300017959|Ga0187779_10353713Not Available950Open in IMG/M
3300017970|Ga0187783_11364173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales511Open in IMG/M
3300017975|Ga0187782_10741477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales758Open in IMG/M
3300018066|Ga0184617_1020626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1461Open in IMG/M
3300018076|Ga0184609_10108397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1254Open in IMG/M
3300018079|Ga0184627_10588715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300018090|Ga0187770_11176269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300018465|Ga0190269_10553174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria763Open in IMG/M
3300020000|Ga0193692_1041728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1054Open in IMG/M
3300020020|Ga0193738_1125989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria710Open in IMG/M
3300021078|Ga0210381_10011465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2161Open in IMG/M
3300021090|Ga0210377_10757881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300021168|Ga0210406_10869068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria681Open in IMG/M
3300021178|Ga0210408_10562631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria904Open in IMG/M
3300021178|Ga0210408_10872278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria702Open in IMG/M
3300021344|Ga0193719_10139504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1049Open in IMG/M
3300021432|Ga0210384_10760978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria865Open in IMG/M
3300021432|Ga0210384_11668096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300021474|Ga0210390_10850026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M
3300021479|Ga0210410_10518450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1064Open in IMG/M
3300021559|Ga0210409_10615759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria955Open in IMG/M
3300022557|Ga0212123_10366156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria979Open in IMG/M
3300024288|Ga0179589_10302525All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium720Open in IMG/M
3300025920|Ga0207649_11643185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300025927|Ga0207687_11867708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300025938|Ga0207704_10654330All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria866Open in IMG/M
3300025939|Ga0207665_10908388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria699Open in IMG/M
3300025940|Ga0207691_10435479Not Available1116Open in IMG/M
3300026325|Ga0209152_10428204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300026538|Ga0209056_10037038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4525Open in IMG/M
3300026555|Ga0179593_1009005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2437Open in IMG/M
3300027181|Ga0208997_1028952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria800Open in IMG/M
3300027537|Ga0209419_1103363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300027562|Ga0209735_1024928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1237Open in IMG/M
3300027629|Ga0209422_1138700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria550Open in IMG/M
3300027645|Ga0209117_1108076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria754Open in IMG/M
3300027886|Ga0209486_11091171All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300027889|Ga0209380_10460134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria744Open in IMG/M
3300027889|Ga0209380_10814052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300027898|Ga0209067_10505424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300028380|Ga0268265_12033846Not Available582Open in IMG/M
3300028720|Ga0307317_10235187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria619Open in IMG/M
3300028787|Ga0307323_10213948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria695Open in IMG/M
3300028802|Ga0307503_10392482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300028819|Ga0307296_10309828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria861Open in IMG/M
3300028876|Ga0307286_10319498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300028906|Ga0308309_11011985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria720Open in IMG/M
3300028906|Ga0308309_11248252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria640Open in IMG/M
3300030294|Ga0311349_12101106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300031538|Ga0310888_10807050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria581Open in IMG/M
3300031544|Ga0318534_10129110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1454Open in IMG/M
3300031547|Ga0310887_10959174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria544Open in IMG/M
3300031561|Ga0318528_10348382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria795Open in IMG/M
3300031573|Ga0310915_10755282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300031681|Ga0318572_10272265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria998Open in IMG/M
3300031682|Ga0318560_10196305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1077Open in IMG/M
3300031708|Ga0310686_102363087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300031708|Ga0310686_111833064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300031719|Ga0306917_10864429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria708Open in IMG/M
3300031736|Ga0318501_10290349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria871Open in IMG/M
3300031771|Ga0318546_11268635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria517Open in IMG/M
3300031781|Ga0318547_10935653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria541Open in IMG/M
3300031793|Ga0318548_10666537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300031798|Ga0318523_10265633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria857Open in IMG/M
3300031798|Ga0318523_10597267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300031805|Ga0318497_10729758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300031821|Ga0318567_10382958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria796Open in IMG/M
3300031879|Ga0306919_11420143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300031890|Ga0306925_10369497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1539Open in IMG/M
3300031890|Ga0306925_12095510All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria530Open in IMG/M
3300031894|Ga0318522_10270209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria644Open in IMG/M
3300031940|Ga0310901_10418657All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria587Open in IMG/M
3300031941|Ga0310912_10401146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1067Open in IMG/M
3300031941|Ga0310912_11000795All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium641Open in IMG/M
3300031944|Ga0310884_10451501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria747Open in IMG/M
3300031945|Ga0310913_10668064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria735Open in IMG/M
3300031946|Ga0310910_10886793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria700Open in IMG/M
3300031946|Ga0310910_10967434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria666Open in IMG/M
3300031981|Ga0318531_10237825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria822Open in IMG/M
3300032001|Ga0306922_10787280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria995Open in IMG/M
3300032001|Ga0306922_12003593All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria564Open in IMG/M
3300032035|Ga0310911_10141488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1349Open in IMG/M
3300032041|Ga0318549_10414877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria606Open in IMG/M
3300032059|Ga0318533_10146953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1666Open in IMG/M
3300032060|Ga0318505_10582974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria526Open in IMG/M
3300032063|Ga0318504_10108787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1248Open in IMG/M
3300032065|Ga0318513_10550743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
3300032066|Ga0318514_10168574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1140Open in IMG/M
3300032066|Ga0318514_10402526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria727Open in IMG/M
3300032067|Ga0318524_10219545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria974Open in IMG/M
3300032075|Ga0310890_10770552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria759Open in IMG/M
3300032076|Ga0306924_11989332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria599Open in IMG/M
3300032091|Ga0318577_10259035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria833Open in IMG/M
3300032180|Ga0307471_101445106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria847Open in IMG/M
3300032180|Ga0307471_104108502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300032261|Ga0306920_102459021All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300032261|Ga0306920_103984048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M
3300032783|Ga0335079_11780194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria600Open in IMG/M
3300032892|Ga0335081_10299205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp.2133Open in IMG/M
3300032895|Ga0335074_10118435Not Available3437Open in IMG/M
3300032895|Ga0335074_10723276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria952Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.38%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.38%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.38%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.79%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.19%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.19%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.19%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.19%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.19%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.19%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.19%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.19%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.60%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.60%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.60%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.60%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.60%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.60%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.60%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.60%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.60%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.60%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.60%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012089Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1206925513300000890SoilMATPRLPVLDKFIVDLRTIWAEDSENERRMGKAKPLLEQLLKDATLKA
Ga0066395_1055299813300004633Tropical Forest SoilMSSARLPVLEKFIADLRTIWSAEADNHQRMERAKPLLEQLVKDAGLKA
Ga0066672_1053879913300005167SoilMSNARLPVLEQFIGDLRAVWAAEADERRRMEKARPLLERLVRDPALRVHSAAW
Ga0066673_1034943213300005175SoilMTNPRLPVLDRFIGDLRAIWAADSDNERRMAKAKPLLEKLVKDATLKAHST
Ga0066388_10583853513300005332Tropical Forest SoilMSSARLPVLEKFIGDLRTIWSADADNQRRMEKAKPRLEQLV
Ga0066388_10870810123300005332Tropical Forest SoilMPPKSWVPDMSSARLPVLEKFINELRVIWSTNADRQSRMEKAKPVLECFVMEPTLK
Ga0070682_10177809713300005337Corn RhizosphereMTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAKPLLEQLVKDETLKA
Ga0070698_10217186413300005471Corn, Switchgrass And Miscanthus RhizosphereMSDARLPILEKFIDELRAVWAAETDDQRRMEKAKPLLERLVRD
Ga0070731_1088529313300005538Surface SoilMPNQRLPVLDKFIADLRAIWAAESDDEHRMKKAKPLLEKLVM
Ga0068853_10184595213300005539Corn RhizosphereMTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAKPLLEQLVKDETLKAH
Ga0070732_1034011023300005542Surface SoilMSNPNLAAQRLPVFEKFIGDLRAVWAAEADDQRRMEKAKPL
Ga0070672_10034412023300005543Miscanthus RhizosphereMTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAMPLLEQLVKDETLKAHSTE
Ga0066661_1072302413300005554SoilMSSARLPVLEKFIKELRTIWAAESDTRRRMERAKPLLEEFVKD
Ga0070762_1104415313300005602SoilMSNIAAQRLPVFEKFIGDLRAVWAAEADDRRRMERAKPLLE
Ga0068864_10256518613300005618Switchgrass RhizosphereMTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAKPLLEQLVK
Ga0070764_1044175023300005712SoilMSNLAAQRLPVFDKFIGDLRAVWAAETDDQRRMQKAKPLLERLVMDPALKSHSASW
Ga0068866_1114686423300005718Miscanthus RhizosphereMSVRLPVLDKFIADLRAIWAANADNQSRMEKAKPAL
Ga0066903_10012914853300005764Tropical Forest SoilMPARLPVMEKFIGDLRAVWAAASENQIRMERAKPLLE
Ga0066903_10456520823300005764Tropical Forest SoilMTTAGLPVFENFVADLRAIWAAENDNQRRMERAKPLLERLVMD
Ga0066903_10489461523300005764Tropical Forest SoilMSITRLPVLEKFIADLRTIWSAEADNRRRMERAKPLLEQLVK
Ga0070717_1118354823300006028Corn, Switchgrass And Miscanthus RhizosphereVTNPNLAAQRLPVFEKFISDLRAVWAAESDDQRRMEKAKPLLERLVL
Ga0066652_10130037213300006046SoilMSSARPPILEKFIGDLRTIWAAEAHEQRRMEKAKPLLERLVSDGGLKAHSAAWPS
Ga0070765_10021986313300006176SoilMTNPRLPVFDTFIGDLRAIWAAEADDQRRMEKAKPLLERLVL
Ga0070765_10166847713300006176SoilMSNPNLAARRLPVFETFIDNLRAVWAAEADDRRRMEKAKPLLERLVLD
Ga0075428_10208801313300006844Populus RhizosphereMSSARLPVLEKFIHELRKVWSTNADNQSRMEKAKPLLENFV
Ga0075431_10183519413300006847Populus RhizosphereMSSPRLPVLEKFIHELRKVWSTNADNQSRMERAKPLLEKFVLEPTLKAHS
Ga0111539_1258931613300009094Populus RhizosphereVQNQRLRAFARFIGELRAVWAAERDDEARMNRAKPLLER
Ga0075418_1082830313300009100Populus RhizosphereMSGPRLPVLEKFIGELRGIWATEAGDRRRMEAAKPLMERLVMEPALKAAATEWPS
Ga0099792_1019685013300009143Vadose Zone SoilMPNPRLPVLDKFIGDLRAVWAAEADNQRRMEKAKPLLEQLVKDPALKANSAGSPST
Ga0116221_106598013300009523Peatlands SoilMPNARLPVFDKFIGDLRAVWSTEPDDAQRMEKAKPLVEAFVKDPSLKSHSA
Ga0116224_1024782923300009683Peatlands SoilVKETAMSNLAAQRLPVFEKFIGDLRAVWAAEADDQRRMEKAKPLMERLVLDDTLKAHSAHWP
Ga0126374_1124740723300009792Tropical Forest SoilMSSARLPILEQFIGDLRAVWAAEADEARRMEKAKPLLERLVADSGLKAHS
Ga0126380_1206130523300010043Tropical Forest SoilMSSARLPILDKFIGDLRTIWSADADNQRRMEKAKPRLEQLVKD
Ga0126384_1124185423300010046Tropical Forest SoilMSSARLPVLDKFIGDLRTIWSAEADNQPRMEKAKPLLEQLVKDDGLKAHSA
Ga0074044_1090803823300010343Bog Forest SoilMANLRLPVFDTFIADLRAIWAAETDDRRRMERAKPLLENLVLEPTL*
Ga0126370_1132424813300010358Tropical Forest SoilMTSARLPVLERFIADLRTVWAAQSDNGRRMEEAKPLLERLLR
Ga0126370_1193234213300010358Tropical Forest SoilMSNARLPVLEKFIADLRTIWSAEADNQRRMEKAKP
Ga0126378_1276383123300010361Tropical Forest SoilMSSARRLPVFEQFIGELRAVWTAEPDARRRMERAKPLLERLVNDAA
Ga0126379_1112172513300010366Tropical Forest SoilMASARLPILETFIADLRAIWAAEADDQRRMERAKPLLERLV
Ga0126379_1361804913300010366Tropical Forest SoilMSNARLPVLEKFIGDLRTIWSAEADNQRRMEKAKPLLERLVK
Ga0126381_10346677613300010376Tropical Forest SoilMSNARLPVFEKFISDLRAIWAAHSDNQRRMETAKPLLEQFVKNESLRAH
Ga0124844_101463433300010868Tropical Forest SoilMSSARLPVLDKFIADLQAIWSGEADNRRRMEKAKPRLEQLVKDEGLRAHSATWP
Ga0137393_1155384823300011271Vadose Zone SoilMPSARLPVLEQFIGDLRALWAAEPDNRRRMEQAKPLLEQLLNDPGLRAH
Ga0153924_108483323300012089Attine Ant Fungus GardensMTNPRSPIFDKFIADLRAIWAAEADDQRRMEKAKPLVERLVMD
Ga0137383_1076640323300012199Vadose Zone SoilMSSARLPVLEKFINELRTIWAAESGTRRRMERAKPLLEEFVKDP
Ga0137376_1112304523300012208Vadose Zone SoilMTNPRLPVLDRFIGELRAIWAADSENERRMAKAKPLLEKLVKDE
Ga0137379_1009566343300012209Vadose Zone SoilMSSARLPVLEKFIADLRTIWSTEADNQRRMERAKPLLEQLVKDE
Ga0137386_1009947733300012351Vadose Zone SoilMSSARLPVLEKFIADLRTIWSTEADNQRRMERAKPLLEQLVKDAG
Ga0137390_1068574723300012363Vadose Zone SoilMATPRLPVLDKFIGDLRAIWAGEFENGRRMEKTKPLLEQLVKDATLKAHSVGWPS
Ga0137398_1042012023300012683Vadose Zone SoilMPNPRLPVLDKFIGNLRAVWAAESDNQRRMERAKPLLEQLVRDP
Ga0137416_1019735143300012927Vadose Zone SoilMGSAGLLVFEEFVAQLRAIWEAESDNQGRMEKAKPLLERLVKDPGL
Ga0164303_1071982223300012957SoilMANARLPVFDKFIDDLRAIWAAEAENRLRMEKAKPLVEQLMKDPSLKA
Ga0164302_1114397213300012961SoilMANARLPVFDKFIDDLRAIWAAEAENRLRMEKAKPLVEQLM
Ga0163162_1223343213300013306Switchgrass RhizosphereMPNARLPVFDRFIDDLRSIWAADPENGRRMEKAKPLLEQLVKDAT
Ga0075322_120426723300014311Natural And Restored WetlandsMPKSIPVLDAFIARLREVWAEEFDDRRRMERAKPLLEHLVAD
Ga0182018_1016539113300014489PalsaVKETIMSNLAAQRLPVFDKFIGDLRAIWSAEADDQRRMEKAKPLLEQLV
Ga0182024_1024964743300014501PermafrostVKETIMSNLAAQRLPIFEKFIGDLRAVWAAEADDQRRMEKAKPLVERLVLDETLK
Ga0181522_1008976833300014657BogVKETIMSNLAAPNLTARRLPVFEKFIGDLRAVWAAEADDRRRMERAKPLLERLVLDQ
Ga0181522_1013455913300014657BogMPNPRLPVFDKFIADLRAIWAAEADDGRRMAKAKPFLERLV
Ga0132258_1240894933300015371Arabidopsis RhizosphereMSSARLPVLDKFIGELRTIWSAEADNQRRMEKAKPLLEQLVKDGGLKAHSASWPS
Ga0132257_10422458823300015373Arabidopsis RhizosphereMSNARLPVFEKFIADLRAIWAAQPDDQRRMEAAKPLLERLVLDPALKAHSASWPS
Ga0182036_1023035113300016270SoilMSSARLPILEKFIADLRTIWSAEADNQRRMEKAKPLLEQLVKDEGLK
Ga0182033_1167197923300016319SoilMSRERLPVFEKFIGDLRAVWSTDPDNGRRMNKAKPLLEALVMDNGLKA
Ga0182035_1218142223300016341SoilMSSIRLPVLEKFVADLRTIWSAEADNQRRMEKAKPLLEHLV
Ga0182040_1171338613300016387SoilMSNARLPVFEKFISDLQGIWAAHSDNQRRMETAKP
Ga0182038_1038533313300016445SoilMTTAGLPVFENFVADLRAIWVAENDNQRRMERAKPL
Ga0181511_103706113300016702PeatlandMSNLAAQRLPVFEKFIGDLRAVWAAEADDQRRMERAQPLLERLV
Ga0187779_1035371313300017959Tropical PeatlandMTTLPVFETFIRDLRAIWAATADNAARMEQARPLME
Ga0187783_1136417323300017970Tropical PeatlandMSQPRLPVFDEFIADLRVVWAAEVDDGRRMARAKPLLERLVKDETLKAHSAD
Ga0187782_1074147723300017975Tropical PeatlandMARPRLPVFDRFIGELRAIWAAEADDGRRMEQAKPLLEALVMDPA
Ga0184617_102062613300018066Groundwater SedimentMASPRLPVLDRFIGDLRAIWAAESDNRHRMERAKPVLERL
Ga0184609_1010839733300018076Groundwater SedimentMANPRLPVLDKFIVDLRTIWAGDSENERRMAKAKPLLEQLVKDATLKAHSAGW
Ga0184627_1058871523300018079Groundwater SedimentMSRLSVLEKFIGDLRAIWAAETDNQRRMERAKPLLETFVVE
Ga0187770_1117626913300018090Tropical PeatlandMPNSRLLVFDKFIADLRAIWSSDADDGRRMAKAKPLLERLVMDPVFKACSVD
Ga0190269_1055317413300018465SoilMSARLPALETFIADLRAIWSANAVNKDRMEKAKPRL
Ga0193692_104172813300020000SoilMANPRLPVLDKFIVELRTIWAEDSENERRMAKAKPLLEQLVKDATLK
Ga0193738_112598923300020020SoilMAERLPAFESFIRELRAVWAAEADDRARMERAKPLLERLV
Ga0210381_1001146513300021078Groundwater SedimentMATPRLPVLDKFIVDLRTIWAEDSENERRMGKAKPLLEQLLKDATLKAHSAGWPS
Ga0210377_1075788123300021090Groundwater SedimentMTKKRLPALEMFIGELRAVWAAEAEDRARMERAKPLLEWLVMDVRLKA
Ga0210406_1086906823300021168SoilMASAGLPVFEQFIAQLRAIWEADGDNQRRMEKAKPLLEALVRDPDLKAHSA
Ga0210408_1056263113300021178SoilMSSARLPVLEKFIADLRTIWSAEADNQRRMERAKPLLEQLVKDAGLKGH
Ga0210408_1087227823300021178SoilMSNGRLPVFQRFIADLRAIWAAEGEDARRMERAKPLLESFVMDEDLK
Ga0193719_1013950423300021344SoilMANPRLPVLDKFIVDLRTIWAGDSENERRMAKAKPLLEQLVKDATL
Ga0210384_1076097813300021432SoilMSAGLPVFEQFVADLRAIWEAESDNQSRMQNAKPLLE
Ga0210384_1166809613300021432SoilMASAGLPVFEKFVAQLRAIWEAESDNQGRMEKAKPLLEQLVRDP
Ga0210390_1085002613300021474SoilMSNLAAQRLPVFEKFIGDLRAVWAAENDDQRRMEGAKPLLERLVMD
Ga0210410_1051845013300021479SoilMASAGLPVFEKFVAQLRAIWEAESDNQGRMERARPLL
Ga0210409_1061575913300021559SoilMSNLAAQRLPVFEKFIGDLRAIWAAEADDQRRMEKAKLLLE
Ga0212123_1036615623300022557Iron-Sulfur Acid SpringMSNLAAQRLPVFEKFIGDLRAVWAAENDDRRRMERAKPLLERLVLDETLKSHSASWP
Ga0179589_1030252513300024288Vadose Zone SoilMSNARLPVFDRFVNDLRGIWAAEAENQHRMERAKPLLERLVKDDGLKAHS
Ga0207649_1164318513300025920Corn RhizosphereMTNPRLPVLDRFIGDLRAIWAADSENEHRMVMAKPLLEQLVKDETLKAHST
Ga0207687_1186770813300025927Miscanthus RhizosphereMTNPRLPVLDRFIGELRAIWATDSDNEHRMAKAKPLLEKLVTDATLKAH
Ga0207704_1065433013300025938Miscanthus RhizosphereMSVRLPVLDKFIADLRAIWAANTDNQSRMEKAKPALEKFVMDPAL
Ga0207665_1090838813300025939Corn, Switchgrass And Miscanthus RhizosphereMSSARLPVLEKFIGDLRTVWAAQSDNGRRMEQAKPLLERLLRDPDLKAHSAQWPST
Ga0207691_1043547923300025940Miscanthus RhizosphereMTNPRLPVLNRFIGDLRAIWAADSENERRMAKAKP
Ga0209152_1042820413300026325SoilMSRLPVLEQFIRDLRSIWATQSDSQRRMERAKPFLEELLKD
Ga0209056_1003703813300026538SoilMSSARLPVLEKFIADLRTIWSTEADNQRRMERAKPLLEQLVKDAGLKAHSASWPST
Ga0179593_100900543300026555Vadose Zone SoilVKETTMSNLAAQRLPVFEKFIGDLRAVWAAEAHDQRRMERANPSWNGW
Ga0208997_102895223300027181Forest SoilMPNPRLPVLDKFIGDLRAVWTAEADNQRRMEKAKPLLEQFVKDPALKANSADWP
Ga0209419_110336323300027537Forest SoilMSNLAAQRLPVFEKFIGDLRAVWATETDDQRRMEKAKPLVERLVLDE
Ga0209735_102492813300027562Forest SoilMNNPNLAAQRLPVFDKFIGDLRTVWAAEADDRRRMEKAKPFLERLVLDDTLKT
Ga0209422_113870013300027629Forest SoilMSNLAAQRLPVFEKFIGDLRAVWAAESDDQRRMEK
Ga0209117_110807613300027645Forest SoilMSIPSIAARRLPVFDKFIGDLRAVWAAEADDQGRMERAK
Ga0209486_1109117113300027886Agricultural SoilMSSAQRLPELNAFIAELRAIWAANGENKDRMEQAKPVLERFVR
Ga0209380_1046013423300027889SoilMSSPNLAARRLPVFEKFIGDLRAVWAAEPNDQCRMERAKPLLERLVLDQTLKAHSA
Ga0209380_1081405213300027889SoilMASAGLLIFETFITQLRVIWEADGDNQRRMEKAKPLLEALVK
Ga0209067_1050542413300027898WatershedsMPNARLPVFEKFIGDLRAVWSDETDDARRMERARPLV
Ga0268265_1203384613300028380Switchgrass RhizosphereTFMPTARLPVFQAFIDDLRAVWAGQPDDRRRMQRAKPLLER
Ga0307317_1023518723300028720SoilMPNPRLPVLDKFIGDLRAVWAAEADNQRRMEKAKPLLEQLVKDPALK
Ga0307323_1021394813300028787SoilMATPRLPVLDKFIVDLRTIWAEDSENERRMGKAKPLLEQLLKDATL
Ga0307503_1039248223300028802SoilMVNARLPVFEKFINDLRAVWGAETDRRRRMERAKPLVEQLVRDPSLKAHS
Ga0307296_1030982813300028819SoilMPNPRLPVLDKFIGDLRAVWTAEADNQRRMEKAKPLLEQFVKNPALKASSAD
Ga0307286_1031949823300028876SoilMANPRLPVLDKFIVDLRTIWAGDSENERRMAKAKPLLEQLVKD
Ga0308309_1101198513300028906SoilMSNPRLPVFDRFIADLRAIWAAEIEDRRRMERAGPLLQKLMMD
Ga0308309_1124825213300028906SoilMASAGLPVFEDFVAQLRAIWQAEGDNQRRMEKARPLLQQLVKD
Ga0311349_1210110613300030294FenMVTPRMPVLDKFIGDLRAIWAADSENQRRMEKAKPLLEKLVKDE
Ga0310888_1080705013300031538SoilMASPRLPVLDRFIGDLRAIWTAESDNQHRMERAKPLLERLVMDPTLKA
Ga0318534_1012911013300031544SoilMSSARLPVLEKFIADLRTIWSAEADNRRRMEKARPLFEQLVKDAGLKAH
Ga0310887_1095917423300031547SoilMSVRLPVLDKFIADLRAIWAANADNQSRMEKAKPALEKFV
Ga0318528_1034838223300031561SoilMSRERLPVFEKFIGDLRAVWSTDPDNGRRMNKAKPLLEALVM
Ga0310915_1075528213300031573SoilMSSARLPVLEKFIADLRTVWSAEADSRRRMERAKPLLEQLVKDAGLKAHSA
Ga0318572_1027226513300031681SoilMTTAGLPVFENFVADLRAIWVAENDNQRRMERAKPLLERLVMDQDLK
Ga0318560_1019630523300031682SoilMSSTRLPVLEKFIADLRTIWSAEADNHRRMERAKPLLEQLVKDAGLKAHSASWPS
Ga0310686_10236308723300031708SoilMSNPNLAAHRLPVFDEFIGALRAIWAAETDDQRRMENAKPLLERL
Ga0310686_11183306423300031708SoilMSNPRLPIFDKFVADLRAIWAAEAEDQRRMEKAKPLLERL
Ga0306917_1086442913300031719SoilMPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVKDPDLKAHSAQGKQDAQAV
Ga0318501_1029034913300031736SoilMGRLPVIEKFIADLRAIWASETDDRRRMEEAKPLLERLLADPGLK
Ga0318546_1126863523300031771SoilMSSARLPVLEKFIADLRTIWSAEADNHRRMERAKPLLEQLVK
Ga0318547_1093565323300031781SoilMPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPL
Ga0318548_1066653723300031793SoilMPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVK
Ga0318523_1026563323300031798SoilMTGARLPVLDSFIADLRAVWAAEPDDRRRMERAKP
Ga0318523_1059726723300031798SoilMSNARLPVLEKFIGDLRTIWSAEADNQRRMEKAKPLLEHLVKD
Ga0318497_1072975823300031805SoilMSSARLPVLEKFIADLRTVWSAEADSRRRMERAKPLLEQLVKDAGLKAHSASWP
Ga0318567_1038295823300031821SoilMANPNLPAQRLPVFDSFIADLRVIWAAEADDRRRMEKAKPRLERLVRNDA
Ga0306919_1142014323300031879SoilMSQLPVLEAFIRELRAVWAAEPDNGRRMERAKPLLERLLREPALKAHA
Ga0306925_1036949733300031890SoilMTTAGLPVFENFVADLRAIWAAENDNQRRMERAKPLLERLVMDQG
Ga0306925_1209551023300031890SoilMLPVFEKFVGDLRAIWAADSDNQRRMERAKPLLEQLVKDETL
Ga0318522_1027020913300031894SoilMSSARLPILEKFIDDLRAAWAADADEARRMENAKPLLERLV
Ga0310901_1041865723300031940SoilMSVRLPVLDKFIADLRAIWAANADNQSRMEKAKPLLERFVMEPALKAHSADWP
Ga0310912_1040114623300031941SoilMTTAGLPVFENFVADLRAIWAAENDNQRRMERAKPLLERLV
Ga0310912_1100079513300031941SoilMLPGFEKFIGDLRAIWAADSDNQRRMERTKPLLEQL
Ga0310884_1045150113300031944SoilMTKLLPAFESFVHELRAIWAAERDDRTRMKHAKPLLE
Ga0310913_1066806423300031945SoilMSSTRLPVLEKFIGDLRTIWSAEADNQRRMEKARPLPEH
Ga0310910_1088679323300031946SoilMPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVKDP
Ga0310910_1096743423300031946SoilMSRLPVIEQFIADLRAIWASETDNEGRMTRAKSLLERLLNNPDLKAHSATWPST
Ga0318531_1023782523300031981SoilMTTAGLPVFENFVADLRAIWAAENDNQRRMERAKP
Ga0306922_1078728023300032001SoilMANPNLAAQRLPVFDSFIADLRAIWAAEADDRRRM
Ga0306922_1200359313300032001SoilMLPGFEKFIGDLRAIWAADSDNQRRMERAKPLLEQLVKDESLRVHSAR
Ga0310911_1014148813300032035SoilMTTAGLPVFENFVADLRAIWVAENDNQRRMERAKPLLERLVMDQDLKAHS
Ga0318549_1041487723300032041SoilMSSTRLPILEKFIADLRTIWGAEADNQRRMEKAKPLL
Ga0318533_1014695333300032059SoilMPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVKDPDLKG
Ga0318505_1058297413300032060SoilMASVGLPVFENFIADLRRIWAAERDNKRRMERAKPLLEQLVMDSGLKAHSA
Ga0318504_1010878713300032063SoilMTRARLPVLDSFIADLRAVWAAEPDDRRRMERAKPLLEKLLADP
Ga0318513_1055074323300032065SoilMTGARLPVLDSFIADLRAVWAAEPDDRRRMERAKPLLEKLLAD
Ga0318514_1016857423300032066SoilMSSARLPVLEKFIADLRTIWSAEADNRRRMEKARPLFEQLVK
Ga0318514_1040252613300032066SoilMSSTRLPVLEKFIGDLRTIWSAEADNQRRMEKARPL
Ga0318524_1021954513300032067SoilMSSARLPVLEKFIADLRTIWSAEADNRRRMEKARPLFEQLVKDAGLKAHSASWPST
Ga0310890_1077055213300032075SoilMASPRLPVLDRFIGDLRAIWTAESDNQHRMERAKPLLE
Ga0306924_1198933223300032076SoilMSRERLPVFEKFIGDLRAVWSTDPDNGRRMNKAKPLLEALVMDNGLKAHSAQ
Ga0318577_1025903523300032091SoilMPHARLPVFEKFIGDLRAVWSAETDDARRMDKARPLVEAFVKDPDLK
Ga0307471_10144510613300032180Hardwood Forest SoilMANRLAAFERFIGDLRAVWAEARDDQQRIERAKPLLERFVMDP
Ga0307471_10410850213300032180Hardwood Forest SoilMSNLAAQLLPVFEKFIGDLSAVWAAEAEDRRRMEKSKPLLERLV
Ga0306920_10245902113300032261SoilARLPILEKFIADLRTIWSADTDNQRRMEKAKPLLE
Ga0306920_10398404813300032261SoilMTTAGLPVFENFVADLRAIWAAENDNQRRMERAKPLLE
Ga0335079_1178019413300032783SoilMANPRLPVFDAFIGDLRAIWAAEADDRRRMEKAKPLLERLV
Ga0335081_1029920513300032892SoilMTIPAFDRFLADLRALWAAESDMRRRMERAKPLLERLV
Ga0335074_1011843543300032895SoilMPHSRLPIFDQFIADLRAIWAAESDDGGRMHKAKPLLERLVRD
Ga0335074_1072327613300032895SoilMTNPRLPVFDKFITDLRAVWAAESDDGRRMAKAKPLLEK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.