| Basic Information | |
|---|---|
| Family ID | F037246 |
| Family Type | Metagenome |
| Number of Sequences | 168 |
| Average Sequence Length | 47 residues |
| Representative Sequence | EDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLKELKPDQ |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.62 % |
| % of genes from short scaffolds (< 2000 bps) | 94.64 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (8.929 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.405 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF01894 | UPF0047 | 38.10 |
| PF08241 | Methyltransf_11 | 19.05 |
| PF02632 | BioY | 10.12 |
| PF04402 | SIMPL | 4.76 |
| PF03030 | H_PPase | 2.98 |
| PF14229 | DUF4332 | 0.60 |
| PF02781 | G6PD_C | 0.60 |
| PF08669 | GCV_T_C | 0.60 |
| PF04879 | Molybdop_Fe4S4 | 0.60 |
| PF12146 | Hydrolase_4 | 0.60 |
| PF07719 | TPR_2 | 0.60 |
| PF05685 | Uma2 | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 38.10 |
| COG1268 | Biotin transporter BioY | Coenzyme transport and metabolism [H] | 10.12 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 4.76 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 4.76 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 4.76 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 2.98 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.60 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.26 % |
| Unclassified | root | N/A | 7.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16539710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1116 | Open in IMG/M |
| 2124908032|Perma_A_C_ConsensusfromContig60131 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104562319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104640497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300000559|F14TC_102653115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 635 | Open in IMG/M |
| 3300000787|JGI11643J11755_11558716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 938 | Open in IMG/M |
| 3300000789|JGI1027J11758_12800626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300000890|JGI11643J12802_12232606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2249 | Open in IMG/M |
| 3300000955|JGI1027J12803_102253494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300001139|JGI10220J13317_10406753 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300003319|soilL2_10114460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300003319|soilL2_10124665 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300003321|soilH1_10007287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1434 | Open in IMG/M |
| 3300003321|soilH1_10116908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1390 | Open in IMG/M |
| 3300003322|rootL2_10161719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1436 | Open in IMG/M |
| 3300005093|Ga0062594_103024655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005295|Ga0065707_10791868 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005333|Ga0070677_10692428 | Not Available | 573 | Open in IMG/M |
| 3300005337|Ga0070682_101789372 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005339|Ga0070660_100971164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 717 | Open in IMG/M |
| 3300005340|Ga0070689_101339145 | Not Available | 646 | Open in IMG/M |
| 3300005345|Ga0070692_11201809 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005353|Ga0070669_101439886 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005406|Ga0070703_10148029 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005459|Ga0068867_101618211 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005467|Ga0070706_102065132 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005468|Ga0070707_100200920 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300005539|Ga0068853_101480867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300005545|Ga0070695_100880827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300005545|Ga0070695_101740053 | Not Available | 522 | Open in IMG/M |
| 3300005549|Ga0070704_102314485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 500 | Open in IMG/M |
| 3300005577|Ga0068857_100287001 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300005577|Ga0068857_100512700 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300005577|Ga0068857_100906058 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005616|Ga0068852_100472278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1245 | Open in IMG/M |
| 3300005617|Ga0068859_100145193 | All Organisms → cellular organisms → Bacteria | 2447 | Open in IMG/M |
| 3300005617|Ga0068859_100939065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300005617|Ga0068859_101893536 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005617|Ga0068859_102419581 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005617|Ga0068859_102955478 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005618|Ga0068864_102644251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 508 | Open in IMG/M |
| 3300005719|Ga0068861_100002429 | All Organisms → cellular organisms → Bacteria | 12146 | Open in IMG/M |
| 3300005719|Ga0068861_100432447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300005719|Ga0068861_100553525 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005840|Ga0068870_10118522 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300005841|Ga0068863_100288825 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300005841|Ga0068863_102090283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300005843|Ga0068860_101041761 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006031|Ga0066651_10730032 | Not Available | 533 | Open in IMG/M |
| 3300006049|Ga0075417_10633436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 546 | Open in IMG/M |
| 3300006058|Ga0075432_10234957 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300006358|Ga0068871_100102557 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300006755|Ga0079222_10165185 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300006894|Ga0079215_10096866 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300006904|Ga0075424_100685077 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300006918|Ga0079216_10607700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300006969|Ga0075419_10332234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1030 | Open in IMG/M |
| 3300006969|Ga0075419_11139303 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300007004|Ga0079218_11037605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300009011|Ga0105251_10310442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300009011|Ga0105251_10420293 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009012|Ga0066710_102257260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300009098|Ga0105245_13214004 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009100|Ga0075418_11038054 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300009101|Ga0105247_10887958 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009147|Ga0114129_13274073 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009162|Ga0075423_10265005 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300009171|Ga0105101_10124251 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300009176|Ga0105242_13289914 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009177|Ga0105248_10137662 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
| 3300009177|Ga0105248_11244275 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300009553|Ga0105249_10038427 | All Organisms → cellular organisms → Bacteria | 4343 | Open in IMG/M |
| 3300009792|Ga0126374_11097214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 631 | Open in IMG/M |
| 3300010041|Ga0126312_10545687 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300010042|Ga0126314_10457291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300010044|Ga0126310_11529190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300010047|Ga0126382_12416619 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010166|Ga0126306_11729448 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010358|Ga0126370_10209667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1479 | Open in IMG/M |
| 3300010361|Ga0126378_12240606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300010373|Ga0134128_11090860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300010373|Ga0134128_12700015 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010397|Ga0134124_10981124 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010397|Ga0134124_12572798 | Not Available | 551 | Open in IMG/M |
| 3300010399|Ga0134127_11026437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300010399|Ga0134127_13404825 | Not Available | 521 | Open in IMG/M |
| 3300010400|Ga0134122_10507028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1093 | Open in IMG/M |
| 3300010400|Ga0134122_10541250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300010400|Ga0134122_10794150 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300010401|Ga0134121_10068147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2940 | Open in IMG/M |
| 3300010401|Ga0134121_12098852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300010403|Ga0134123_10835738 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300010403|Ga0134123_11370617 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010403|Ga0134123_12660162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 568 | Open in IMG/M |
| 3300011119|Ga0105246_10748398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300011269|Ga0137392_10276743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1385 | Open in IMG/M |
| 3300012184|Ga0136610_1224299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300012200|Ga0137382_11000215 | Not Available | 600 | Open in IMG/M |
| 3300012208|Ga0137376_10275754 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300012212|Ga0150985_115560060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300012350|Ga0137372_10521734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 881 | Open in IMG/M |
| 3300012361|Ga0137360_11143501 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012582|Ga0137358_10185686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1418 | Open in IMG/M |
| 3300012681|Ga0136613_10638472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 571 | Open in IMG/M |
| 3300012922|Ga0137394_10734680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 830 | Open in IMG/M |
| 3300012929|Ga0137404_10373488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1253 | Open in IMG/M |
| 3300012948|Ga0126375_11137635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300012955|Ga0164298_10828361 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012960|Ga0164301_10524644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 859 | Open in IMG/M |
| 3300013100|Ga0157373_10107791 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
| 3300013100|Ga0157373_11218193 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300013102|Ga0157371_11043274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 625 | Open in IMG/M |
| 3300013297|Ga0157378_10431796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
| 3300013306|Ga0163162_10848621 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300013306|Ga0163162_11581287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 748 | Open in IMG/M |
| 3300013307|Ga0157372_11979497 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300014320|Ga0075342_1200133 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300014325|Ga0163163_11451584 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300014325|Ga0163163_12158594 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300014326|Ga0157380_11548378 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300014497|Ga0182008_10226441 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300014745|Ga0157377_11439267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 545 | Open in IMG/M |
| 3300015053|Ga0137405_1371413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300015245|Ga0137409_11332662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300015371|Ga0132258_13494128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1077 | Open in IMG/M |
| 3300015372|Ga0132256_102944301 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300015374|Ga0132255_106356033 | Not Available | 500 | Open in IMG/M |
| 3300018052|Ga0184638_1217117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 669 | Open in IMG/M |
| 3300018054|Ga0184621_10097730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1036 | Open in IMG/M |
| 3300018054|Ga0184621_10236054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 654 | Open in IMG/M |
| 3300018469|Ga0190270_11640087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300018482|Ga0066669_10605595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300019377|Ga0190264_11582680 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300021445|Ga0182009_10329809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300021445|Ga0182009_10588284 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025322|Ga0209641_10153282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1749 | Open in IMG/M |
| 3300025900|Ga0207710_10496874 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300025904|Ga0207647_10396851 | Not Available | 777 | Open in IMG/M |
| 3300025908|Ga0207643_10031093 | All Organisms → cellular organisms → Bacteria | 2975 | Open in IMG/M |
| 3300025910|Ga0207684_11606612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300025912|Ga0207707_10215548 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300025914|Ga0207671_10617654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300025917|Ga0207660_11069620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 658 | Open in IMG/M |
| 3300025919|Ga0207657_10648095 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300025925|Ga0207650_10075088 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
| 3300025942|Ga0207689_10667874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300025960|Ga0207651_11542501 | Not Available | 598 | Open in IMG/M |
| 3300026071|Ga0208537_1014568 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300026075|Ga0207708_10669015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300026088|Ga0207641_10683500 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300026095|Ga0207676_11804392 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300026116|Ga0207674_11344848 | Not Available | 684 | Open in IMG/M |
| 3300026142|Ga0207698_12497818 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027266|Ga0209215_1008648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1219 | Open in IMG/M |
| 3300027880|Ga0209481_10746660 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300027909|Ga0209382_12128513 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300028379|Ga0268266_11164501 | Not Available | 746 | Open in IMG/M |
| 3300028381|Ga0268264_10849270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 914 | Open in IMG/M |
| 3300031456|Ga0307513_10943610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 571 | Open in IMG/M |
| 3300031731|Ga0307405_10807316 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300031740|Ga0307468_101338560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 654 | Open in IMG/M |
| 3300031740|Ga0307468_102004851 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031824|Ga0307413_10359200 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300031908|Ga0310900_11245376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 620 | Open in IMG/M |
| 3300032002|Ga0307416_103594658 | Not Available | 519 | Open in IMG/M |
| 3300032174|Ga0307470_10607853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300032421|Ga0310812_10052487 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300033407|Ga0214472_11551555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 565 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.98% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.38% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.19% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.19% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.60% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.60% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026071 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02975700 | 2088090014 | Soil | SDLIAMMAQVLDEDTTKALTQTPTWTAYLDSRRSMEKTRTDVERFAEVLKELKPE |
| Perma_A_C_00158560 | 2124908032 | Soil | DEDTTKALTQTPVWTAYLDSRRRMESTRKDVEKFAGVMKRLGGDDQSPGP |
| INPhiseqgaiiFebDRAFT_1045623192 | 3300000364 | Soil | TQTPVWTAYLDSRRDLDRTRINVEQFAEVLKNLGEE* |
| INPhiseqgaiiFebDRAFT_1046404971 | 3300000364 | Soil | TTKALTQTPTWTAYLDSRRTMEKTREDVERFAEILKQLKPDE* |
| F14TC_1026531152 | 3300000559 | Soil | DTTKALTQTPTWTAYLDSRRSMERTREDIERFAEILNELKPEQTLNGPKDI* |
| JGI11643J11755_115587161 | 3300000787 | Soil | XVLDEDXTKAXTXTPTWTAYLDSRRSLEKTKADVEKFADALKELKPDQ* |
| JGI1027J11758_128006262 | 3300000789 | Soil | IAMMAQVLDEDTTKALTQTPTWTAYLDSRRSMEKTRTDVERFAEVLKELKPE* |
| JGI11643J12802_122326065 | 3300000890 | Soil | TQTPTWTAYLDSRRSLEKTKADVEKFADALKELKPDQ* |
| JGI1027J12803_1022534942 | 3300000955 | Soil | AIMAQVLDDDTTRALTHTPTWTAYLDSRRSMEKTREDIEKFAEVLKQLKPQEGKDEG* |
| JGI10220J13317_104067533 | 3300001139 | Soil | LTQTPTWTAYLDSRRSMERTRNDIEKFAEILNELRPDSDAPDA* |
| soilL2_101144604 | 3300003319 | Sugarcane Root And Bulk Soil | ALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLKELKPDQ* |
| soilL2_101246651 | 3300003319 | Sugarcane Root And Bulk Soil | LTQTPTWTAYLDSRRSMEKTRGDIEKFAEILNQLKPDDASEPS* |
| soilH1_100072871 | 3300003321 | Sugarcane Root And Bulk Soil | DEDTTKALTQTPTWTAYLDSRRTLEKTKADVEKFAGVLKEMKPD* |
| soilH1_101169081 | 3300003321 | Sugarcane Root And Bulk Soil | AQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLKELKPDQ* |
| rootL2_101617191 | 3300003322 | Sugarcane Root And Bulk Soil | AQVLDEDTTKALTQTPTWTAYLDSRRTLEKTKADVEKFAGVLKEMKPD* |
| Ga0062594_1030246551 | 3300005093 | Soil | DLIAMMAQVLDEDTTKALTQTPTWTAYLDSRRSMEKTRSDIEQFAEVLKQLKPE* |
| Ga0065707_107918682 | 3300005295 | Switchgrass Rhizosphere | RVVSDLVAMMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTRADVEKFAEILKELQPED* |
| Ga0070677_106924281 | 3300005333 | Miscanthus Rhizosphere | MAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLKELKPDQ* |
| Ga0070682_1017893722 | 3300005337 | Corn Rhizosphere | LMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKNDVEKFAEILKELDADETDS* |
| Ga0070660_1009711642 | 3300005339 | Corn Rhizosphere | SDLVAVMAQVLDEDTTKALTQTPTWSAYLDSRRSLEKTRRDVETFAEILNKL* |
| Ga0070689_1013391451 | 3300005340 | Switchgrass Rhizosphere | IAMMAQVLDEDTTKALTQTPTWTAYLDSRRSMEKTKADIEKFAEILKQLNPE* |
| Ga0070692_112018092 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AMMAQVLDEDTTKALTQTPTWAAYLDSRRTLEKTKADVEKFAEILKGLDEG* |
| Ga0070669_1014398862 | 3300005353 | Switchgrass Rhizosphere | MAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKADVEKFAEILKELDADERG* |
| Ga0070703_101480291 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | AMMAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEILNELAAEERE* |
| Ga0068867_1016182111 | 3300005459 | Miscanthus Rhizosphere | LIAMMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTRADVERFAEILKELDADERG* |
| Ga0070706_1020651321 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEDTTKALTRTPTWTAYLDSRRALEKTRVDIETFAEILKGLRPDEQRGDHTD* |
| Ga0070707_1002009204 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEDTTKALTQTPTWTAYLDSRRALEKTRADVEKFAEILKELAADDTDS* |
| Ga0068853_1014808671 | 3300005539 | Corn Rhizosphere | AMMAQVLDEDTTKALTQTPTWTAYLDSRRSMEKTRSDIEQFAEVLKQLKPE* |
| Ga0070695_1008808272 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | HTRVVSDLIAMMAQVLDEDTTKALTQTPTWTAYLDSRRSMEKTRSDIEQFAEVLKQLKPE |
| Ga0070695_1017400532 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ALMAQTLDEDTTKALTQTPVWTAYLDSRRSMDRTRENVERFAEILKQLGG* |
| Ga0070704_1023144852 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVLDEDTTKAITQTPTWTAYLDSRRALERTKADVEKFSEEMKKLE* |
| Ga0068857_1002870014 | 3300005577 | Corn Rhizosphere | QTPTWTAYLDSRRSLEKTKADVEKFATILKELAADETDS* |
| Ga0068857_1005127003 | 3300005577 | Corn Rhizosphere | DLIAMMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTRADVERFAGILTNLATDDTDNTDKKI* |
| Ga0068857_1009060583 | 3300005577 | Corn Rhizosphere | TKAVTQTPTWTAYLDSRRALEKTKSDVEKFAEILRELGPEEVSSQD* |
| Ga0068852_1004722783 | 3300005616 | Corn Rhizosphere | KALTQTPVWTAYLDSRRSLERTRTDVEKFAEIMRQLSED* |
| Ga0068859_1001451931 | 3300005617 | Switchgrass Rhizosphere | LMAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLRALKPD* |
| Ga0068859_1009390651 | 3300005617 | Switchgrass Rhizosphere | TQTPTWTAYLDSRRALEKTRADVERFAEVLKELDADERG* |
| Ga0068859_1018935363 | 3300005617 | Switchgrass Rhizosphere | TQTPTWTAYLDSRRALEKTRNDVERFAEILKELTADETDR* |
| Ga0068859_1024195812 | 3300005617 | Switchgrass Rhizosphere | VLDEDTVKALTQTPTWTAYLDSRRALEKTKNDVEKFAAILKELDADETDS* |
| Ga0068859_1029554782 | 3300005617 | Switchgrass Rhizosphere | VAMMAQVLDEDTTKALIQTPTWTAYLDSRRALEKTKADVEKFAEALKDLTADERG* |
| Ga0068864_1026442511 | 3300005618 | Switchgrass Rhizosphere | TQTPTWTAYLDSKRSMEKTKDDIAKFAEVLQELKPE* |
| Ga0068861_1000024291 | 3300005719 | Switchgrass Rhizosphere | MMAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEILTGLQDSQD* |
| Ga0068861_1004324471 | 3300005719 | Switchgrass Rhizosphere | EDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLKELKPDQ* |
| Ga0068861_1005535253 | 3300005719 | Switchgrass Rhizosphere | QTPTWTAYLDSRRALEKTRADVERFAEILKGLDAEEQA* |
| Ga0068870_101185224 | 3300005840 | Miscanthus Rhizosphere | MAQVLDEDTTKALTQTPTWAAYLDSRRTLEKTKADVEKFAEILKGLDEG* |
| Ga0068863_1002888254 | 3300005841 | Switchgrass Rhizosphere | LTQTPTWTAYLDSRRALEKTKNDVEKFAEILKELAADERG* |
| Ga0068863_1020902831 | 3300005841 | Switchgrass Rhizosphere | SDLIAMMAQVLDEDTTRALTLTPTWTAYLDSRRSMEKTRRDVEKFAEVLKQLKPQEGNDEG* |
| Ga0068860_1010417611 | 3300005843 | Switchgrass Rhizosphere | VLDEDTTKALTQTPTWTAYLDSRRALEKTRADVERFAEILKGLDAEEQA* |
| Ga0066651_107300321 | 3300006031 | Soil | RALTQTPVWTAYLDSRRSLERTRADVEKFAEAMRKIRE* |
| Ga0075417_106334362 | 3300006049 | Populus Rhizosphere | VSDLVAVMAQVLDEDTTKALTQTPTWRAYLDSRRALEKTKADVERFAEALNNLAADDAD* |
| Ga0075432_102349571 | 3300006058 | Populus Rhizosphere | MMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKNDVEKFVEVLKDLKPEEDS* |
| Ga0068871_1001025575 | 3300006358 | Miscanthus Rhizosphere | TQTPTWTAYLDSRRSMEKTRSDIEQFAEVLKQLKPE* |
| Ga0079222_101651854 | 3300006755 | Agricultural Soil | QVLDEDTTKALTQTPTWTAYLDSRRALEKTKADVERFAEVLENLTTDDTDH* |
| Ga0079215_100968663 | 3300006894 | Agricultural Soil | VLDEDTTKALTQTPTWTAYLDSRRALEKTKADVEKFAEILKELASDDTDNADQITGSS* |
| Ga0075424_1006850773 | 3300006904 | Populus Rhizosphere | MAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKRDIERFAEILDRLKPDDANGSS* |
| Ga0079216_106077001 | 3300006918 | Agricultural Soil | DEETPKALTQTPTWTAYLDSRRTLEKTKSDVEKFVEVLKDLKPDQ* |
| Ga0075419_103322341 | 3300006969 | Populus Rhizosphere | PTWTAYLDSRRSLEKTKADVEKFAEVLKELKPDQ* |
| Ga0075419_111393032 | 3300006969 | Populus Rhizosphere | LTQTPTWTAYLDSRRSLERTKADVEKFAEALKQLATDDTD* |
| Ga0079218_110376051 | 3300007004 | Agricultural Soil | TTKALTQTPTWTAYLDSRRSLEKTKADVEKFVEVLKDLKPDQ* |
| Ga0105251_103104421 | 3300009011 | Switchgrass Rhizosphere | VLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLNKLDPEHNG* |
| Ga0105251_104202932 | 3300009011 | Switchgrass Rhizosphere | LDEDTTKALTQTPTWTAYLDSRRALEKTREDVETFAEILKGLDGNEQS* |
| Ga0066710_1022572602 | 3300009012 | Grasslands Soil | MMDRTLDQDTTKPITQTTQSTEYLESRLALERTRADVETFAEIMKKLGED |
| Ga0105245_132140042 | 3300009098 | Miscanthus Rhizosphere | AQVLDEDTTKALTQTPTWTAYLDSRRALEKTRNDVERFAEILKELTADETDR* |
| Ga0075418_110380541 | 3300009100 | Populus Rhizosphere | QVLDEDTTKALTQTPTWTAYLDSRRALEKTKDDVERFAEILKRLAADERE* |
| Ga0105247_108879581 | 3300009101 | Switchgrass Rhizosphere | TTKALTQTPTWTAYLDSRRALEKTRADVETFAEILKGLDAEEQT* |
| Ga0114129_132740731 | 3300009147 | Populus Rhizosphere | KALTQTPVWMAYLDSRRSLEHTHADVEKFAEIMRKLSEE* |
| Ga0075423_102650051 | 3300009162 | Populus Rhizosphere | KALTQTPTWTAYLDSRRSLEKTKNDVEKFAAILKELAADETDS* |
| Ga0105101_101242511 | 3300009171 | Freshwater Sediment | EETTKALTQTPVWTAYLDSRRALERTKADVEKFAEVMKTLSED* |
| Ga0105242_132899142 | 3300009176 | Miscanthus Rhizosphere | WTAYLDSRRALEKTRADVETFAEVLKELATDDADN* |
| Ga0105248_101376621 | 3300009177 | Switchgrass Rhizosphere | VVGDLIAMMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKADVERFAAVLKELKPEE* |
| Ga0105248_112442753 | 3300009177 | Switchgrass Rhizosphere | AYLDSRRSMERTRSDIEKFTEVLNRLKPDEDGNTD* |
| Ga0105249_100384271 | 3300009553 | Switchgrass Rhizosphere | QTLDEDTTKALTQTPVWTAYLDSRRALERTRADVEEFAEVLKQLSED* |
| Ga0126374_110972142 | 3300009792 | Tropical Forest Soil | KALTQTPTWTAYLDSRRAMERTKGDVEKFAEVLKSMNPD* |
| Ga0126312_105456873 | 3300010041 | Serpentine Soil | MMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKADVEDFAEVLKQMED* |
| Ga0126314_104572913 | 3300010042 | Serpentine Soil | TQTPTWTAYLDSRRSLEKTKADVERFAEALKELDADHTDISGSS* |
| Ga0126310_115291902 | 3300010044 | Serpentine Soil | VVSDLIAVMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKADVEKFADILTGLQDSQD* |
| Ga0126382_124166191 | 3300010047 | Tropical Forest Soil | AMMAQVLNEDTTKALTQTPTWTAYLDSRRALEKTKADVEKFAEILKGFDSGEES* |
| Ga0126306_117294481 | 3300010166 | Serpentine Soil | TQTPTWTAYLDSRRALEKTKADVEKFAEILKELTTDDTD* |
| Ga0126370_102096673 | 3300010358 | Tropical Forest Soil | KALTQTPTWTAYLDSRRSLEKTKADIERFAQVLNELKPDEERNTD* |
| Ga0126378_122406061 | 3300010361 | Tropical Forest Soil | QTLDEDTTKGLTQTPHWQAYLDSRRALERTRTDIERFAETMKKLSED* |
| Ga0134128_110908602 | 3300010373 | Terrestrial Soil | TRVVSDLIAMMAQVLDEDTTKALTQTPTWTAYLDSRRSMEKTREDIEKFAEALNQLKSD* |
| Ga0134128_127000151 | 3300010373 | Terrestrial Soil | TQTPTWTAYLDSRRSLEKTKADVEKFAEVLNKLDPEHNG* |
| Ga0134124_109811241 | 3300010397 | Terrestrial Soil | QVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAAILKELAADETDS* |
| Ga0134124_125727982 | 3300010397 | Terrestrial Soil | DLIAMMAQVLDEDTTKALTQTPTWTAYLDSRRLMEKTREDIEKFADVLKKLKPGNDR* |
| Ga0134127_110264371 | 3300010399 | Terrestrial Soil | ALMAQTLDQDTTKALTQTPVWTAYLDSRRSLEQTRIDVEKFAEIMKNLSE* |
| Ga0134127_134048252 | 3300010399 | Terrestrial Soil | MAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLKEMKPDE* |
| Ga0134122_105070283 | 3300010400 | Terrestrial Soil | EDTTKALTLTPTWTAYLDSRRSLERTRADVEKFAEVMKKLSDD* |
| Ga0134122_105412503 | 3300010400 | Terrestrial Soil | MAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAGVLKDLKPDQ* |
| Ga0134122_107941501 | 3300010400 | Terrestrial Soil | SDLVAMMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKADVEKFAEALKDLTADERG* |
| Ga0134121_100681475 | 3300010401 | Terrestrial Soil | EHTGVVSDLVALMAQVLDEDTTKALTQTPTWTAYLDSRRSMEKTRSDIEQFAEVLKQLKPE* |
| Ga0134121_120988521 | 3300010401 | Terrestrial Soil | TTKALTQTPVWTAYLDSRRALERTRADIEKFAEVMKQLSED* |
| Ga0134123_108357383 | 3300010403 | Terrestrial Soil | VAMMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTRVDVETFAEVLQNLTADDTDG* |
| Ga0134123_113706173 | 3300010403 | Terrestrial Soil | LTQTPTWTAYLDSRRALEKTRADVETFAEILKELATDNTDN* |
| Ga0134123_126601621 | 3300010403 | Terrestrial Soil | DTTKAVTQTPTWTAYLDSRRALERTKADVEKFSEEIKKLE* |
| Ga0105246_107483981 | 3300011119 | Miscanthus Rhizosphere | TTKALTQTPVWTAYLDSRRGLERTRANVEKFAETMKALSDDEQQ* |
| Ga0137392_102767433 | 3300011269 | Vadose Zone Soil | MAQVLDQDTTKALTQTPTWTAYLDSRRSLERTHADVEKFAEILKQIDHD* |
| Ga0136610_12242991 | 3300012184 | Polar Desert Sand | QRALTQTPVWTAYLDSRRDLDRTRADVEKFAEVMKQLSEG* |
| Ga0137382_110002152 | 3300012200 | Vadose Zone Soil | DEDTTKALTQTPTWTAYLDSRRSLERTHADVERFAEILKQMDPD* |
| Ga0137376_102757545 | 3300012208 | Vadose Zone Soil | TQTPVWTAYLDSRRAMERTRAEVEKFAEVMKGLSED* |
| Ga0150985_1155600602 | 3300012212 | Avena Fatua Rhizosphere | EDTTRALTQTPMWTAYLDSRRALENTRTNIDKFVAAMQSLDQDKSAS* |
| Ga0137372_105217341 | 3300012350 | Vadose Zone Soil | HNRVVSDLIAVMAQVLDEDTIKALTQTPTWTAYLDSRRSLERTHADVEKFAEILKSMNPD |
| Ga0137360_111435011 | 3300012361 | Vadose Zone Soil | TTKALTQTPVWTAYLDSRRSMERTRADVEKFAEIMRDLSED* |
| Ga0137358_101856861 | 3300012582 | Vadose Zone Soil | VLDQDTTKALTQTPTWTAYLDSRRSLERTHADVEKFAEILKQMDPD* |
| Ga0136613_106384722 | 3300012681 | Polar Desert Sand | ALDEDTKHALTNTPVWTNYLDSRRALHAAQADMEKFSEAMKKFDEENI* |
| Ga0137394_107346802 | 3300012922 | Vadose Zone Soil | DLIAVMAQTLDEDTSKALTQTPVWTAYLDSRRSMEHTRKNVGKFAEILKGLGEEE* |
| Ga0137404_103734881 | 3300012929 | Vadose Zone Soil | RVVSDLIAVMAQVLDEDTTKALTQTPTWTAYLDSRRSLERTHADVERFAEILKQMDPD* |
| Ga0126375_111376351 | 3300012948 | Tropical Forest Soil | SDLVALMAQVLDEETTKAVTQTPTWTAYLDSRRALERTKADVEKFSEEMKKFE* |
| Ga0164298_108283611 | 3300012955 | Soil | DTTKALTQTPTWTAYLDSRRSLERTKRDIEKFAEILKQLRSDEPNESS* |
| Ga0164301_105246442 | 3300012960 | Soil | LTQTPTWTAYLDSRRSMERTREDIEKFAEVLNQLKPEE* |
| Ga0157373_101077914 | 3300013100 | Corn Rhizosphere | VSDLVAMMAQVLDEDTTKALTQTPTWAAYLDSRRTLEKTKADVEKFAEILKRLDES* |
| Ga0157373_112181932 | 3300013100 | Corn Rhizosphere | MAQVLDEDTTKALTQTPTWTAYLDSRRALEKTRADVETFAEILNGLDAEEQS* |
| Ga0157371_110432741 | 3300013102 | Corn Rhizosphere | TKAITQTPTWTAYLDSRRALERTKADVEKFSEEMKKLE* |
| Ga0157378_104317963 | 3300013297 | Miscanthus Rhizosphere | MMAQVLDEDTTKALTQTPTWTAYLDSRRSMERTREDIERFAEILKELKPEKS* |
| Ga0163162_108486213 | 3300013306 | Switchgrass Rhizosphere | LTQTPTWAAYLDSRRTLEKTKADVEKFAEILKGLDEG* |
| Ga0163162_115812871 | 3300013306 | Switchgrass Rhizosphere | ALTQTPTWSAYLDSRRSMEKTRRDVETFAEILKQLQPE* |
| Ga0157372_119794973 | 3300013307 | Corn Rhizosphere | DEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEILTGLQDSQD* |
| Ga0075342_12001332 | 3300014320 | Natural And Restored Wetlands | QTPTWTAYLDSRRALEKTKTDVEKFAEILKELKPDA* |
| Ga0163163_114515843 | 3300014325 | Switchgrass Rhizosphere | SDLVAMMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKADVERFAEALKNLATDDTDNTDQH* |
| Ga0163163_121585943 | 3300014325 | Switchgrass Rhizosphere | TAYLDSRRSLERTKEDVEKFAEILKELAADDADER* |
| Ga0157380_115483781 | 3300014326 | Switchgrass Rhizosphere | MAQVLDEDTTKALTQTPTWTAYLDSRRALEKTRADVETFAEILKGLDGEEES* |
| Ga0182008_102264411 | 3300014497 | Rhizosphere | MAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKTDVETFAEALKVLAADERG* |
| Ga0157377_114392671 | 3300014745 | Miscanthus Rhizosphere | ETTKAVTQTPTWTAYLDSRRALERTKTDVEKFSEEIKKLE* |
| Ga0137405_13714131 | 3300015053 | Vadose Zone Soil | MAQTLDEDTTKALTQTPVWTAYLDSRRSMDRTRENVEKFAAILKQLGG* |
| Ga0137409_113326621 | 3300015245 | Vadose Zone Soil | ALTLTPHWTAYLDSRRALERTRADVEKFADEMKRLNED* |
| Ga0132258_134941281 | 3300015371 | Arabidopsis Rhizosphere | MAQVLDEDTTRALTQTPTWTAYLDSRRSMEKTREDIEKFAEVLKQLEPQEGKDEG* |
| Ga0132256_1029443011 | 3300015372 | Arabidopsis Rhizosphere | LVAVMAQVLDEDTTKALIQTPTWTAYLDSRRALEKTKTDVEKFAEILTNLAADERE* |
| Ga0132255_1063560331 | 3300015374 | Arabidopsis Rhizosphere | DTTKALTQTPVWTAYLDSRRSLEQTHKDVEKFAEVLKQLSED* |
| Ga0184638_12171172 | 3300018052 | Groundwater Sediment | MAQTLDEDTTKALTQTPVWTAYLDSRRALERTRKDVDKFVEVMRRLSDD |
| Ga0184621_100977301 | 3300018054 | Groundwater Sediment | MAQTLDQDTTKALTQTPVWTAYLDSRRSLERTHADVEKFAEVMKTLSE |
| Ga0184621_102360541 | 3300018054 | Groundwater Sediment | MAQTLDQDTTKALTQTPVWTAYLDSRRSLERTHADVEKFAEIMKTLSE |
| Ga0190270_116400871 | 3300018469 | Soil | DTTKALTQTPVWTAYLDSRRALERTRAVVEKFAEIIKNLNDDDQ |
| Ga0066669_106055951 | 3300018482 | Grasslands Soil | MAQTMDEDTTRALTQTPVWTAYLDSRRSLEATQAKVEKFVEAMQQLDLNNSLT |
| Ga0190264_115826801 | 3300019377 | Soil | TTRALTQTPTWTAYLDSRRSMEKTKGDIEKFAEVLKELKPDT |
| Ga0182009_103298092 | 3300021445 | Soil | VLDEDTTKALTQTPTWTAYLDSRRLMEKTREDIEKFADVLKKLKPGNDR |
| Ga0182009_105882841 | 3300021445 | Soil | PTWTAYLDSRRAMEKTKGDIARFAEILNELKPDATEQS |
| Ga0209641_101532821 | 3300025322 | Soil | ETTKALTQTPVWAAYLDSRRSMERTRQDVERFASLMKTMNEERKPPD |
| Ga0207710_104968741 | 3300025900 | Switchgrass Rhizosphere | TTKALTQTPTWTAYLDSRRALEKTRADVETFAEILKGLDGEDES |
| Ga0207647_103968511 | 3300025904 | Corn Rhizosphere | MAQVLDDETTKALTQTPTWSAYLDSRRSLEKTRKDIEQFADDLKQLKPE |
| Ga0207643_100310931 | 3300025908 | Miscanthus Rhizosphere | LDEDTTKALTQTPTWTAYLDSRRALEKTKADVERFAEALKNLATDDTDNTDQH |
| Ga0207684_116066121 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DTTKALTQTPTWTAYLDSRRSLERTHADVEKFAEILKQMDPD |
| Ga0207707_102155483 | 3300025912 | Corn Rhizosphere | LTHTPTWTAYLDSRRALEQTKADVDKFAEILKELTADNTQ |
| Ga0207671_106176543 | 3300025914 | Corn Rhizosphere | AQVLDEDTTRALTQTPTWTAYLDSRRALEQTKADVDKFAEILKELTADNTQ |
| Ga0207660_110696201 | 3300025917 | Corn Rhizosphere | ALMAQVLDEDTTKAITLTPTWTAYLDSRRALERTKADVEKFSEEMKKLE |
| Ga0207657_106480953 | 3300025919 | Corn Rhizosphere | LTQTPTWTAYLDSRRALEKTRADVEKFAEALNNLATDDTDNTDKKI |
| Ga0207650_100750884 | 3300025925 | Switchgrass Rhizosphere | DTTKALTQTPTWAAYLDSRRTLEKTKADVEKFAEILKGLDEG |
| Ga0207689_106678743 | 3300025942 | Miscanthus Rhizosphere | ALTQTPTWTAYLDSRRSLEKTKADIEKFAGVLKEMKPDE |
| Ga0207651_115425011 | 3300025960 | Switchgrass Rhizosphere | KALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLKELKPDQ |
| Ga0208537_10145683 | 3300026071 | Natural And Restored Wetlands | EETTKALTQTPTWSAYLDSRRQLEKTKADVERFAEILKGLKPEE |
| Ga0207708_106690151 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RVVSDLVAMMAQVLDEDTTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEILNELAAEER |
| Ga0207641_106835003 | 3300026088 | Switchgrass Rhizosphere | LDEDTTKALTQTPTWTAYLDSRRALEKTRVDVETFAEILKGLDAEEQA |
| Ga0207676_118043922 | 3300026095 | Switchgrass Rhizosphere | AMMAQVLDEDTTKALTQTPTWTAYLDSRRALEKTKADVERFAEALKNLATDDTDNTDQH |
| Ga0207674_113448481 | 3300026116 | Corn Rhizosphere | TTKALTQTPTWTAYLDSRRSLEKTKADVEKFAEVLKEMKPDE |
| Ga0207698_124978182 | 3300026142 | Corn Rhizosphere | TKALTQTPTWIAYLDSRRSMEKTRSDIEKFAEILNQLKPDDTSESS |
| Ga0209215_10086481 | 3300027266 | Forest Soil | WTAYLDSRRSMEKTRGDIERFAEILNQLKSDDQDT |
| Ga0209481_107466601 | 3300027880 | Populus Rhizosphere | PTWAAYLDSRRTLEQTKADVEKFAEILKNLDADEKD |
| Ga0209382_121285131 | 3300027909 | Populus Rhizosphere | LDEDTTKALTQTPTWAAYLDSRRTLEQTKADVERFAEILKNLAADERG |
| Ga0268266_111645012 | 3300028379 | Switchgrass Rhizosphere | DETTKALTQTPTWSAYPDSRRSLEKTRKDIEQFADDLKQLKPE |
| Ga0268264_108492701 | 3300028381 | Switchgrass Rhizosphere | ALTQTPTWSAYLDSRRSLEKTRRDVETFAEILNKL |
| Ga0307513_109436101 | 3300031456 | Ectomycorrhiza | DEDTQRALTQTPVWTAYLDSRRDLDRTRANVEKFAEEMKKLGE |
| Ga0307405_108073161 | 3300031731 | Rhizosphere | VLDEDTTRALTQTPTWTAYLDSRRSMEKTRIDIEKFAEILKELKPDA |
| Ga0307468_1013385602 | 3300031740 | Hardwood Forest Soil | LDEDTTKALTQTPVWTAYLDSRRALERTRADVEKFTEIMKSLGDRRED |
| Ga0307468_1020048511 | 3300031740 | Hardwood Forest Soil | TPTWTAYLDSRRALEKTKADVEKFAEILKGLGNEEDS |
| Ga0307413_103592003 | 3300031824 | Rhizosphere | LTQTPTWTAYLDSRRSMEKTRIDIEKFAEILKELKPDA |
| Ga0310900_112453761 | 3300031908 | Soil | HTRVVSDLVALMAQVLDEDTTKAITQTPTWTAYLDSRRALERTKADVEKFSEEMKKLE |
| Ga0307416_1035946581 | 3300032002 | Rhizosphere | NTPHWKAYLDSRRTMEKTRGEVEQFAEIMKKLSGDEES |
| Ga0307470_106078531 | 3300032174 | Hardwood Forest Soil | TQTPTWTAYLDSRRSMEKTKADIEKFAEILKQLNPE |
| Ga0310812_100524871 | 3300032421 | Soil | LTQTPTWTAYLDSRRSLEQTKADVERFAEVLKELAADDTD |
| Ga0214472_115515552 | 3300033407 | Soil | QTLDEDTAKALTQTPVWTAYLDSRRSMERTQKDVEKFAEILKKLNQE |
| ⦗Top⦘ |