| Basic Information | |
|---|---|
| Family ID | F037245 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 40 residues |
| Representative Sequence | PLAFARKHGVDPARSILVGTSSAHRTLATTLGARYVAA |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.61 % |
| % of genes near scaffold ends (potentially truncated) | 95.24 % |
| % of genes from short scaffolds (< 2000 bps) | 91.07 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.214 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.691 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.024 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.30% β-sheet: 12.12% Coil/Unstructured: 57.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 9.52 |
| PF13602 | ADH_zinc_N_2 | 5.36 |
| PF04828 | GFA | 2.98 |
| PF01022 | HTH_5 | 2.98 |
| PF13302 | Acetyltransf_3 | 2.38 |
| PF12680 | SnoaL_2 | 1.79 |
| PF03741 | TerC | 1.79 |
| PF13396 | PLDc_N | 1.79 |
| PF00795 | CN_hydrolase | 1.79 |
| PF10604 | Polyketide_cyc2 | 1.19 |
| PF00701 | DHDPS | 1.19 |
| PF02148 | zf-UBP | 1.19 |
| PF00563 | EAL | 1.19 |
| PF04675 | DNA_ligase_A_N | 1.19 |
| PF00221 | Lyase_aromatic | 1.19 |
| PF01425 | Amidase | 1.19 |
| PF00903 | Glyoxalase | 1.19 |
| PF00067 | p450 | 1.19 |
| PF12833 | HTH_18 | 0.60 |
| PF05853 | BKACE | 0.60 |
| PF01810 | LysE | 0.60 |
| PF06262 | Zincin_1 | 0.60 |
| PF14525 | AraC_binding_2 | 0.60 |
| PF08240 | ADH_N | 0.60 |
| PF01510 | Amidase_2 | 0.60 |
| PF06737 | Transglycosylas | 0.60 |
| PF13649 | Methyltransf_25 | 0.60 |
| PF13424 | TPR_12 | 0.60 |
| PF13280 | WYL | 0.60 |
| PF04087 | DUF389 | 0.60 |
| PF00230 | MIP | 0.60 |
| PF13466 | STAS_2 | 0.60 |
| PF07885 | Ion_trans_2 | 0.60 |
| PF10027 | DUF2269 | 0.60 |
| PF12802 | MarR_2 | 0.60 |
| PF04075 | F420H2_quin_red | 0.60 |
| PF00892 | EamA | 0.60 |
| PF01243 | Putative_PNPOx | 0.60 |
| PF03729 | DUF308 | 0.60 |
| PF13177 | DNA_pol3_delta2 | 0.60 |
| PF07080 | DUF1348 | 0.60 |
| PF00248 | Aldo_ket_red | 0.60 |
| PF13528 | Glyco_trans_1_3 | 0.60 |
| PF00296 | Bac_luciferase | 0.60 |
| PF08002 | DUF1697 | 0.60 |
| PF01663 | Phosphodiest | 0.60 |
| PF00132 | Hexapep | 0.60 |
| PF00669 | Flagellin_N | 0.60 |
| PF03734 | YkuD | 0.60 |
| PF06983 | 3-dmu-9_3-mt | 0.60 |
| PF12847 | Methyltransf_18 | 0.60 |
| PF00582 | Usp | 0.60 |
| PF04101 | Glyco_tran_28_C | 0.60 |
| PF01896 | DNA_primase_S | 0.60 |
| PF00578 | AhpC-TSA | 0.60 |
| PF01938 | TRAM | 0.60 |
| PF01717 | Meth_synt_2 | 0.60 |
| PF00144 | Beta-lactamase | 0.60 |
| PF00480 | ROK | 0.60 |
| PF01872 | RibD_C | 0.60 |
| PF02597 | ThiS | 0.60 |
| PF07920 | DUF1684 | 0.60 |
| PF13732 | DUF4162 | 0.60 |
| PF00571 | CBS | 0.60 |
| PF00353 | HemolysinCabind | 0.60 |
| PF10057 | MpsC | 0.60 |
| PF03446 | NAD_binding_2 | 0.60 |
| PF03372 | Exo_endo_phos | 0.60 |
| PF13671 | AAA_33 | 0.60 |
| PF02190 | LON_substr_bdg | 0.60 |
| PF14342 | DUF4396 | 0.60 |
| PF00083 | Sugar_tr | 0.60 |
| PF03200 | Glyco_hydro_63 | 0.60 |
| PF00072 | Response_reg | 0.60 |
| PF02635 | DrsE | 0.60 |
| PF02909 | TetR_C_1 | 0.60 |
| PF08546 | ApbA_C | 0.60 |
| PF00282 | Pyridoxal_deC | 0.60 |
| PF00127 | Copper-bind | 0.60 |
| PF01041 | DegT_DnrJ_EryC1 | 0.60 |
| PF00440 | TetR_N | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 2.98 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 2.38 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 1.79 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.19 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 1.19 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.19 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.19 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.19 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 1.19 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.19 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.19 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.19 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.19 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.60 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.60 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.60 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.60 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.60 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.60 |
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 0.60 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.60 |
| COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.60 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.60 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.60 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.60 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.60 |
| COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.60 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.60 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.60 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.60 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.60 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.60 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.60 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.60 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.60 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.60 |
| COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 0.60 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.60 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.60 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.81 % |
| Unclassified | root | N/A | 26.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_11519273 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300000956|JGI10216J12902_107466738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 766 | Open in IMG/M |
| 3300000956|JGI10216J12902_117634601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 724 | Open in IMG/M |
| 3300001593|JGI12635J15846_10122983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1830 | Open in IMG/M |
| 3300001686|C688J18823_10032102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3596 | Open in IMG/M |
| 3300001686|C688J18823_10069101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2450 | Open in IMG/M |
| 3300001686|C688J18823_10191452 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300002124|C687J26631_10047350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1503 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101292145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Hiyo1 | 620 | Open in IMG/M |
| 3300003861|Ga0031654_10018085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2052 | Open in IMG/M |
| 3300004479|Ga0062595_102688380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300005093|Ga0062594_101545714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300005364|Ga0070673_100075728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2715 | Open in IMG/M |
| 3300005435|Ga0070714_101926219 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005456|Ga0070678_100951326 | Not Available | 787 | Open in IMG/M |
| 3300005458|Ga0070681_10941820 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005530|Ga0070679_100269780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1656 | Open in IMG/M |
| 3300005544|Ga0070686_100556626 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005544|Ga0070686_101964946 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005576|Ga0066708_10340071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 963 | Open in IMG/M |
| 3300005617|Ga0068859_100349380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1574 | Open in IMG/M |
| 3300005713|Ga0066905_101098991 | Not Available | 706 | Open in IMG/M |
| 3300005719|Ga0068861_101017646 | Not Available | 792 | Open in IMG/M |
| 3300005719|Ga0068861_102086383 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005764|Ga0066903_103155753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300005764|Ga0066903_103654471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
| 3300005921|Ga0070766_10113851 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300005937|Ga0081455_10062808 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
| 3300005981|Ga0081538_10081750 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300005994|Ga0066789_10397374 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006046|Ga0066652_100524257 | Not Available | 1105 | Open in IMG/M |
| 3300006058|Ga0075432_10577824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 511 | Open in IMG/M |
| 3300006358|Ga0068871_100216187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Calidithermus → Calidithermus chliarophilus | 1659 | Open in IMG/M |
| 3300006574|Ga0074056_10751961 | Not Available | 547 | Open in IMG/M |
| 3300006576|Ga0074047_11850858 | Not Available | 517 | Open in IMG/M |
| 3300006800|Ga0066660_10019772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3913 | Open in IMG/M |
| 3300006806|Ga0079220_11699953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 552 | Open in IMG/M |
| 3300006844|Ga0075428_101936825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 612 | Open in IMG/M |
| 3300006854|Ga0075425_101478046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300006871|Ga0075434_101665291 | Not Available | 646 | Open in IMG/M |
| 3300006904|Ga0075424_100039523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4907 | Open in IMG/M |
| 3300007004|Ga0079218_10767995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 919 | Open in IMG/M |
| 3300009093|Ga0105240_11680693 | Not Available | 663 | Open in IMG/M |
| 3300009094|Ga0111539_10463666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1475 | Open in IMG/M |
| 3300009094|Ga0111539_10615940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
| 3300009094|Ga0111539_12847144 | Not Available | 560 | Open in IMG/M |
| 3300009098|Ga0105245_12567120 | Not Available | 563 | Open in IMG/M |
| 3300009100|Ga0075418_10017729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7871 | Open in IMG/M |
| 3300009137|Ga0066709_101470965 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300009147|Ga0114129_10024837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 8495 | Open in IMG/M |
| 3300009147|Ga0114129_11300443 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009147|Ga0114129_12584889 | Not Available | 606 | Open in IMG/M |
| 3300009553|Ga0105249_10286562 | Not Available | 1647 | Open in IMG/M |
| 3300009816|Ga0105076_1113180 | Not Available | 534 | Open in IMG/M |
| 3300010039|Ga0126309_10842519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 602 | Open in IMG/M |
| 3300010041|Ga0126312_10549828 | Not Available | 828 | Open in IMG/M |
| 3300010044|Ga0126310_11495764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 554 | Open in IMG/M |
| 3300010337|Ga0134062_10414879 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300010358|Ga0126370_11030349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300010359|Ga0126376_11171905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 781 | Open in IMG/M |
| 3300010362|Ga0126377_11802601 | Not Available | 687 | Open in IMG/M |
| 3300010371|Ga0134125_10169551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2433 | Open in IMG/M |
| 3300010371|Ga0134125_11386127 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010371|Ga0134125_13072688 | Not Available | 506 | Open in IMG/M |
| 3300010373|Ga0134128_10932321 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300010373|Ga0134128_12282623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300011107|Ga0151490_1391923 | Not Available | 1862 | Open in IMG/M |
| 3300011107|Ga0151490_1701467 | Not Available | 511 | Open in IMG/M |
| 3300012201|Ga0137365_10545647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300012530|Ga0136635_10232819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300012684|Ga0136614_11168415 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012893|Ga0157284_10187226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300012943|Ga0164241_10226478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1337 | Open in IMG/M |
| 3300012951|Ga0164300_10986572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300012955|Ga0164298_10929005 | Not Available | 636 | Open in IMG/M |
| 3300012958|Ga0164299_10392671 | Not Available | 888 | Open in IMG/M |
| 3300012958|Ga0164299_10911544 | Not Available | 639 | Open in IMG/M |
| 3300013296|Ga0157374_12806583 | Not Available | 515 | Open in IMG/M |
| 3300013306|Ga0163162_11791278 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 702 | Open in IMG/M |
| 3300014325|Ga0163163_11549190 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300015200|Ga0173480_10920909 | Not Available | 569 | Open in IMG/M |
| 3300015371|Ga0132258_12484634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1296 | Open in IMG/M |
| 3300015371|Ga0132258_12635047 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300015371|Ga0132258_13211281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1127 | Open in IMG/M |
| 3300015372|Ga0132256_100581234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1234 | Open in IMG/M |
| 3300015372|Ga0132256_102338821 | Not Available | 637 | Open in IMG/M |
| 3300015374|Ga0132255_100982989 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300016294|Ga0182041_10613955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 957 | Open in IMG/M |
| 3300016341|Ga0182035_11586060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300016387|Ga0182040_10597408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
| 3300016445|Ga0182038_10565581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 978 | Open in IMG/M |
| 3300017966|Ga0187776_10241947 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300018034|Ga0187863_10247165 | Not Available | 991 | Open in IMG/M |
| 3300018056|Ga0184623_10082602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1480 | Open in IMG/M |
| 3300018062|Ga0187784_10424191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 1074 | Open in IMG/M |
| 3300018063|Ga0184637_10335567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 911 | Open in IMG/M |
| 3300018422|Ga0190265_10350549 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300018422|Ga0190265_11764586 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300018432|Ga0190275_13266322 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018433|Ga0066667_11015813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora coriariae | 716 | Open in IMG/M |
| 3300018465|Ga0190269_11023398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300018468|Ga0066662_12215004 | Not Available | 577 | Open in IMG/M |
| 3300018469|Ga0190270_10325731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1383 | Open in IMG/M |
| 3300018469|Ga0190270_11686798 | Not Available | 687 | Open in IMG/M |
| 3300018481|Ga0190271_12019324 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300019377|Ga0190264_10946954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 680 | Open in IMG/M |
| 3300021403|Ga0210397_10882719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300021405|Ga0210387_10371320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces carpinensis | 1266 | Open in IMG/M |
| 3300021420|Ga0210394_11468368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300021560|Ga0126371_12288975 | Not Available | 653 | Open in IMG/M |
| 3300021560|Ga0126371_13328068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300022309|Ga0224510_10674953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300023064|Ga0247801_1056276 | Not Available | 609 | Open in IMG/M |
| 3300023266|Ga0247789_1063002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 699 | Open in IMG/M |
| 3300025899|Ga0207642_10212633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
| 3300025899|Ga0207642_10950761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300025906|Ga0207699_10209989 | Not Available | 1323 | Open in IMG/M |
| 3300025915|Ga0207693_11455049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Trueperales → Trueperaceae → unclassified Trueperaceae → Trueperaceae bacterium | 507 | Open in IMG/M |
| 3300025918|Ga0207662_10334606 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300025921|Ga0207652_10507692 | Not Available | 1085 | Open in IMG/M |
| 3300025922|Ga0207646_11306537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300025928|Ga0207700_10272734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1452 | Open in IMG/M |
| 3300025929|Ga0207664_11889563 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300025938|Ga0207704_10426377 | Not Available | 1053 | Open in IMG/M |
| 3300025998|Ga0208651_1010773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300026095|Ga0207676_11152956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 767 | Open in IMG/M |
| 3300026326|Ga0209801_1238925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300027505|Ga0209218_1107295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Trueperales → Trueperaceae → unclassified Trueperaceae → Trueperaceae bacterium | 585 | Open in IMG/M |
| 3300027821|Ga0209811_10350091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300027907|Ga0207428_10388683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 1023 | Open in IMG/M |
| 3300027908|Ga0209006_11164886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300028589|Ga0247818_10563276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300028592|Ga0247822_11676701 | Not Available | 540 | Open in IMG/M |
| 3300028597|Ga0247820_11262558 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300028717|Ga0307298_10140064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
| 3300028812|Ga0247825_10508156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
| 3300028828|Ga0307312_10712081 | Not Available | 665 | Open in IMG/M |
| 3300028872|Ga0307314_10250223 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028889|Ga0247827_10731144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 648 | Open in IMG/M |
| 3300028906|Ga0308309_11915345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Trueperales → Trueperaceae → unclassified Trueperaceae → Trueperaceae bacterium | 500 | Open in IMG/M |
| 3300030006|Ga0299907_10238135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1496 | Open in IMG/M |
| 3300030006|Ga0299907_10724240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 759 | Open in IMG/M |
| 3300030336|Ga0247826_10418844 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300030336|Ga0247826_10472836 | Not Available | 941 | Open in IMG/M |
| 3300030336|Ga0247826_10974364 | Not Available | 672 | Open in IMG/M |
| 3300030619|Ga0268386_10031070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 4224 | Open in IMG/M |
| 3300031170|Ga0307498_10055675 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300031226|Ga0307497_10100513 | Not Available | 1126 | Open in IMG/M |
| 3300031572|Ga0318515_10149342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
| 3300031680|Ga0318574_10151132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1318 | Open in IMG/M |
| 3300031724|Ga0318500_10702206 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031748|Ga0318492_10495170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300031782|Ga0318552_10120642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1306 | Open in IMG/M |
| 3300031782|Ga0318552_10315939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 795 | Open in IMG/M |
| 3300031893|Ga0318536_10307498 | Not Available | 804 | Open in IMG/M |
| 3300031910|Ga0306923_10744511 | Not Available | 1087 | Open in IMG/M |
| 3300031939|Ga0308174_10413662 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300031939|Ga0308174_11317911 | Not Available | 617 | Open in IMG/M |
| 3300032060|Ga0318505_10436142 | Not Available | 619 | Open in IMG/M |
| 3300032180|Ga0307471_100926208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300032180|Ga0307471_102351756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 673 | Open in IMG/M |
| 3300032211|Ga0310896_10569413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300033134|Ga0335073_10015937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10506 | Open in IMG/M |
| 3300033551|Ga0247830_10936214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300033807|Ga0314866_054136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.38% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.19% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.19% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.19% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.60% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.60% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.60% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.60% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_115192732 | 3300000891 | Soil | PLPGLPLAFARAHRLDPTHSILVGTSTAHRTLAATLVARYESID* |
| JGI10216J12902_1074667381 | 3300000956 | Soil | PLPGLPLAFARAQAVDPSRSILIGTGPAHRTLATTLGARYVPVDLDTGSKR* |
| JGI10216J12902_1176346011 | 3300000956 | Soil | PGLALAFARRHGVDPARSMLVGTSAAHRRMGATLGAELRP* |
| JGI12635J15846_101229831 | 3300001593 | Forest Soil | GLPLAFGRAKGVDPARSTLAGTGPAHRTLATTLGCRYVAV* |
| C688J18823_100321024 | 3300001686 | Soil | PGLPLAFARAHSVDPARSVVVGASTAHRTLAAALGARFVPV* |
| C688J18823_100691016 | 3300001686 | Soil | PGLPLAFARAHDVDPARSLLIGTSPAHRTLATTLGALYVSL* |
| C688J18823_101914521 | 3300001686 | Soil | FARTHQIDPSRSILIGTGPAHKTLATTLGARYVEA* |
| C687J26631_100473501 | 3300002124 | Soil | AFARAHGVDPSGSTIVGSGPSQRTLANALGARYVHVVP* |
| JGIcombinedJ26739_1012921452 | 3300002245 | Forest Soil | LPLAFARAHGVDPAXSILIGTGPAHRTLAMTLGAQYVPV* |
| Ga0031654_100180851 | 3300003861 | Freshwater Lake Sediment | RLPLAFARAHDVDPSRSILVGAAAAHRTLAAALGARYVPAAAXXP* |
| Ga0062595_1026883801 | 3300004479 | Soil | PLPGLVLAFAREHGVDPARSVLAGTGPAHRSLAAALGARYLEP* |
| Ga0062594_1015457143 | 3300005093 | Soil | GLPLAFARVHGVDPARSVVVGASPAHRTLATALGARFVAV* |
| Ga0070670_1014515292 | 3300005331 | Switchgrass Rhizosphere | LPGLVLAFCHDRGVDPGRSVLVGTTARHGALATTLGARFDKVG* |
| Ga0070673_1000757285 | 3300005364 | Switchgrass Rhizosphere | AFARAHGVDPARSVLIGTSSAHRTLATTLGARFVGVGSKS* |
| Ga0070714_1019262192 | 3300005435 | Agricultural Soil | GLPLAFARAHGLNPARCTLAGTSPAHRTLAAALGTRYVGV* |
| Ga0070678_1009513261 | 3300005456 | Miscanthus Rhizosphere | PLAFARAHGVDPARSVLIGTSSAHRTLATTLGARFVGVGSKS* |
| Ga0070681_109418201 | 3300005458 | Corn Rhizosphere | PLPGLPLAFARAHGVDPARAVLVGTSSAHRTLATTLGARFVGVGSES* |
| Ga0070679_1002697801 | 3300005530 | Corn Rhizosphere | PPLPGLALAFCRAHGLDPARSTVIGVAPAHRTLAAALGARHLDVR* |
| Ga0070686_1005566261 | 3300005544 | Switchgrass Rhizosphere | PLPRLILEFARRRDVDPARSTLIGTSAAHRTLATTLGARFVEVS* |
| Ga0070686_1019649462 | 3300005544 | Switchgrass Rhizosphere | LPGLPLAFAREHGVDPARSVVIGSGTAHKTLAVTLGARYVSAAPPTP* |
| Ga0066708_103400711 | 3300005576 | Soil | PGLPLAYARARKLDPARSVVIGSGPAHRTLASALGARYLGEG* |
| Ga0068859_1003493804 | 3300005617 | Switchgrass Rhizosphere | PLPGLPLEFARRHGVDPARAVLVGTSAAHRTLASALGSSYIHVG* |
| Ga0066905_1010989912 | 3300005713 | Tropical Forest Soil | FARRHGVDPARAVVVGTSTAHRTLANALGAEFVRPA* |
| Ga0068861_1010176461 | 3300005719 | Switchgrass Rhizosphere | FARTHGVDPARAALVGTSSAHRTLATTLGARFVAVGSQV* |
| Ga0068861_1020863831 | 3300005719 | Switchgrass Rhizosphere | AFARAHGLDRSRSILIGARPAHRQLAEALGARCVNV* |
| Ga0066903_1031557531 | 3300005764 | Tropical Forest Soil | GLALAFARRHDVDPARSLLIGTSTAHRTLAATLGAHYAEPLPEQPA* |
| Ga0066903_1036544711 | 3300005764 | Tropical Forest Soil | AFARRHGVDPSRSKLIGAGPAHRTLAATLGCTYVEA* |
| Ga0070766_101138511 | 3300005921 | Soil | LAFARRHGVDPARSVVMGTGPSHRTLAATLGARYVPV* |
| Ga0081455_100628081 | 3300005937 | Tabebuia Heterophylla Rhizosphere | YGVDPARSIVVGSSPAHRTLATTLGARFVGTDLR* |
| Ga0081538_100817506 | 3300005981 | Tabebuia Heterophylla Rhizosphere | LALAFARSHGVDPARSTLVGSTPAQRTFAATLGARYLAV* |
| Ga0066789_103973742 | 3300005994 | Soil | PLPGLPLAFARAHGLDPSRSILVGATVAHRTMAAALGARYVPAAPPVA* |
| Ga0066652_1005242571 | 3300006046 | Soil | LAFARRHGVDPARSLVVGTGPAHRTLAAALGARFAGVQTLE* |
| Ga0075432_105778241 | 3300006058 | Populus Rhizosphere | IDTARSILVGAGPAHRTLATALGARYVPVGTASSP* |
| Ga0068871_1002161873 | 3300006358 | Miscanthus Rhizosphere | GVDPARSVVIGSGTAHKTLAVTLGARYVSAAPPTP* |
| Ga0074056_107519611 | 3300006574 | Soil | GVDPARAVLIGTSSAHRTLATTLGARFVGVGSES* |
| Ga0074047_118508582 | 3300006576 | Soil | LAFAREHGVDPARSVVIGSGTAHKTLAATLGARYVSPDPPTP* |
| Ga0066660_100197721 | 3300006800 | Soil | LPLAFARTHGIAPSRSILVGTSPAHRTLATTLGAQYIPV* |
| Ga0079220_116999531 | 3300006806 | Agricultural Soil | AFARERRIDTARSILVGAGPAHRTLATALGARYVAVGTASSP* |
| Ga0075428_1019368251 | 3300006844 | Populus Rhizosphere | LPGLPLAFARERRIDTARSILVGAGPAHRTLATALGARYVAVGTASSP* |
| Ga0075425_1014780462 | 3300006854 | Populus Rhizosphere | AFARAAGVDPARSVVIGAGPAHRTLANALGARYVAVA* |
| Ga0075434_1016652912 | 3300006871 | Populus Rhizosphere | LVFARRRDVDPARSTLIGTSAAHRTLATTLGARFVEVS* |
| Ga0075424_1000395231 | 3300006904 | Populus Rhizosphere | PGLPLAFGRAHDVDLGRSLLVGAGAAHRTLATALGARYVEVGTT* |
| Ga0079218_107679951 | 3300007004 | Agricultural Soil | FARTHGVDPSRSILVGTGPAHRTLATTLGARYVAV* |
| Ga0105240_116806931 | 3300009093 | Corn Rhizosphere | AFSRAVGVDPARSTLVGTSMAHRTLATTLGAHFLGA* |
| Ga0111539_104636663 | 3300009094 | Populus Rhizosphere | GLVLAFAREYGVDPARSVLAGTGPAHRSLAAALGARYLEP* |
| Ga0111539_106159403 | 3300009094 | Populus Rhizosphere | GLPLAFGRAHDVDLGRSLLVGAGAAHRTLATALGARYVEVGTT* |
| Ga0111539_128471442 | 3300009094 | Populus Rhizosphere | GLDPARAVLVGTSAAHRTLATTLGARFVGVGSDS* |
| Ga0105245_125671202 | 3300009098 | Miscanthus Rhizosphere | LIAGLVLAFARARHVDVGRSILVGTSPAHRALAEALGTSYVAA* |
| Ga0075418_100177291 | 3300009100 | Populus Rhizosphere | LPLEFARAHQIDPSSSILIGAGPAHRTLAATLGARYVKV* |
| Ga0066709_1014709651 | 3300009137 | Grasslands Soil | LAFTRRHDLDPPRSLLVGTSPVHRTLATTLGCRYLAASTAAGT* |
| Ga0114129_1002483714 | 3300009147 | Populus Rhizosphere | VLEFARRHSVDPARSVVVGASPAHRSLANALGARYVDVGG* |
| Ga0114129_113004433 | 3300009147 | Populus Rhizosphere | VLEFARRHSVDPARSVVVGTSPAHRTLANALGARYVDTG* |
| Ga0114129_125848891 | 3300009147 | Populus Rhizosphere | LPGLPLAFARAHDVDLSRSTLVGTSPAHKTLATTLGARYEAR* |
| Ga0105249_102865621 | 3300009553 | Switchgrass Rhizosphere | ARAHGVDPARAVLIGTSSAHRTLATTLGARFVGVGSKS* |
| Ga0105076_11131801 | 3300009816 | Groundwater Sand | LPLAFARAHGVDPSSSIVIGTGAAHRTLASALGAQYVQV* |
| Ga0126309_108425191 | 3300010039 | Serpentine Soil | GLPLAFARAHGIDTTRSVLIGAGPAHRTLATSLGARYVQV* |
| Ga0126312_105498281 | 3300010041 | Serpentine Soil | GLPLAFARAHNVDPSRSLVIGTGPAHRTLANALSARYLGVVLADA* |
| Ga0126310_114957642 | 3300010044 | Serpentine Soil | MTFARAHGVEPSRSSLVGVSAAHRTLAATLGARYVDLG* |
| Ga0134062_104148793 | 3300010337 | Grasslands Soil | GLPLAFARTHQIDPSRSILIGTGPAHKTLATTLGARYIEA* |
| Ga0126370_110303493 | 3300010358 | Tropical Forest Soil | AKAHAVDPGRSLLVGSSPAHKTLAATLGARYRAID* |
| Ga0126376_111719052 | 3300010359 | Tropical Forest Soil | HKIDPSRSTLIGTSAAHRTLAATLGAAFVEVARD* |
| Ga0126377_118026011 | 3300010362 | Tropical Forest Soil | PLAFARKHGVDPARSILVGTSSAHRTLATTLGARYVAA* |
| Ga0134125_101695514 | 3300010371 | Terrestrial Soil | LALAFARAHDVDPSRSILIGCAPAHRTLATTLDARYIAVE* |
| Ga0134125_113861272 | 3300010371 | Terrestrial Soil | GLALAFARSHGVDLSRSLVVGTSPAHRTLANTLGAEYRDG* |
| Ga0134125_130726882 | 3300010371 | Terrestrial Soil | VLAFARARHVDVGRSILVGTSPAHRALAEALGASYVAA* |
| Ga0134128_109323211 | 3300010373 | Terrestrial Soil | LAFAREHGVDPARSVLAGTGPAHRSLAAALGARYLEP* |
| Ga0134128_122826231 | 3300010373 | Terrestrial Soil | RATGVDPARSLLVGVGPAHRTLANALGARFAQVA* |
| Ga0126383_125162362 | 3300010398 | Tropical Forest Soil | DVDPARSLLIGTSTAHRTLAATLGARYAEPLPEQPA* |
| Ga0151490_13919231 | 3300011107 | Soil | FARAHGVDPARAVLIGTSSAHRTLATTLGARFVGVGSES* |
| Ga0151490_17014671 | 3300011107 | Soil | LALAFARAHGVDPARSVVVGTGAAHRSMASALGARLLQPA* |
| Ga0137365_105456474 | 3300012201 | Vadose Zone Soil | LAFARAHGVDPSRSILVGTGPAHRTLATTLGARYVPVSG* |
| Ga0157315_10446752 | 3300012508 | Arabidopsis Rhizosphere | AREREVDPARSLLIGAGPAHRTLADALGARYVQPG* |
| Ga0136635_102328192 | 3300012530 | Polar Desert Sand | FAHAHGADPARSVLVGTSAAHRTLAAALGARLVAP* |
| Ga0136614_111684152 | 3300012684 | Polar Desert Sand | AFAHAHGVDPARSLLIETSLAHRTLATTLDARYVAL* |
| Ga0157284_101872261 | 3300012893 | Soil | EFARRHGVDPARAVLVGTSAAHRTLASALGSSYIHVG* |
| Ga0164241_102264781 | 3300012943 | Soil | FARAHGVDPAGSALVGTSPAHRTLAETLGARFVAP* |
| Ga0164300_109865721 | 3300012951 | Soil | PLPGLVLAFARRHGVDPARSALVGTSSAHRTMAKTLGCAFDAR* |
| Ga0164298_109290052 | 3300012955 | Soil | LALAFARRHGLDLGSSTVVGASPAHRTLANALGSRFVSA* |
| Ga0164299_103926711 | 3300012958 | Soil | LPLAFARAHGVDLSRSVVVGTGAAHGTLASALGARYVDA* |
| Ga0164299_109115441 | 3300012958 | Soil | PGLPLAFALEHSLDPGRSTLVGTSPAHRTLATTLAARYVENGVKAR* |
| Ga0157374_128065832 | 3300013296 | Miscanthus Rhizosphere | RPPLPRLILEFARRRDVDPARSTLIGTSAAHRTLATTLGARFVEVS* |
| Ga0163162_117912781 | 3300013306 | Switchgrass Rhizosphere | VRAVGVDPARSTLVGTSTAHRTLATTLGARFLGA* |
| Ga0163163_115491902 | 3300014325 | Switchgrass Rhizosphere | LPLAFARIHDVDPASSTLLGTSAAHRTLATTLGARYISV* |
| Ga0173480_109209091 | 3300015200 | Soil | PLPGLALAFARSHEIDLPQSLLVGTGPAHRTLATALGARYASV* |
| Ga0132258_124846343 | 3300015371 | Arabidopsis Rhizosphere | PLPGLPLAFARAHGVGPSRSTLVGTSPAHRALANALGARYVEPA* |
| Ga0132258_126350471 | 3300015371 | Arabidopsis Rhizosphere | LAFARAHGVDPARSTLVGNGPAHRTLATTLGARYVAVSA* |
| Ga0132258_132112813 | 3300015371 | Arabidopsis Rhizosphere | PLAFARTHGVDPSRSLLVGTGPAHRTMANTLGATLVG* |
| Ga0132256_1005812342 | 3300015372 | Arabidopsis Rhizosphere | GLPLAFARRHGVDPARSLVVGSSPAHRTLATTLGARFVGTDARGNG* |
| Ga0132256_1023388212 | 3300015372 | Arabidopsis Rhizosphere | LAFSRANDVDPARSLLIGNAPSHRTLATTLGARFVEAANG* |
| Ga0132255_1009829891 | 3300015374 | Arabidopsis Rhizosphere | LPGLPLAFARTHGVDPARSALVGTSPAHRTLAATLDARFVDAV* |
| Ga0182041_106139551 | 3300016294 | Soil | PAARPAGLPLAFARTHEIALAGSIVIGAGPAHRTLATTLGAMYVSA |
| Ga0182035_115860602 | 3300016341 | Soil | LAFARAHSIDTASSILIGCSRAHRALATTLGARYLPL |
| Ga0182040_105974083 | 3300016387 | Soil | LPGLLLAFARAHSVDTASSILIGCSRAHRTLATTLGARYVPL |
| Ga0182038_105655811 | 3300016445 | Soil | AFARAHSIDTASSILIGCSRAHRTLATTLGARYLPL |
| Ga0187776_102419471 | 3300017966 | Tropical Peatland | LAFARTHAVDLLRSVVVGVSPTHRTLASALGARHIPV |
| Ga0187863_102471651 | 3300018034 | Peatland | LPGLIQAFARANNVDVSRSTLVGAGPAHRTLARTLGAAYVAV |
| Ga0184623_100826022 | 3300018056 | Groundwater Sediment | MPFASAHGIDPARSVVVGASPAHRTLATTLGAGYVAIGAPESL |
| Ga0187784_104241914 | 3300018062 | Tropical Peatland | LAFARTHNVDPARSIVIGTSRAHRTLATALGARYVPCG |
| Ga0184637_103355672 | 3300018063 | Groundwater Sediment | LAFARAHGIDPSRSVLVGSGPAHKTLATTLDARYVPVRP |
| Ga0190265_103505491 | 3300018422 | Soil | LPGLPLAFARAHGVDPARSLLVGTVPAHKTLAAALGARYLAA |
| Ga0190265_117645863 | 3300018422 | Soil | PTLPGLPLAFAREHDVDPSRSTLVGTGPAHKTLATTLGARYVPVETTEPA |
| Ga0190275_132663221 | 3300018432 | Soil | HGVEPSRSVLVGVSTAHRTLATTLGARFVNAAGRV |
| Ga0066667_110158132 | 3300018433 | Grasslands Soil | PPLPGLSLAFARAHGVDPARSILVGTSTAHRTLATTLGARYLAV |
| Ga0190269_110233981 | 3300018465 | Soil | LPGLVLAFAFAHGVDPAQSALVGDGPAHRAIAAAVRARLELLGA |
| Ga0066662_122150041 | 3300018468 | Grasslands Soil | AFARSQGVDPSRSILVGTGAAHRTLATALGARYVAL |
| Ga0190270_103257311 | 3300018469 | Soil | AFARRHGVDPAQSLLVGSSPAHRTLATTLGARYVSA |
| Ga0190270_116867982 | 3300018469 | Soil | FAQANDVDWSRSTLVGTSTAHRTLATTLGARFIAA |
| Ga0190271_120193241 | 3300018481 | Soil | PLPGLPLAFARRHGVDPAQSVVIGGSAAHRTLANALGAGYVEAS |
| Ga0190264_109469541 | 3300019377 | Soil | IAFARVHAIDLSRSLLIGSAPAHRTLATALGVRYVPVTP |
| Ga0210397_108827191 | 3300021403 | Soil | ARAHDINPSRSIVIGCSPAHRTIATTLDARYVAVE |
| Ga0210387_103713201 | 3300021405 | Soil | FCRRHGVDPARSLLVGTSPAHRALAAAVGARFTSHG |
| Ga0210394_114683681 | 3300021420 | Soil | FARIHDVDPSRSTLIGAGPAHRTLATTLGAGYIAV |
| Ga0126371_122889752 | 3300021560 | Tropical Forest Soil | LALAFAHAHGVDPARSILIGTSAAHRTLAATLGARYLEA |
| Ga0126371_133280682 | 3300021560 | Tropical Forest Soil | PGLPLAFAKAHAVDPGRSLLVGSSPAHKTLAATLGARYRAID |
| Ga0224510_106749531 | 3300022309 | Sediment | PLPGLLLAFARRHGVDPARSVVVGTSAAHRALAVALGASIVST |
| Ga0247801_10562761 | 3300023064 | Soil | PLAFARTHGVDPARAALVGTSSAHRTLATTLGARFVAVGSQV |
| Ga0247789_10630022 | 3300023266 | Soil | VFAREHGIDLSRSAVIGGGPAHRTLATTLGSRYVGSP |
| Ga0207642_102126333 | 3300025899 | Miscanthus Rhizosphere | LPGLPLEFARRHGVDPARAVLVGTSAAHRTLASALGSSYIHVG |
| Ga0207642_109507612 | 3300025899 | Miscanthus Rhizosphere | GLPLAFARRHGVDPARSLLVGSSTTHRALATALGSTYVDISG |
| Ga0207699_102099892 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LAFTTAHGLDPARCVVVGSGPAHRTLANALGARHIPVVP |
| Ga0207693_114550492 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GARGVDLSRSLVIGSGPAHRTLANALGARHVGVVA |
| Ga0207662_103346063 | 3300025918 | Switchgrass Rhizosphere | GLPLAFARTHGVDPARSLLVGTGHAHRQLAEALGARYLQP |
| Ga0207652_105076921 | 3300025921 | Corn Rhizosphere | PLPGLPLAFARAHGVDPARSVLIGTSSAHRTLATTLGARFVGVGSES |
| Ga0207646_113065372 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LAFSRVHGVDPSRSILVGTGPAHRTLATTLGARYVPV |
| Ga0207700_102727343 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ALAFARSHGVEPVRCALIGCSPAHRTLSTTLDARYLAVE |
| Ga0207664_118895631 | 3300025929 | Agricultural Soil | GLPLAFARAHGLNPARCTLAGTSPAHRTLAAALGTRYVGV |
| Ga0207704_104263772 | 3300025938 | Miscanthus Rhizosphere | GLPLAFAREHGVDPARSVVIGSGTAHKTLAVTLGARYVSAAPPTP |
| Ga0208651_10107731 | 3300025998 | Rice Paddy Soil | PLPGLPLAFAHVHSLDPALCTLIGTSAAHRTLAATLGARYLDA |
| Ga0207676_111529564 | 3300026095 | Switchgrass Rhizosphere | LPGLVLEFARRHSVDPARSVVVGASPAHRSLANALGARYVDVGG |
| Ga0209801_12389253 | 3300026326 | Soil | PGLPLAFARAHRIDPSRSILVGSASAHRTLANTLGAQYVAV |
| Ga0209218_11072951 | 3300027505 | Forest Soil | FARTHGLDLASSVVVGCRPTDRTLATALGARYVAV |
| Ga0209811_103500912 | 3300027821 | Surface Soil | FARTHGVEPSVSTVIGTGPAHKTLAAALGARYVAV |
| Ga0207428_103886831 | 3300027907 | Populus Rhizosphere | IDTARSILVGAGPAHRTLATALGARYVPVGTASSP |
| Ga0209006_111648861 | 3300027908 | Forest Soil | LAFARTRGIDPSQSLLVGAAPAHRTLATTLGAMYRAVNAEPR |
| Ga0247818_105632761 | 3300028589 | Soil | ARVPGLPLAFARARGVDPSCSVLIGTGPAHRSLAAALGARYVQAA |
| Ga0247822_116767011 | 3300028592 | Soil | HGVDPARAVLVGTSSAHRTLATTLGARFVGVGSES |
| Ga0247820_112625581 | 3300028597 | Soil | SMPGLPLAFAREHGVDPSRSLLVGTGPAHKNLAAALGSRYVQA |
| Ga0307298_101400641 | 3300028717 | Soil | PLPGLALVFARARDVDLSRSTVVGASPAHATLARTLGCRSVMV |
| Ga0247825_105081562 | 3300028812 | Soil | HCRPLPGLVLAFARARGVDPARSAFVGTSAAHRTLATTLGASFVEP |
| Ga0307312_107120811 | 3300028828 | Soil | PPLPGFALAFCRAHSLDPARSTLIGAAPAHRTLAAALGARYLEP |
| Ga0307314_102502231 | 3300028872 | Soil | MAFARAHGVEPARSVLVGVSAAHRTLATTLGARYVDLG |
| Ga0247827_107311442 | 3300028889 | Soil | GLVLAFARARGVDPARSAFVGTSAAHRTLATTLGASFVEP |
| Ga0308309_119153451 | 3300028906 | Soil | ALAFARTHGLDLASSVVVGCRPTDRTLATALGARYVAV |
| Ga0299907_102381353 | 3300030006 | Soil | LPLAFARAHGVDPARSVVVGTGPAHRTLAATLGARYAQPG |
| Ga0299907_107242401 | 3300030006 | Soil | GLPLAFARTHAVDPARSTLVGTSSAHKTLALTLGARYVAL |
| Ga0247826_104188443 | 3300030336 | Soil | GLPLAFARAHGVDPSGSVLVGTGPAHRSLAAALGAGYIQAS |
| Ga0247826_104728362 | 3300030336 | Soil | PLPGLPLAFARAHGVDPARSTVLGTSPAHRTLAAALGADVVLLPRPG |
| Ga0247826_109743641 | 3300030336 | Soil | AHGVDPARSVLIGTSSAHRTLATTLGARFVGVGSES |
| Ga0268386_100310701 | 3300030619 | Soil | PGLPLAFARAHDVDPARSTLIGTSAAHRTLATTLCARYLDLTKVG |
| Ga0307498_100556751 | 3300031170 | Soil | AFARLHGIDPSRSVLVGTGAAHRSMASALGARPLQPA |
| Ga0307497_101005131 | 3300031226 | Soil | FAREHGIDPARSVVIGSGTAHKTLAATLGARYVSAEPPTP |
| Ga0318515_101493421 | 3300031572 | Soil | PGLCLAFAHRHGLDPPGSILVGTSSAHRTLAAALGARYVTL |
| Ga0318574_101511323 | 3300031680 | Soil | LPGLPLAFARHHGVDPARSTLIGVSAAHRTLATTLGATFVTVSVS |
| Ga0318500_107022063 | 3300031724 | Soil | PGLPLAFARANGVASDRSALVGTSTAHRSLADALGARYVSVSLR |
| Ga0318492_104951701 | 3300031748 | Soil | FAHRHRLDPARCTLVGTSSAHRTLAATLGARYVPVS |
| Ga0318552_101206423 | 3300031782 | Soil | LPLAFARASAVDPARSLLVGSSSAHKTLAATLGARYRGVV |
| Ga0318552_103159391 | 3300031782 | Soil | LAFARTHEIALAGSIVIGAGPAHRTLATTLGAMYVSA |
| Ga0318536_103074981 | 3300031893 | Soil | PLPGLPLAFSRANAVDPADSILIGCSPAHRTLATTLGARYIPV |
| Ga0306923_107445112 | 3300031910 | Soil | ARHHGVDPARSTLIGVSAAHRTLATTLGATFVTVSVS |
| Ga0308174_104136621 | 3300031939 | Soil | GLALAFARSHDVDPARSTLIGAGPAHRTLAAALGARHVPV |
| Ga0308174_113179112 | 3300031939 | Soil | LAFCRAHGLDPARSTVIGRAPAHRTLAAALGARLLDLR |
| Ga0318505_104361421 | 3300032060 | Soil | GLPLAFSHANAVDPADSILIGCSPAHRTLATTLGARYIPV |
| Ga0307471_1009262083 | 3300032180 | Hardwood Forest Soil | LPGLPLAFARARTLDPARSVVIGSGPAHRTLASALGARYVDAS |
| Ga0307471_1023517563 | 3300032180 | Hardwood Forest Soil | RSAGVDPARSTLVGTSTAHRTLAATLGARYVDVQNERT |
| Ga0310896_105694132 | 3300032211 | Soil | PLAFAKRHGVDPARSLLVGTSTTHRTLATVLGSTYVDVSG |
| Ga0335073_1001593713 | 3300033134 | Soil | PLPGLALAFARAHGLDPARSVLIGTGPAHRNLAAALGARYLPV |
| Ga0247830_109362143 | 3300033551 | Soil | PGLLLVFARQHSVDLPRSTLIGSGPAHKTLASTLGARYVGV |
| Ga0314866_054136_74_187 | 3300033807 | Peatland | VFARAHDLDPARSLLIGTGPAHRNLAVALGARYVEVA |
| ⦗Top⦘ |