NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F037146

Metagenome Family F037146

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037146
Family Type Metagenome
Number of Sequences 168
Average Sequence Length 48 residues
Representative Sequence MAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLIL
Number of Associated Samples 142
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 63.64 %
% of genes near scaffold ends (potentially truncated) 94.64 %
% of genes from short scaffolds (< 2000 bps) 92.26 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.024 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.452 % of family members)
Environment Ontology (ENVO) Unclassified
(27.976 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.214 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.74%    β-sheet: 0.00%    Coil/Unstructured: 55.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF13302Acetyltransf_3 6.55
PF01497Peripla_BP_2 5.36
PF04268SoxG 4.17
PF137592OG-FeII_Oxy_5 4.17
PF08240ADH_N 3.57
PF02979NHase_alpha 2.98
PF08669GCV_T_C 2.38
PF064393keto-disac_hyd 2.38
PF11937DUF3455 1.79
PF13360PQQ_2 1.79
PF05437AzlD 1.19
PF13628DUF4142 1.19
PF13502AsmA_2 1.19
PF00528BPD_transp_1 1.19
PF01323DSBA 1.19
PF02687FtsX 1.19
PF04542Sigma70_r2 1.19
PF02798GST_N 0.60
PF01061ABC2_membrane 0.60
PF03721UDPG_MGDP_dh_N 0.60
PF02776TPP_enzyme_N 0.60
PF13395HNH_4 0.60
PF13181TPR_8 0.60
PF04828GFA 0.60
PF14534DUF4440 0.60
PF12806Acyl-CoA_dh_C 0.60
PF02738MoCoBD_1 0.60
PF07883Cupin_2 0.60
PF14759Reductase_C 0.60
PF00950ABC-3 0.60
PF00565SNase 0.60
PF02154FliM 0.60
PF13710ACT_5 0.60
PF01738DLH 0.60
PF02211NHase_beta 0.60
PF00579tRNA-synt_1b 0.60
PF01343Peptidase_S49 0.60
PF08028Acyl-CoA_dh_2 0.60
PF02878PGM_PMM_I 0.60
PF08281Sigma70_r4_2 0.60
PF00127Copper-bind 0.60
PF01844HNH 0.60
PF13361UvrD_C 0.60
PF05685Uma2 0.60
PF13545HTH_Crp_2 0.60
PF03389MobA_MobL 0.60
PF05199GMC_oxred_C 0.60
PF07715Plug 0.60
PF00563EAL 0.60
PF00144Beta-lactamase 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG4607ABC-type enterochelin transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.36
COG0614ABC-type Fe3+-hydroxamate transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.36
COG4594ABC-type Fe3+-citrate transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.36
COG4592ABC-type Fe2+-enterobactin transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.36
COG4558ABC-type hemin transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.36
COG4583Sarcosine oxidase gamma subunitAmino acid transport and metabolism [E] 4.17
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.19
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.19
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.19
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.19
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.19
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.60
COG1868Flagellar motor switch protein FliMCell motility [N] 0.60
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.60
COG2367Beta-lactamase class ADefense mechanisms [V] 0.60
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.60
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.60
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 0.60
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.60
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.60
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.60
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.60
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.60
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 0.60
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.60
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.60
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.60
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 0.60
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.60
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.60
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.60
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 0.60
COG0507ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.60
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.60
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.60
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.62 %
UnclassifiedrootN/A27.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_100626507All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300005167|Ga0066672_10352316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium961Open in IMG/M
3300005167|Ga0066672_10896741All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005167|Ga0066672_10978174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium518Open in IMG/M
3300005175|Ga0066673_10270111All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium987Open in IMG/M
3300005176|Ga0066679_10273963All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300005176|Ga0066679_10608775All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005178|Ga0066688_10233904All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300005180|Ga0066685_10566823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria782Open in IMG/M
3300005187|Ga0066675_10284692All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1191Open in IMG/M
3300005206|Ga0068995_10092082Not Available607Open in IMG/M
3300005365|Ga0070688_101744777All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005437|Ga0070710_10036102All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium2700Open in IMG/M
3300005438|Ga0070701_10080403All Organisms → cellular organisms → Bacteria → Proteobacteria1763Open in IMG/M
3300005450|Ga0066682_10149751All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1485Open in IMG/M
3300005530|Ga0070679_102169513Not Available505Open in IMG/M
3300005533|Ga0070734_10595900Not Available629Open in IMG/M
3300005545|Ga0070695_101389992Not Available582Open in IMG/M
3300005553|Ga0066695_10567010All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium687Open in IMG/M
3300005561|Ga0066699_10363653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1034Open in IMG/M
3300005576|Ga0066708_10138777All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300005576|Ga0066708_10840674All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium574Open in IMG/M
3300005586|Ga0066691_10310785All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300006032|Ga0066696_11008503All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006034|Ga0066656_10175325All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300006046|Ga0066652_101319769All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium680Open in IMG/M
3300006794|Ga0066658_10193733All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300006796|Ga0066665_10235750All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1440Open in IMG/M
3300006797|Ga0066659_11401627All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium584Open in IMG/M
3300006800|Ga0066660_10547638All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium971Open in IMG/M
3300006846|Ga0075430_101431021Not Available568Open in IMG/M
3300006881|Ga0068865_101905184Not Available538Open in IMG/M
3300009012|Ga0066710_100993665All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300009012|Ga0066710_102178465All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium810Open in IMG/M
3300009087|Ga0105107_10231172All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1293Open in IMG/M
3300009093|Ga0105240_11149636All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium824Open in IMG/M
3300009137|Ga0066709_103226954All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium594Open in IMG/M
3300009662|Ga0105856_1280580Not Available551Open in IMG/M
3300010048|Ga0126373_10537100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1216Open in IMG/M
3300010048|Ga0126373_11813641All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
3300010048|Ga0126373_11939886All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300010049|Ga0123356_13907330Not Available514Open in IMG/M
3300010162|Ga0131853_11056473All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300010320|Ga0134109_10138515All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium870Open in IMG/M
3300010322|Ga0134084_10144259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium796Open in IMG/M
3300010335|Ga0134063_10481931All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium619Open in IMG/M
3300010337|Ga0134062_10095236All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300010398|Ga0126383_12517242All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium599Open in IMG/M
3300010403|Ga0134123_10964530Not Available865Open in IMG/M
3300011435|Ga0137426_1080565All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300011435|Ga0137426_1182029All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium625Open in IMG/M
3300011436|Ga0137458_1031286All Organisms → cellular organisms → Bacteria → Proteobacteria1362Open in IMG/M
3300012285|Ga0137370_10007295All Organisms → cellular organisms → Bacteria → Proteobacteria5124Open in IMG/M
3300012285|Ga0137370_10284881All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium984Open in IMG/M
3300012285|Ga0137370_10444067All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium789Open in IMG/M
3300012349|Ga0137387_10654755All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium761Open in IMG/M
3300012683|Ga0137398_10860287All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter633Open in IMG/M
3300012683|Ga0137398_11039603Not Available566Open in IMG/M
3300012908|Ga0157286_10121906Not Available795Open in IMG/M
3300012914|Ga0157297_10427377Not Available538Open in IMG/M
3300012971|Ga0126369_12288731All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium627Open in IMG/M
3300012975|Ga0134110_10312403All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300013104|Ga0157370_11868091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium539Open in IMG/M
3300014157|Ga0134078_10145960All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium927Open in IMG/M
3300014166|Ga0134079_10302788All Organisms → cellular organisms → Bacteria → Proteobacteria711Open in IMG/M
3300014321|Ga0075353_1231229All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria508Open in IMG/M
3300014324|Ga0075352_1254173Not Available542Open in IMG/M
3300014326|Ga0157380_12761467Not Available558Open in IMG/M
3300014871|Ga0180095_1026120Not Available960Open in IMG/M
3300014968|Ga0157379_10229811Not Available1681Open in IMG/M
3300014968|Ga0157379_11366868All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia686Open in IMG/M
3300014969|Ga0157376_11999974Not Available617Open in IMG/M
3300015200|Ga0173480_10189916Not Available1080Open in IMG/M
3300015200|Ga0173480_10700169Not Available635Open in IMG/M
3300015356|Ga0134073_10080499All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300015357|Ga0134072_10005516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2748Open in IMG/M
3300016387|Ga0182040_10543066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea934Open in IMG/M
3300017937|Ga0187809_10331613All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300017973|Ga0187780_10190636All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300017973|Ga0187780_11405840Not Available514Open in IMG/M
3300017975|Ga0187782_11254556All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300018085|Ga0187772_10048370All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2602Open in IMG/M
3300018089|Ga0187774_10391709All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300018433|Ga0066667_10081992All Organisms → cellular organisms → Bacteria → Proteobacteria2082Open in IMG/M
3300018433|Ga0066667_11142742All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium675Open in IMG/M
3300018469|Ga0190270_10734861All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300018476|Ga0190274_13866088Not Available507Open in IMG/M
3300018481|Ga0190271_13764456Not Available508Open in IMG/M
3300018482|Ga0066669_10783941All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300018482|Ga0066669_11959431All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300020199|Ga0179592_10014674All Organisms → cellular organisms → Bacteria → Proteobacteria3431Open in IMG/M
3300021559|Ga0210409_10596225All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium973Open in IMG/M
3300024177|Ga0247686_1033367All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300024283|Ga0247670_1044745All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300025790|Ga0210075_1061728All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300025924|Ga0207694_11747125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium523Open in IMG/M
3300025931|Ga0207644_11289586Not Available614Open in IMG/M
3300025939|Ga0207665_11207744All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300026111|Ga0208291_1075570Not Available594Open in IMG/M
3300026312|Ga0209153_1017017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2364Open in IMG/M
3300026314|Ga0209268_1060410All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1174Open in IMG/M
3300026315|Ga0209686_1052448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1486Open in IMG/M
3300026316|Ga0209155_1188743All Organisms → cellular organisms → Bacteria → Proteobacteria657Open in IMG/M
3300026318|Ga0209471_1328552All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300026325|Ga0209152_10001986All Organisms → cellular organisms → Bacteria → Proteobacteria7980Open in IMG/M
3300026523|Ga0209808_1184134All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium732Open in IMG/M
3300026532|Ga0209160_1198649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium770Open in IMG/M
3300026538|Ga0209056_10006991All Organisms → cellular organisms → Bacteria → Proteobacteria11630Open in IMG/M
3300026542|Ga0209805_1027412All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2937Open in IMG/M
3300026542|Ga0209805_1316170All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium592Open in IMG/M
3300026557|Ga0179587_10106899All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1700Open in IMG/M
3300027818|Ga0209706_10295809All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium768Open in IMG/M
3300028780|Ga0302225_10324857Not Available728Open in IMG/M
3300028812|Ga0247825_10147772All Organisms → cellular organisms → Bacteria → Proteobacteria1610Open in IMG/M
3300030006|Ga0299907_10763322All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium733Open in IMG/M
3300031455|Ga0307505_10280286All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300031455|Ga0307505_10427495All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300031572|Ga0318515_10387128All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300031573|Ga0310915_11158962All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031640|Ga0318555_10724161Not Available537Open in IMG/M
3300031720|Ga0307469_11162869Not Available728Open in IMG/M
3300031747|Ga0318502_11011112Not Available507Open in IMG/M
3300031768|Ga0318509_10411001All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium757Open in IMG/M
3300031771|Ga0318546_10300166Not Available1111Open in IMG/M
3300031779|Ga0318566_10344801All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300031781|Ga0318547_10217660All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300031797|Ga0318550_10369423Not Available695Open in IMG/M
3300031819|Ga0318568_10610576Not Available679Open in IMG/M
3300031835|Ga0318517_10207993All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300031860|Ga0318495_10401423Not Available604Open in IMG/M
3300031879|Ga0306919_10189413All Organisms → cellular organisms → Bacteria1523Open in IMG/M
3300031890|Ga0306925_12004716All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300031893|Ga0318536_10312183Not Available797Open in IMG/M
3300031912|Ga0306921_10409865All Organisms → cellular organisms → Bacteria → Acidobacteria1581Open in IMG/M
3300031942|Ga0310916_10208256All Organisms → cellular organisms → Bacteria → Acidobacteria1639Open in IMG/M
3300031942|Ga0310916_10631126Not Available909Open in IMG/M
3300031945|Ga0310913_10537140Not Available830Open in IMG/M
3300031945|Ga0310913_10768938All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium680Open in IMG/M
3300031946|Ga0310910_10252792All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. Root4941379Open in IMG/M
3300031954|Ga0306926_10414221All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300031954|Ga0306926_11505073All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300031962|Ga0307479_10559844All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1126Open in IMG/M
3300031981|Ga0318531_10154841All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax1027Open in IMG/M
3300032000|Ga0310903_10376829All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium717Open in IMG/M
3300032001|Ga0306922_10979652All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales874Open in IMG/M
3300032002|Ga0307416_101963535All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium688Open in IMG/M
3300032039|Ga0318559_10626666Not Available502Open in IMG/M
3300032059|Ga0318533_11164572Not Available564Open in IMG/M
3300032060|Ga0318505_10104055Not Available1288Open in IMG/M
3300032063|Ga0318504_10389282All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300032068|Ga0318553_10552904All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032089|Ga0318525_10485653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium632Open in IMG/M
3300032090|Ga0318518_10281274All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300032090|Ga0318518_10680226Not Available524Open in IMG/M
3300032144|Ga0315910_11005997All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium650Open in IMG/M
3300032157|Ga0315912_10182944Not Available1643Open in IMG/M
3300032157|Ga0315912_10628159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium856Open in IMG/M
3300032174|Ga0307470_10761637Not Available745Open in IMG/M
3300032174|Ga0307470_11614890Not Available543Open in IMG/M
3300032782|Ga0335082_10532331All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300032783|Ga0335079_11025926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria840Open in IMG/M
3300032828|Ga0335080_11832676Not Available591Open in IMG/M
3300032895|Ga0335074_10317251All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300033289|Ga0310914_11220375All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300033433|Ga0326726_10207337All Organisms → cellular organisms → Bacteria1811Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.98%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.38%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.38%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.19%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.19%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.19%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.19%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.60%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.60%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.60%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.60%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.60%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.60%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.60%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005206Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010162Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)Host-AssociatedOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024177Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025790Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026111Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10062650713300000955SoilMAVQPASLEVLEKAAAPAAQARGIVQAIEIEIAGAKDTLATRQDMLILRHEMA
Ga0066672_1035231613300005167SoilMSMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDTLATKQDTLLL
Ga0066672_1089674113300005167SoilMSMQVASLEVLEKANLPAPQARAIVQAIEIEIAGARDTLATKQDTLLLRQDMAELGHDLR
Ga0066672_1097817413300005167SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRHEIAELRT
Ga0066673_1027011113300005175SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQ
Ga0066679_1027396313300005176SoilMSMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDTLATKQDTLLLRQDMA
Ga0066679_1060877513300005176SoilMPVQAASLEILEKANLPAPQARAIVQAIEIEIAGAKETLATKQDILILRHEMAEMRAELKTE
Ga0066688_1023390433300005178SoilMPVQAASLEILEKANVPAPQARAIVQAIEIEIAGAKETLATKQDMLILRHEMAEM
Ga0066685_1056682323300005180SoilMAVQAASLEILEKADVPPAQARAIVQAMEIEIAGARDTLATKHDL
Ga0066675_1028469213300005187SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATRQDVLILRHEIVELRHEVEGKLS
Ga0068995_1009208223300005206Natural And Restored WetlandsMQVESLEILEKAEVAPAQARAIVRAIEVEIAGARDTLATKHDLIALKQDVRALGQD
Ga0070688_10174477723300005365Switchgrass RhizosphereVLEKASVAPMQARAIVRAIEIEIAGAKDTLATKQDVLGLHQALDVLRAEL
Ga0070710_1003610213300005437Corn, Switchgrass And Miscanthus RhizosphereVAVQPASLEVLEKAAVPPVQARAIVRAIEIEIAGAKETLATKQDVLILRHEIA
Ga0070701_1008040313300005438Corn, Switchgrass And Miscanthus RhizosphereMTMQAESLEVLEKASVAPMQARAIVRAIEIEIAGAKDTLA
Ga0066682_1014975113300005450SoilMSMQAASLEVLEKANLPPLQARAIVQAIEIAGARDTLATKH
Ga0070679_10216951323300005530Corn RhizosphereMPMQAESLEILEKASVAPAQARAIVRAIEIEIAGAKDTLATKHDLFELRAE
Ga0070734_1059590023300005533Surface SoilMAVQPASLEVLERAQVPPAQARAIVQAIEIEISGAKETLATKSDT
Ga0070695_10138999223300005545Corn, Switchgrass And Miscanthus RhizosphereMQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLATKHDLLALRQ
Ga0066695_1056701023300005553SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRHEIAELRTELR
Ga0066699_1036365333300005561SoilMPVQAASLEILEKANVPAPQARAIVQAIEIEIAGAKE
Ga0066708_1013877713300005576SoilMPVQAASLEILEKANVPAPQARAIVQAIEIEIAGAKETLATKQDILILRHEMAEMRAELRHEL
Ga0066708_1084067423300005576SoilMAVQAASLEILDKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDILILRHEI
Ga0066691_1031078513300005586SoilMPVQAASLEILEKANLPAPQARAIVQAIEIEIAGAKETLATKQDILILRHEMAEMRHELKTEIAT
Ga0066696_1100850313300006032SoilMPVQAASLEILEKANVPAPQARAIVQAIEIEIAGAKETLATKQDMLILRHEMAEMR
Ga0066656_1017532533300006034SoilMPVQAASLEILEKANVPAPQARAIVQAIEIEIAGAKETLATKQDILILRHEMAEM
Ga0066652_10131976923300006046SoilVQAASLEILEKADVPPAQARAIVQAMEIQIAGARDTLATKHDLLVLRNELSEK
Ga0066658_1019373313300006794SoilMSMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDTLATKQDTLL
Ga0066665_1023575013300006796SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRHEIAEL
Ga0066659_1140162723300006797SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRHEIAELRTE
Ga0066660_1054763833300006800SoilMPVQAASLEILEKANVPAPQARAIVQAIEIEIAGAKET
Ga0075430_10143102123300006846Populus RhizosphereMPMQAESLEVLEKASVAPAQARAIVRAIEIELAGAKDTLATKHDVLALRSELNGKIDN
Ga0068865_10190518413300006881Miscanthus RhizosphereMPMQAESLEILEKASVAPAHARAIVRAIEIEIAGAKDTLATKHDLFELRAEVRQL
Ga0066710_10099366513300009012Grasslands SoilMPVQAASLEILEKANLPAPQARAIVQAIEIEIAGAKETLATKQDILILRHEMAEMR
Ga0066710_10217846513300009012Grasslands SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRHEIAE
Ga0105107_1023117223300009087Freshwater SedimentMQAESLAVLEKTSVAPAQARAMVRAIEIEIAGANDTLATKQDV*
Ga0105240_1114963613300009093Corn RhizosphereMSMQAASLEVLEKANVPAPQARAIVQAIEIELSASQSRLATKQDL
Ga0066709_10322695413300009137Grasslands SoilVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRHEIAE
Ga0105856_128058023300009662Permafrost SoilMLAASLEILERAQVPPLQARAIIQAIELELVAQHDVLATKQDFALLRN
Ga0126373_1053710033300010048Tropical Forest SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDK*
Ga0126373_1181364123300010048Tropical Forest SoilMAVQAASLEILEKANVPAAQARAFVQAIEIEIEGAKDTLATKHDLLVLRNDLTE
Ga0126373_1193988623300010048Tropical Forest SoilMAVQAASLEVLEKAAVPPAQARAIVQAIEIEIAGSKDTLAT
Ga0123356_1390733013300010049Termite GutMAVQPASLEVLEKAAVPSAQARAIVQAIEIEIAGAKDTLAT
Ga0131853_1105647313300010162Termite GutMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATRQDMLI
Ga0134109_1013851513300010320Grasslands SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIELAGARDTLATKQDTL
Ga0134084_1014425923300010322Grasslands SoilMPVQAASLEILEKADVPAQQARAIVQAIEIEIAGAKETLATKQDMLILR
Ga0134063_1048193123300010335Grasslands SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTL
Ga0134062_1009523633300010337Grasslands SoilMSMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDT
Ga0126383_1251724213300010398Tropical Forest SoilMSMRAESLEVLEKVGVPPAQARAIVRAIEIELDGAKEPLATKQDLK
Ga0134123_1096453013300010403Terrestrial SoilLQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLATKH
Ga0137426_108056523300011435SoilMSMQAESLEVLEKASVAPAQARAIVRAIEIEIAGARDTLATKHDILALRHDFDLLRG
Ga0137426_118202923300011435SoilMPMQAESLEVLEKASVAPTQARAIVRAIEIEIAGAKDTLATKQDVLGLHQALDVLRA
Ga0137458_103128623300011436SoilMPMQAESLEVLEKADVAPAQARAIVRAIEIEITGAKDTLATKHDLATLD
Ga0137370_1000729513300012285Vadose Zone SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGARDTLATKQDTLLLRQDT
Ga0137370_1028488113300012285Vadose Zone SoilMAVQAASLEILDKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDILILRHEIA
Ga0137370_1044406723300012285Vadose Zone SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDILILRHEIA
Ga0137370_1062847013300012285Vadose Zone SoilMQPESLEVLEKADVPPAQARAIVRAIELEIAGAKDTLATKHDVLALRHDFDALRHDVEMFRSDV
Ga0137387_1065475513300012349Vadose Zone SoilVQAASLEILEKADVPPAQARAIVQAIEIEIAGARDTLATKHD
Ga0137398_1086028723300012683Vadose Zone SoilMSMQAASLEVLEKANLPPLQAPAIVQAIEIEIAGARDTLATKHDVVQLRQEMSDMR
Ga0137398_1103960313300012683Vadose Zone SoilMAMQVESLEVLEKAAVVPAQARAIVRAIEIEIAGAKD
Ga0157286_1012190613300012908SoilMQAESLEILEKADVLPSQARAILRAIDLEIDARDTLATKQDL
Ga0157297_1042737713300012914SoilMPMQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLATKSDLL
Ga0126369_1228873113300012971Tropical Forest SoilVAVQPASLEVLERAAVPPAQARAIVQAIEIETAGAKDTLVTRQDTLILRHEMAS*
Ga0134110_1031240313300012975Grasslands SoilMSMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDTLATKQDTLLLRQDMAELGHDL
Ga0157370_1186809123300013104Corn RhizosphereMAVQPESLEVLEKAAVPPMQARAIVQAIEIEIAGAQDVLATKQDLLELR
Ga0134078_1014596013300014157Grasslands SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDILILRHEI
Ga0134079_1030278823300014166Grasslands SoilMFMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDMLATKQNTLLLSQDTA
Ga0075353_123122913300014321Natural And Restored WetlandsMSMQAESLEVLESANVAPPQARAIVRAIEIELAGAKDTLATKHDLVLLRQDFRNE
Ga0075352_125417323300014324Natural And Restored WetlandsMAMQVESLEILEKAEVAPAQARAIVRAIEVEIAGARDTLATKHDLIALKQD
Ga0157380_1276146713300014326Switchgrass RhizosphereMPMQVESLEALEKASVAPAQARAIVRAIEIEIAGAKDTLATKRDLDVLRADLR
Ga0180095_102612013300014871SoilMQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLAT
Ga0157379_1022981113300014968Switchgrass RhizosphereMSMQAASLEVLEKANLPAPQARAIVQAIEIEIAGAHNVLATKED
Ga0157379_1136686813300014968Switchgrass RhizosphereMQAASLEILEKANVPAPQARAIVQAIEFELIAAKDTL
Ga0157376_1199997413300014969Miscanthus RhizosphereMQAESLEVLEKADVPPGQARAIVRAIEIELKSAKDTLATKHD
Ga0173480_1018991613300015200SoilMAMQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLATKHDLLELR
Ga0173480_1070016923300015200SoilMQAESLEVLEKADVAPVQARAIVRAIEIEIAGAKDTLATKHDLLL
Ga0134073_1008049913300015356Grasslands SoilMPVQAASLEILEKANVPAPQARAIVQAIEIEIAGAKETLATK
Ga0134072_1000551613300015357Grasslands SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRH
Ga0182040_1054306633300016387SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTL
Ga0187809_1033161323300017937Freshwater SedimentVAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDGLILR
Ga0187780_1019063623300017973Tropical PeatlandMAVQAASLEVLEKAAVPPAQARAIVQAIEIEIAGASNTLATKQDVLILRHEMAELR
Ga0187780_1140584023300017973Tropical PeatlandMAVQPESLEVLEKANVPPAQARAIVRAIEIEIDGSKNTLATKHDLQLLRQEL
Ga0187782_1125455613300017975Tropical PeatlandMPVQSASLEILEKAAVPPAQARAIVQAIEIEIAGSKETLATKQDVLILRHELRHEM
Ga0187772_1004837013300018085Tropical PeatlandMAVQAASLEILEKANVPPAQARAFVQAIEIEIAGAR
Ga0187774_1039170943300018089Tropical PeatlandMQAESLEVLEKADVPPAQARAIVRAIEIELAGAKDTLATKHDLLLHRQDFLQETGKL
Ga0066655_1076569623300018431Grasslands SoilMAVQAASLEILEKADVPPAQARAIVQAMEIEIAGARDTLA
Ga0066667_1008199213300018433Grasslands SoilVQAASLEILEKADVPPAQARAIVQAMEIEIAGARDTLATKHDLLVL
Ga0066667_1114274223300018433Grasslands SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLIL
Ga0190270_1073486113300018469SoilMPMQAESLEVLESAAVAPAQARAIVRAIEIELAGAKDTLATKHDL
Ga0190274_1386608833300018476SoilMSMQAESLEVLEKADLAPAQARAIVRAIEIEIGSA
Ga0190271_1376445623300018481SoilMQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLATK
Ga0066669_1078394113300018482Grasslands SoilMSMQAASLKVLEKANLPAPQARAIVQAIEIELAGARDTLATKQDTLLLR
Ga0066669_1195943123300018482Grasslands SoilMSMQAASLEVLEKANLPAPQARAIVQAIEIELAGARDTLATKQDTLLLR
Ga0179592_1001467413300020199Vadose Zone SoilMSMQAASLEVLEKANLPPLQARAIVQAIEIEIAGARDTLA
Ga0210409_1059622523300021559SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGARDTLATRQRI
Ga0247686_103336713300024177SoilMAVQPASLEVLENAAVPPAQARRGQAIEIEIAGAKDTLATRQGML
Ga0247670_104474523300024283SoilMAVQPASLEVLENAVVPPAQARRGQAIEIEIAGAKDTLATRQGMLILRHEM
Ga0210075_106172813300025790Natural And Restored WetlandsMPMQGESLEVLERAEVPPAQARAIVRAIEIEIAGAK
Ga0207694_1174712513300025924Corn RhizosphereMAVHPESLEVLEKAAVPPMQARAIVQAIEIEIAGAQDVLATKQDLL
Ga0207644_1128958623300025931Switchgrass RhizosphereMSMQAESLEVLEKADVPPGQARAIVRAIEIELKSAKDT
Ga0207665_1120774423300025939Corn, Switchgrass And Miscanthus RhizosphereMAVQPASLEVLENAAVPPAQARRGQAIEIEIAGAKDTLATRQ
Ga0208291_107557023300026111Natural And Restored WetlandsMPMQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLATKR
Ga0209153_101701743300026312SoilMAVQPASLELLEKAAVPPAQARAIVQAIEIEIAGAKEILATKQDILILRHE
Ga0209268_106041033300026314SoilMPVQAASLEILEKANVPAPQARAIVQAIEIEIAGAKETL
Ga0209686_105244813300026315SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKD
Ga0209155_118874313300026316SoilMFMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDALATKQNT
Ga0209471_132855213300026318SoilMSMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDTLATKQDTLLLRQDIA
Ga0209152_1000198613300026325SoilMSMQAASLEVLEKANLPAPQARAIVQAIEIEIAGARDTLATKQDTLLLRQD
Ga0209808_118413423300026523SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGA
Ga0209160_119864923300026532SoilVQAASLEILEKADVPPAQARAIVQAIEIEIAGARDTLATKHDLLVLRNELSE
Ga0209056_10006991133300026538SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRHEIA
Ga0209805_102741213300026542SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIEIAGAKDTLATKQDILILR
Ga0209805_131617013300026542SoilMAVQAASLEILEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDVLILRHEIAELRTEL
Ga0179587_1010689933300026557Vadose Zone SoilMQAASLEVLEKANLPPLQARAIVQAIEIEIAGARDTLATKQDVV
Ga0209706_1029580923300027818Freshwater SedimentMQAESLAVLEKTSVAPAQARAMVRAIEIEIAGANDTLATKQDV
Ga0302225_1032485733300028780PalsaLSAMLAASLDILEKAQVPPLQARAIVQAIELELVAQHDVLATKQDLAL
Ga0247825_1014777243300028812SoilMPMQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLATKRDLDLLRSSLRNRSR
Ga0299907_1076332213300030006SoilMQAESLEVLEKASVAPAQARAFVRAIEIEIAGAKDTLATKHDLLLL
Ga0307505_1028028613300031455SoilMPMQAESLEILEKASVVPAQARAIVRAIEIEIAGAKDTLATKHDILVLQQRMDALGVEL
Ga0307505_1042749513300031455SoilMPMQAESLEVLEKASVAPALARAIVRAIEIEIAGAKDTLATKHDILVLRQ
Ga0318515_1038712823300031572SoilVTMQAASLEILEKAALPPAQARAIVQAIEIAGAKDTLATKHDM
Ga0310915_1115896223300031573SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLILRHEMAELRTELR
Ga0318555_1072416123300031640SoilVTMQAASLEILEKAALPPAQARAIVQAIEIAGAKDTLATKHDMLLL
Ga0307469_1116286923300031720Hardwood Forest SoilMPMQAESLEVLEKADVPPAQARAIVRAIELEIAGAKDTLAT
Ga0318502_1101111213300031747SoilVTMQAASLEILEKAALPPVQARAIVQAIEIAGAKDTLATKHDVLLLRHE
Ga0318509_1041100113300031768SoilVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLILRHEMA
Ga0318546_1030016623300031771SoilVQHALLEVLEKAAVPPAQARAIVRAIEIEIAGASETLATKQDML
Ga0318566_1034480113300031779SoilMQAASLEILEKAALPPAQARAIVQAIEIAGAKDTLATKHDMLL
Ga0318547_1021766013300031781SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLIL
Ga0318550_1036942313300031797SoilMTAMQAESLEVLEKADVAPAQARAIVRAIEIEIAGAKDVLA
Ga0318568_1061057613300031819SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAK
Ga0318517_1020799313300031835SoilVTMQAASLEILEKAALPPAQARAIVQAIEIAGAKDTLATKHDVLLLR
Ga0318495_1040142323300031860SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGARDTLA
Ga0306919_1018941313300031879SoilMAVQPASLELLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLILRHEMA
Ga0306925_1200471623300031890SoilVPMQAESLEVLERANVVPAQARAIVRAIEIEITGARDSLATKHDLLMLGQQF
Ga0318536_1031218313300031893SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGARDTLATKQD
Ga0306921_1040986513300031912SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLILR
Ga0310916_1020825643300031942SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLAT
Ga0310916_1063112613300031942SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGARDTLATKQDMLILRHEMAELRA
Ga0310913_1053714023300031945SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGARDTLATKQDMLILRHEMAELRAEL
Ga0310913_1076893823300031945SoilMQAESLEVLEKADVAPAQARAIVRAIEIEIAGASDTLATKRDVLE
Ga0310910_1025279233300031946SoilVTMQAASLEILEKAALPPAQARAIVQAIEIAGAKDTLATKHDMLLLRHEVTEKLGELR
Ga0306926_1041422143300031954SoilMAVQPASLELLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLILRHEMAELRTELRQEM
Ga0306926_1150507313300031954SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLILRHEMA
Ga0307479_1055984413300031962Hardwood Forest SoilMSMQAASLEVLEKAKVPSPQARAIVQAIEIEIAAAGN
Ga0318531_1015484113300031981SoilMAVQPASLEVLEKAAVPAAQARAIVQAIEIEIAGAR
Ga0310903_1037682913300032000SoilMPMQAESLEVLEKASVAPAQARAIVRAIEIEIAGAKDTLATKRDLDLLRGEIA
Ga0306922_1097965233300032001SoilVPMQAESLEVLEKADIVPAQARAIVRAIEIEIDGAKDSLATKHDLLLLGQQFH
Ga0307416_10196353513300032002RhizosphereMPMQAESLEVLEKAEVAPVQARAIVRAIEIEIAGAKDTLSTKHDLLTLENRL
Ga0318559_1062666613300032039SoilMTAMQAESLEVLEKADVAPAQARAIVRAIEIEIAGA
Ga0318533_1116457213300032059SoilMAVQPTSLEVLEKAAVPPAQARAIVQAIEIEIAGARDTLAT
Ga0318505_1010405523300032060SoilVGLGACANALLEVLEKAAVPPAQARAIVRAIEIEIAGASETLATKQDMLILR
Ga0318504_1038928223300032063SoilMQAASLEILEKAALPPAQARAIVQAIEIAGAKDTLATKHDMLLLRHE
Ga0318553_1055290413300032068SoilVTMQAASLEILEKAALPPAQARAIVQAIEIAGAKDTLATKHD
Ga0318525_1048565313300032089SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLILRHEMAELRGGL
Ga0318518_1028127413300032090SoilMAVQPASLEVLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQD
Ga0318518_1068022613300032090SoilVTMQAASLEILEKAALPPAQARAIVQAIEIAGAKDTLATKHDMLLLRHEVTEKLG
Ga0315910_1100599723300032144SoilMSMQAESLDVLEKASVAPAQARAIVRAIEIEIAGAKDTLAT
Ga0315910_1105154223300032144SoilMQAQSLEVLEKASVAPAQARAIVRAIEIELVGAPETLATKNGLAVLDVGLR
Ga0315912_1018294423300032157SoilMQAESLEVLERASVAPTQARAIVRAIEIEIAGAKDALATKP
Ga0315912_1062815923300032157SoilMPMQAESLEVLEGADVAPAQARAIVRAIEIEIAGAKNV
Ga0307470_1076163713300032174Hardwood Forest SoilMPMQAESLEVLEKASVAPAQARAIVRAIEIELAGAKDTLATKHDLTEL
Ga0307470_1161489023300032174Hardwood Forest SoilMRMQAESLEVLEKADASPALARAIVRAIEIELGAQDTLA
Ga0335082_1053233113300032782SoilMQAESLEVLEKADVALAQARAFVRAIEIEIAGAKDTLATKQDLLLLKQDLLSLRQEL
Ga0335079_1102592623300032783SoilVQPASLEVLEKAAVPPVQARAIVQAIEIEIAGAKETLATKQDVLILRYEI
Ga0335080_1183267623300032828SoilMAVQAASLEILERAEFPAPQARAIVQAIELEISGAKETL
Ga0335074_1031725133300032895SoilMSVQADSLEILEKAGVSSPQARAIVRAIEIELDGAKDTLATKHDVLALRQEMSE
Ga0310914_1122037523300033289SoilMAVQPASLELLEKAAVPPAQARAIVQAIEIEIAGAKDTLATKQDMLILRHEMAEL
Ga0326726_1020733743300033433Peat SoilMPMQIESLEVLEKADVAPAQARAIVRAIEIEIAGARDTLATKQDLAP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.