| Basic Information | |
|---|---|
| Family ID | F037142 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VSESYHYDRIEDRDKAAVDRPKRPWEVAGKEAAVAAKKGRA |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.19 % |
| % of genes near scaffold ends (potentially truncated) | 97.62 % |
| % of genes from short scaffolds (< 2000 bps) | 90.48 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.119 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.214 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.595 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF13474 | SnoaL_3 | 15.48 |
| PF13456 | RVT_3 | 8.93 |
| PF14559 | TPR_19 | 7.14 |
| PF14534 | DUF4440 | 6.55 |
| PF13432 | TPR_16 | 2.98 |
| PF01544 | CorA | 2.98 |
| PF13414 | TPR_11 | 2.38 |
| PF00933 | Glyco_hydro_3 | 2.38 |
| PF12850 | Metallophos_2 | 1.79 |
| PF00374 | NiFeSe_Hases | 1.19 |
| PF00291 | PALP | 1.19 |
| PF01261 | AP_endonuc_2 | 1.19 |
| PF01551 | Peptidase_M23 | 1.19 |
| PF07238 | PilZ | 1.19 |
| PF03144 | GTP_EFTU_D2 | 0.60 |
| PF13407 | Peripla_BP_4 | 0.60 |
| PF00009 | GTP_EFTU | 0.60 |
| PF04366 | Ysc84 | 0.60 |
| PF00069 | Pkinase | 0.60 |
| PF07676 | PD40 | 0.60 |
| PF02517 | Rce1-like | 0.60 |
| PF13181 | TPR_8 | 0.60 |
| PF08338 | DUF1731 | 0.60 |
| PF02782 | FGGY_C | 0.60 |
| PF13517 | FG-GAP_3 | 0.60 |
| PF04389 | Peptidase_M28 | 0.60 |
| PF02224 | Cytidylate_kin | 0.60 |
| PF13155 | Toprim_2 | 0.60 |
| PF12895 | ANAPC3 | 0.60 |
| PF13620 | CarboxypepD_reg | 0.60 |
| PF00596 | Aldolase_II | 0.60 |
| PF03712 | Cu2_monoox_C | 0.60 |
| PF10978 | DUF2785 | 0.60 |
| PF00155 | Aminotran_1_2 | 0.60 |
| PF03309 | Pan_kinase | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 2.98 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.38 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 2.38 |
| COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 1.19 |
| COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 1.19 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.60 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.60 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 0.60 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.60 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.12 % |
| Unclassified | root | N/A | 14.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M102JR095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 2199352024|deeps_contig44362.27844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 600 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101359031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1381 | Open in IMG/M |
| 3300001976|JGI24752J21851_1018673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 904 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100771808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 841 | Open in IMG/M |
| 3300005180|Ga0066685_11144322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300005337|Ga0070682_100828271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 754 | Open in IMG/M |
| 3300005434|Ga0070709_10407657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1016 | Open in IMG/M |
| 3300005536|Ga0070697_100679603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 908 | Open in IMG/M |
| 3300005537|Ga0070730_10647438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300005541|Ga0070733_10735194 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005841|Ga0068863_101191582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 767 | Open in IMG/M |
| 3300006028|Ga0070717_10457777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300006028|Ga0070717_10548725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300006052|Ga0075029_100069157 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300006052|Ga0075029_100107175 | Not Available | 1683 | Open in IMG/M |
| 3300006052|Ga0075029_101141185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300006162|Ga0075030_100002242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 17540 | Open in IMG/M |
| 3300006794|Ga0066658_10820055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300006880|Ga0075429_100747174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300009029|Ga0066793_10542887 | Not Available | 663 | Open in IMG/M |
| 3300009089|Ga0099828_11615247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300009137|Ga0066709_102814493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300009518|Ga0116128_1214462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300009519|Ga0116108_1218842 | Not Available | 557 | Open in IMG/M |
| 3300009520|Ga0116214_1289668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300009521|Ga0116222_1164550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300009522|Ga0116218_1036616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2212 | Open in IMG/M |
| 3300009524|Ga0116225_1083023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1499 | Open in IMG/M |
| 3300009545|Ga0105237_10864194 | Not Available | 911 | Open in IMG/M |
| 3300009551|Ga0105238_12889771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300009784|Ga0123357_10957194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300010048|Ga0126373_11461949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300010048|Ga0126373_13084166 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010361|Ga0126378_12184432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300010362|Ga0126377_11814473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300010376|Ga0126381_101970326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300010397|Ga0134124_11066439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300011120|Ga0150983_10181612 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300011269|Ga0137392_10959467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300012201|Ga0137365_11235457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300012208|Ga0137376_10188148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1784 | Open in IMG/M |
| 3300012211|Ga0137377_11803925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300012351|Ga0137386_10749198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300012353|Ga0137367_10869807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300012356|Ga0137371_11115573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012363|Ga0137390_10031755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5038 | Open in IMG/M |
| 3300012469|Ga0150984_111638596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1996 | Open in IMG/M |
| 3300012469|Ga0150984_120146702 | Not Available | 609 | Open in IMG/M |
| 3300012924|Ga0137413_11479679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012925|Ga0137419_10868064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300012927|Ga0137416_11724317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012948|Ga0126375_10306393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300012971|Ga0126369_10891648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
| 3300012975|Ga0134110_10542146 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300013297|Ga0157378_11596478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300013306|Ga0163162_10004993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12784 | Open in IMG/M |
| 3300014169|Ga0181531_10363751 | Not Available | 888 | Open in IMG/M |
| 3300014501|Ga0182024_10400233 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
| 3300015051|Ga0137414_1153236 | Not Available | 4327 | Open in IMG/M |
| 3300015241|Ga0137418_10586988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300016445|Ga0182038_12134947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300017659|Ga0134083_10366034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300017924|Ga0187820_1208909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300017924|Ga0187820_1337340 | Not Available | 501 | Open in IMG/M |
| 3300017933|Ga0187801_10478645 | Not Available | 525 | Open in IMG/M |
| 3300017943|Ga0187819_10306941 | Not Available | 922 | Open in IMG/M |
| 3300017955|Ga0187817_10306847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1012 | Open in IMG/M |
| 3300017955|Ga0187817_10911254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300017961|Ga0187778_10432398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300017961|Ga0187778_11078288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300017966|Ga0187776_10634137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300017973|Ga0187780_10149501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1620 | Open in IMG/M |
| 3300017975|Ga0187782_10259615 | Not Available | 1307 | Open in IMG/M |
| 3300017975|Ga0187782_10743320 | Not Available | 757 | Open in IMG/M |
| 3300017999|Ga0187767_10126116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 741 | Open in IMG/M |
| 3300018012|Ga0187810_10397916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300018035|Ga0187875_10231271 | Not Available | 1013 | Open in IMG/M |
| 3300018037|Ga0187883_10242370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300018038|Ga0187855_10577688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300018047|Ga0187859_10263525 | Not Available | 927 | Open in IMG/M |
| 3300018061|Ga0184619_10024730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2493 | Open in IMG/M |
| 3300018090|Ga0187770_10162561 | Not Available | 1706 | Open in IMG/M |
| 3300018431|Ga0066655_10605113 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300018468|Ga0066662_11877035 | Not Available | 627 | Open in IMG/M |
| 3300018468|Ga0066662_12483924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300018482|Ga0066669_10919752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300019275|Ga0187798_1502873 | Not Available | 556 | Open in IMG/M |
| 3300020021|Ga0193726_1058033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1828 | Open in IMG/M |
| 3300020581|Ga0210399_10365088 | Not Available | 1205 | Open in IMG/M |
| 3300020582|Ga0210395_10766920 | Not Available | 720 | Open in IMG/M |
| 3300020583|Ga0210401_10223768 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300021168|Ga0210406_10189774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1709 | Open in IMG/M |
| 3300021170|Ga0210400_11230045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 602 | Open in IMG/M |
| 3300021171|Ga0210405_10083259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2522 | Open in IMG/M |
| 3300021171|Ga0210405_11251550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300021178|Ga0210408_10433879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1046 | Open in IMG/M |
| 3300021180|Ga0210396_10015676 | All Organisms → cellular organisms → Bacteria | 7044 | Open in IMG/M |
| 3300021180|Ga0210396_10578168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 978 | Open in IMG/M |
| 3300021403|Ga0210397_10208118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1401 | Open in IMG/M |
| 3300021404|Ga0210389_11169505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300021405|Ga0210387_10474349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1111 | Open in IMG/M |
| 3300021420|Ga0210394_11348150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300021433|Ga0210391_10780157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300021433|Ga0210391_11370731 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300021474|Ga0210390_10538619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 982 | Open in IMG/M |
| 3300021478|Ga0210402_10928474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300021478|Ga0210402_11784206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300021479|Ga0210410_10257829 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300021559|Ga0210409_10662640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300021559|Ga0210409_10888067 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300022557|Ga0212123_10095628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2444 | Open in IMG/M |
| 3300024330|Ga0137417_1066165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2322 | Open in IMG/M |
| 3300025454|Ga0208039_1041131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300025459|Ga0208689_1088560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300025899|Ga0207642_10390858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300025914|Ga0207671_10602050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300025922|Ga0207646_10128619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2279 | Open in IMG/M |
| 3300025924|Ga0207694_11786087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300025932|Ga0207690_11353235 | Not Available | 595 | Open in IMG/M |
| 3300025939|Ga0207665_11672836 | Not Available | 504 | Open in IMG/M |
| 3300025944|Ga0207661_11593474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300026075|Ga0207708_11318896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300026305|Ga0209688_1020869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1267 | Open in IMG/M |
| 3300026469|Ga0257169_1067613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300026557|Ga0179587_10562732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300027065|Ga0208489_1013223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300027609|Ga0209221_1024050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1618 | Open in IMG/M |
| 3300027619|Ga0209330_1048759 | Not Available | 967 | Open in IMG/M |
| 3300027826|Ga0209060_10392099 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027867|Ga0209167_10263202 | Not Available | 928 | Open in IMG/M |
| 3300027867|Ga0209167_10787671 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027875|Ga0209283_10680525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300027905|Ga0209415_11142094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300027911|Ga0209698_10300043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
| 3300027915|Ga0209069_10571290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300028036|Ga0265355_1004910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1019 | Open in IMG/M |
| 3300028808|Ga0302228_10137444 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300028879|Ga0302229_10221081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300028882|Ga0302154_10373783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300028884|Ga0307308_10546165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300029636|Ga0222749_10183414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1038 | Open in IMG/M |
| 3300029982|Ga0302277_1341988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 535 | Open in IMG/M |
| 3300030503|Ga0311370_10425259 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300030506|Ga0302194_10101675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1277 | Open in IMG/M |
| 3300030687|Ga0302309_10224580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300030706|Ga0310039_10292631 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031010|Ga0265771_1028681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300031446|Ga0170820_12966970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
| 3300031708|Ga0310686_101765617 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300031708|Ga0310686_112412593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300031708|Ga0310686_115142883 | Not Available | 1046 | Open in IMG/M |
| 3300031720|Ga0307469_10937604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 804 | Open in IMG/M |
| 3300031753|Ga0307477_10175792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1492 | Open in IMG/M |
| 3300031910|Ga0306923_10168938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2498 | Open in IMG/M |
| 3300032160|Ga0311301_10291772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2625 | Open in IMG/M |
| 3300032180|Ga0307471_100281486 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300032261|Ga0306920_103263023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300032515|Ga0348332_13904643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300032805|Ga0335078_10060346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5572 | Open in IMG/M |
| 3300032805|Ga0335078_10449256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1674 | Open in IMG/M |
| 3300032828|Ga0335080_12059293 | Not Available | 551 | Open in IMG/M |
| 3300032829|Ga0335070_11005565 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300032892|Ga0335081_11180894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300032893|Ga0335069_12359251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300032955|Ga0335076_10032834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5207 | Open in IMG/M |
| 3300033134|Ga0335073_10441818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300033402|Ga0326728_10604016 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.19% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.19% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.60% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.60% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.60% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.60% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027065 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_05537840 | 2189573001 | Grass Soil | SYHYDRIEDRDKAAIDRPKRPWEVAGKAAAVAAKKGRA |
| deeps_00084410 | 2199352024 | Soil | LGTVSESYQYDRVVGRDKPAVDRPKRPWERARAAVATKKSARK |
| INPhiseqgaiiFebDRAFT_1013590311 | 3300000364 | Soil | SLGTVSESYHYDRIENRDKPVLDRPKRPWEVAGKPAAAAAKKGRA* |
| JGI24752J21851_10186731 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | LGTVSESYHYDRVKDRDXAQADRPKRPWQAAAAGAPAKKNPA* |
| JGIcombinedJ26739_1007718083 | 3300002245 | Forest Soil | GTVSDSYQYDRVKDRDEAVVDRPKRPWETAGKQAAVAAKKGRA* |
| Ga0066685_111443221 | 3300005180 | Soil | TVSESYQYDRIEDRDKPKAERRKRPWEVAGVVATTAATKKGRA* |
| Ga0070682_1008282712 | 3300005337 | Corn Rhizosphere | ESLGTVSESYQYDRIKDRDKAAADRPKRPWEKAGKLNAAAAKKGRA* |
| Ga0070709_104076573 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SLGTVSESYQYDRIKDRDKAAADRPKRPWEKAGKLNAAAAKKGRA* |
| Ga0070697_1006796033 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TVSESYHYDRIQDRDKPWAERPKRPWEVARVVTTKSKKTRA* |
| Ga0070730_106474382 | 3300005537 | Surface Soil | SLGTVSESYHYDRIENRDKASVDRPKRPWEVAGKPAAIAAKKGRA* |
| Ga0070733_107351941 | 3300005541 | Surface Soil | DRIENRDKPVAARPKRPWEKAGVMAAAAAKKGRA* |
| Ga0068863_1011915821 | 3300005841 | Switchgrass Rhizosphere | SESYHYDRIKDRDKPAAERPKRPWEKAGATAAAKKGRA* |
| Ga0070717_104577771 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GTVSESYQYDRIEDRDKPKAERRKRPWEVAGVVATTAATKKGRA* |
| Ga0070717_105487253 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YDRVEDRDKKATDRPKRPWEVAGAAAVLAAKKGRA* |
| Ga0075029_1000691573 | 3300006052 | Watersheds | TVSESYHYDRIENRDKPAVERPKRPWEVAGKQAAVAAKKGRA* |
| Ga0075029_1001071752 | 3300006052 | Watersheds | YDRIENRDKAAVDRPKRPWEVAGKEAAVAAKKGRA* |
| Ga0075029_1011411853 | 3300006052 | Watersheds | SEAYQYDRIVDRDKPAVDRPKRPWEVAGKTAAVAAKKGRA* |
| Ga0075030_1000022421 | 3300006162 | Watersheds | YHYDRIENRDKPAVERPKRPWEVAGKQAAAATKKGRA* |
| Ga0066658_108200551 | 3300006794 | Soil | TVSESYQYDRIVDRDKPKASRKKRPWEVAGAAVAKTVKKTRG* |
| Ga0075429_1007471742 | 3300006880 | Populus Rhizosphere | TVSESYHYDRVKDRDKAQPDRPKRPWQTAAAAAAPAKKNPA* |
| Ga0066793_105428873 | 3300009029 | Prmafrost Soil | SLGTVSESYHYDRIENRDKAAVDRPKRPWEVAGRQAAVAAKKGRA* |
| Ga0099828_116152471 | 3300009089 | Vadose Zone Soil | TVSDSYQYDRIENRDKPAEERPKRPWEKADAMAAAAKKSKA* |
| Ga0066709_1028144931 | 3300009137 | Grasslands Soil | QYDRIVDRDKPAAERPKRPWEKIRAAAAGKKSRA* |
| Ga0116128_12144621 | 3300009518 | Peatland | LGTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVASKAAAAKKGRA* |
| Ga0116108_12188421 | 3300009519 | Peatland | GTVSESYHYDRIENRDKAAVDRPKRPWEVAGKEAAVAAKKGRA* |
| Ga0116214_12896682 | 3300009520 | Peatlands Soil | SLGTVSESYQYDSIENRDKPVTERPKRPWEKAGVMAVAAAKKSRA* |
| Ga0116222_11645503 | 3300009521 | Peatlands Soil | YHYDRIEDRDKPAVDRPKRPWEVAGKAGAAVAKKGRA* |
| Ga0116218_10366161 | 3300009522 | Peatlands Soil | SLGTVSESYHYDRIEDRDKPAVDRPKRPWEVAGKQAAVAAKKGRA* |
| Ga0116225_10830234 | 3300009524 | Peatlands Soil | DRIEDRDKPAVDRPKRPWEVAGKAGAAVAKKGRA* |
| Ga0105237_108641941 | 3300009545 | Corn Rhizosphere | YDRVEDRDKPVVERPKRPWEVSGKKAVAAKKGRA* |
| Ga0105238_128897712 | 3300009551 | Corn Rhizosphere | GTVSESYHYDRVKDRDRAQADRPKRPWQAAAAGAPAKKNPA* |
| Ga0123357_109571941 | 3300009784 | Termite Gut | TVSESYHYDRLEDRDKPAVDRPKRPWEVAGKAVVVAAKKGRA* |
| Ga0126373_114619491 | 3300010048 | Tropical Forest Soil | SESYHYDRIENRDQPAVDRPKRPWEVAGKEAAAAAKKGRA* |
| Ga0126373_130841662 | 3300010048 | Tropical Forest Soil | VSESYHYDRIVDRDKPAVDRPKRPWAVAGKEAAAAAKKGRA* |
| Ga0126378_121844322 | 3300010361 | Tropical Forest Soil | HYDRIENRDKPAVDRPKRPWEVAGKENAVAAKKGRA* |
| Ga0126377_118144733 | 3300010362 | Tropical Forest Soil | YDRVVDRDKPSPERPKRPWEVAGSKAKAAKKSRA* |
| Ga0126381_1019703262 | 3300010376 | Tropical Forest Soil | EAYHYDRIQDRDKPQTDRPKRPWDMAGKAIAAKKGRA* |
| Ga0134124_110664391 | 3300010397 | Terrestrial Soil | QYDRVKDRDKPATEKPKRPWEVAGKGTAKAAKKGRA* |
| Ga0150983_101816121 | 3300011120 | Forest Soil | ALGTVSESYHYDRIEDRDKATVDRPKRPWETAGKAAAAGKKGRA* |
| Ga0137392_109594671 | 3300011269 | Vadose Zone Soil | HYDRIKDRDKAPVDRPKRPWEVAGKAVSAKAVAAKKGRG* |
| Ga0137365_112354572 | 3300012201 | Vadose Zone Soil | YQYDRIVDRDKPAAERPKRPWEKIRAAAAGKKSRA* |
| Ga0137376_101881484 | 3300012208 | Vadose Zone Soil | VSESYQYDRVEDRDKKPTDRPKRPWEVAGAAAALAAKKGRA* |
| Ga0137377_118039252 | 3300012211 | Vadose Zone Soil | RIEDRDKPKAERRKRPWEVAGVVATTTAATKKGRA* |
| Ga0137386_107491982 | 3300012351 | Vadose Zone Soil | ESYHYDRIQDRDKPWAERPKRPWEVARVVTTKSKKSRA* |
| Ga0137367_108698072 | 3300012353 | Vadose Zone Soil | GTVSESYQYDRIENRDKPPVERPKRPWEVAGKAAAAAKKGRA* |
| Ga0137371_111155731 | 3300012356 | Vadose Zone Soil | LGTVSESYQYDRIEDRDKPKGERRKRPWEVAGVVATTAATKKGRA* |
| Ga0137390_100317557 | 3300012363 | Vadose Zone Soil | QYDRVEDRDKKATDRPKRPWEVAGAAAVLAAKKGRA* |
| Ga0150984_1116385961 | 3300012469 | Avena Fatua Rhizosphere | QYDRVEDRDKPGIERPKRPWEVSGKRAAAAKKGRA* |
| Ga0150984_1201467022 | 3300012469 | Avena Fatua Rhizosphere | VSEAYQYDRVEDRDKPGIERPKRPWEVSGKRAAAAKKGRA* |
| Ga0137413_114796792 | 3300012924 | Vadose Zone Soil | SESYEYDRIKDRDKAPVDRPKRPWEVAGNAVTAKAAAAKKGRA* |
| Ga0137419_108680642 | 3300012925 | Vadose Zone Soil | ESYQYDRVENRDKPAVDRPKRPWEVAGKAAAAKKGRA* |
| Ga0137416_117243172 | 3300012927 | Vadose Zone Soil | YQYDRVEDRDKKATDRPKRPWEVAGAAAVLAAKKGRA* |
| Ga0126375_103063932 | 3300012948 | Tropical Forest Soil | GTVSESYHYDRIEDRDKFVVERPKRPWEVAGKQAVAAKKGRA* |
| Ga0126369_108916482 | 3300012971 | Tropical Forest Soil | YDRIENRDKPAVDRPKRPWEVAGKEAAVAAKKGRA* |
| Ga0134110_105421461 | 3300012975 | Grasslands Soil | VSEAYQYDRIADRDKPAAERPKRPWEKAQAAAASKKSRA* |
| Ga0157378_115964781 | 3300013297 | Miscanthus Rhizosphere | YDRIKDRDKPKAERPKRPWEKAGLTAATAKKGRA* |
| Ga0163162_1000499313 | 3300013306 | Switchgrass Rhizosphere | SEAYQYDRVKDRDKPTTEKPKRPWEVAGKDSAKAAKKGRA* |
| Ga0181531_103637512 | 3300014169 | Bog | SESYHYDRIEDRDKAAVDRPKRPWEVAGKGAAVAAKKGRA* |
| Ga0182024_104002331 | 3300014501 | Permafrost | YDRVKDRDTPEAARPKRPWEVAGAKTATVAKKGRA* |
| Ga0137414_11532364 | 3300015051 | Vadose Zone Soil | LVPVSESYQYDRIKDRDKPTADRPKRPWEKVGKLNAAAAKKGRA* |
| Ga0137418_105869882 | 3300015241 | Vadose Zone Soil | SYEYDRVVDRDKAQPERPKRPWEVAGKAAAAKKGRA* |
| Ga0182038_121349472 | 3300016445 | Soil | YHYDRIENRDKPAVERPKRPWEVAGKQAVAAKKGRA |
| Ga0134083_103660342 | 3300017659 | Grasslands Soil | SYHYDRIQDRDKPWAERPKRPWEIARVVTTKSKKSRA |
| Ga0187820_12089092 | 3300017924 | Freshwater Sediment | SLGTVSESYHYDRIKDRDKAPVDRPKRPWEVAGKAVAAKKGRA |
| Ga0187820_13373402 | 3300017924 | Freshwater Sediment | GTVSESYQYDRVEDRDKPAVERPKRPWEVSGKKAVAAKKGRA |
| Ga0187801_104786451 | 3300017933 | Freshwater Sediment | LGTVSESYHYDRVENRDKPTVDRPKRPWEVAGKRAVAAKKGRA |
| Ga0187819_103069412 | 3300017943 | Freshwater Sediment | YDRIENRDKPAVDRPKRPWEVAGKEAAVAAKKGRA |
| Ga0187817_103068471 | 3300017955 | Freshwater Sediment | TVSDSYHYDRLKDDDKAPVDRPKRPWEVVGKAVAVKKGRA |
| Ga0187817_109112542 | 3300017955 | Freshwater Sediment | VSEAYQYDRIENRDKPVAERPKRPWERAGAMAAAAAKKSPA |
| Ga0187778_104323981 | 3300017961 | Tropical Peatland | TVSEVYHYDRILDRDKPQAERPKRPWERAEQLTAAAAKKNPA |
| Ga0187778_110782881 | 3300017961 | Tropical Peatland | SLGTVSESYHYDRIVDRDKPAVERPKRPWEVAGKEAAVAVKKGRA |
| Ga0187776_106341371 | 3300017966 | Tropical Peatland | EVYHYDRIEDRDKPQAERRKRPWERAEGVSAAAAKKSPA |
| Ga0187780_101495013 | 3300017973 | Tropical Peatland | SYHYDRIENRDKPAVERPKRPWEVAGKEAAAAAKKGRA |
| Ga0187782_102596151 | 3300017975 | Tropical Peatland | ESYHYDRIENRDQAEAERPKRPWEKAGAMAAAAMKKSRA |
| Ga0187782_107433201 | 3300017975 | Tropical Peatland | TVSESYHYDRVENRDTPAVDRPKRPWEVAGKRAVAAKKGRA |
| Ga0187767_101261161 | 3300017999 | Tropical Peatland | SLGTVSESYHYDRIENRDKPEAQRPKRPWEVAGAKSMAAAKKSRA |
| Ga0187810_103979161 | 3300018012 | Freshwater Sediment | LGTVSESYHYDRIENRDKPAADRPKRPWEKAGAMAAAVAKKSPA |
| Ga0187875_102312712 | 3300018035 | Peatland | YDRIENRDKAAVDRPKRPWEVAGKEAAVAAKKGRA |
| Ga0187883_102423701 | 3300018037 | Peatland | ESLGTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVAVKKGRA |
| Ga0187855_105776882 | 3300018038 | Peatland | SLGTVSESYHYDRIENRDEAAVDRPKRPWEVAGKQAAAAGKKGRA |
| Ga0187859_102635251 | 3300018047 | Peatland | TVSESYHYDRIENRDKPAADRPKRPWEKAGVIAAAAKKGRA |
| Ga0184619_100247301 | 3300018061 | Groundwater Sediment | DRIEDRDKPKAERRKRPWEVAGVVTTTASTKKGRA |
| Ga0187770_101625611 | 3300018090 | Tropical Peatland | TVSESYHYDRIENRDKAEAERPKRPWEKAGAMAAAAMKKSRA |
| Ga0066655_106051132 | 3300018431 | Grasslands Soil | DSYQYDRVENRDSPVADRPKRPWEKAEAAATAKSGSGKKRA |
| Ga0066662_118770351 | 3300018468 | Grasslands Soil | VSESYQYDRVEDRDKPTADRPKRPWEVSGKKAVAAKKGRA |
| Ga0066662_124839242 | 3300018468 | Grasslands Soil | DAYQYDRIEDRDKPKGERPKRPWEVEGARAAAAAKKSRV |
| Ga0066669_109197523 | 3300018482 | Grasslands Soil | QYDRIEDRDKPKAERRKRQWEVAGVVTTPAATKKGRA |
| Ga0187798_15028731 | 3300019275 | Peatland | TVSESYHYDRIADRDKAAVDRPKRPWEVAGKEVAAAAKKGRA |
| Ga0193726_10580334 | 3300020021 | Soil | ESYDYDRVLNRDKAPAEKPKRPWEKAGKLAAAVAKKGRA |
| Ga0210399_103650881 | 3300020581 | Soil | GTVSESYQYDRIENRDKAPVDRPKRPWEVAGKAAAAGAKKSRA |
| Ga0210395_107669201 | 3300020582 | Soil | YHYDRIKDADKAMVDRPKRPWEVAGKAVAGRAVAAKKGRA |
| Ga0210401_102237683 | 3300020583 | Soil | LGTVSESYHYDRIENRDKPTADRPKRPWEKAGVLAAAAKKGRA |
| Ga0210406_101897742 | 3300021168 | Soil | TVSESYHYDRIENRDKPTVDRPKRPWEVAGKPTAVAAKKGRA |
| Ga0210400_112300451 | 3300021170 | Soil | SLYNEPLGTVSESYQYDRIKDRDQPEVERPKRPWETVKAKVAAATKKGRA |
| Ga0210405_100832595 | 3300021171 | Soil | SESDHYDRIKDNDKAPVDRPKRPWEVAGRAVAAKKGRA |
| Ga0210405_112515501 | 3300021171 | Soil | ESYHYDRIENRDRPVVDRPKRPWEVAGKQAAVAAKKGRA |
| Ga0210408_104338793 | 3300021178 | Soil | VSESYHYDRIKDRDKPAAERPKRPWEKAGAVAAAAKKGRA |
| Ga0210396_100156761 | 3300021180 | Soil | LGTVSESYHYDRIENRDKPVLDRPKRPWEVGGKQAAVAAKKGRA |
| Ga0210396_105781682 | 3300021180 | Soil | SYHYDRIENRDKPAADRPKRPWEKAGVIAAAAKKGRA |
| Ga0210397_102081183 | 3300021403 | Soil | LGTVSEAYHYDRVKDNDKAPVDRPKRPWEVAVKPVAAKAVAAKKGRA |
| Ga0210389_111695051 | 3300021404 | Soil | TVSESYQYDRVVDRDKPAAEKPKRPWEVAGAKAAVAKKGRP |
| Ga0210387_104743493 | 3300021405 | Soil | SESYHYDRVENRDKPTADRPKRPWEKAGVLAAAAKKGRA |
| Ga0210394_113481502 | 3300021420 | Soil | YHYDRIKDRDKAPVDRPKRPWEVAGKAVVAKAVAAKKGRA |
| Ga0210391_107801571 | 3300021433 | Soil | GTVSDSYHYDRLKDDDKPPVDRPKRPWEVAGKAVAVKKGRA |
| Ga0210391_113707312 | 3300021433 | Soil | TVSESYHYDRIEDRDKAAVDRPKRPWEVAGKQAAVAAKKGRA |
| Ga0210390_105386191 | 3300021474 | Soil | VKDNDKPVVDRPKRPWEKVGSAVSTKAVAVKKGRA |
| Ga0210402_109284741 | 3300021478 | Soil | SESYQYDRIEDRDKAEVDRPKRPWEVAGKQAAIAAKKGRA |
| Ga0210402_117842062 | 3300021478 | Soil | ESYHYDRVENRDKPAAARPKRPWEKAGVIAAAVKKGRA |
| Ga0210410_102578294 | 3300021479 | Soil | GTVSESYHYDRIKDRDKAPLDRPKRPWEVAGKSVAAKKGRA |
| Ga0210409_106626401 | 3300021559 | Soil | ESYHYDRIKDRDKPAAERPKRPWEKAGAVAAAAKKGRA |
| Ga0210409_108880671 | 3300021559 | Soil | GTVSESYHYDRIENRDKPVAARPKRPWEKAGVMAAAAAKKGRA |
| Ga0212123_100956281 | 3300022557 | Iron-Sulfur Acid Spring | SESYQYDRIEDRDKAPVDRPKRPWEVAGKQAAIAAKKGRA |
| Ga0137417_10661651 | 3300024330 | Vadose Zone Soil | YQYDRVEDRDKKATDRPKRPWEVAGAAAVLAAKKGRA |
| Ga0208039_10411313 | 3300025454 | Peatland | LGTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVASKAAAAKKGRA |
| Ga0208689_10885601 | 3300025459 | Peatland | SDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVASKAAAAKKGRA |
| Ga0207642_103908581 | 3300025899 | Miscanthus Rhizosphere | SESYHYDRVKDRDKAQADRPKRPWQAAAAAAPAKKNPA |
| Ga0207671_106020502 | 3300025914 | Corn Rhizosphere | ESYQYDRIVDRDKPKASRKKRPWEVAGAAVAKTVKKTRG |
| Ga0207646_101286193 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SEAYQYDRIVDRDKPVPERPKRPWEKVQAAVAAKKSRI |
| Ga0207694_117860871 | 3300025924 | Corn Rhizosphere | LGTVSESYHYDRVKDRDRAQADRPKRPWQAAAAGAPAKKNPA |
| Ga0207690_113532352 | 3300025932 | Corn Rhizosphere | SESYQYDRIVDRDKPKASRKKRPWEVAGAAVAKTVKKTRG |
| Ga0207665_116728361 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SYHYDRIQDRDKPWAERPKRPWEVARVVTTKSKKSRA |
| Ga0207661_115934741 | 3300025944 | Corn Rhizosphere | SLGTVSESYQYDRIKDRDKAAADRPKRPWEKAGKLNAAAAKKGRA |
| Ga0207708_113188961 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | YDRVKDRDKPTTEKPKRPWEVAGKDSAKAAKKGRA |
| Ga0209688_10208691 | 3300026305 | Soil | TVSESYQYDRIEDRDKPKAERPKRPWEKAGTLAAAANKKGRA |
| Ga0257169_10676132 | 3300026469 | Soil | YQYDRIKDRDKPKAERPKRPWEKAGTLAAAAAKKGRA |
| Ga0179587_105627321 | 3300026557 | Vadose Zone Soil | SLGTVSESYQYDRIEDRDKAPVDRPKRPWEVVGKAVAAKAAAGKKGRA |
| Ga0208489_10132232 | 3300027065 | Forest Soil | LGTVSESYQYDRVENRDKPAAERPKRPWEKAGVMAAAAKKGRA |
| Ga0209221_10240504 | 3300027609 | Forest Soil | GTVSESYHYDRVKDHDKAPVDRPKRPWEVAGKAVAGKAVAAKKGRA |
| Ga0209330_10487591 | 3300027619 | Forest Soil | HYDRIENRDKPPVDRPKRPWEVAGKAAAVAAKKGRA |
| Ga0209060_103920991 | 3300027826 | Surface Soil | SESYQYDRIENRDKSVEARPKRPWEKAGVIAAAAKKGRA |
| Ga0209167_102632022 | 3300027867 | Surface Soil | LVTVSESYHYDRIENRDKPAPERPKRPWEKAGIPLAAVAKKSPA |
| Ga0209167_107876713 | 3300027867 | Surface Soil | SEAYQYDRIVGRDKPETERAKRPWEKAQAAAAPKKSRA |
| Ga0209283_106805252 | 3300027875 | Vadose Zone Soil | DSYQYDRIENRDKPAEERPKRPWEKADAMAAAAKKSKA |
| Ga0209415_111420941 | 3300027905 | Peatlands Soil | ESYHYDRIQDRDKAPVDRPKRPWEVAGKAVGAKAVAAKKGRA |
| Ga0209698_103000432 | 3300027911 | Watersheds | SLGTVSESYHYDRIENRDKPVVDRPKRPWEVAGKQAAVAAKKGRA |
| Ga0209069_105712902 | 3300027915 | Watersheds | VSESYHYDRIEDRDKPKAERPKRPWEKAGTLAAAAAKKGRA |
| Ga0265355_10049101 | 3300028036 | Rhizosphere | LGTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAATVKAVAAQKGRA |
| Ga0302228_101374441 | 3300028808 | Palsa | YHYDRIEDRDKAVVDRPKRPWEVAGKGAAVAAKKGRA |
| Ga0302229_102210813 | 3300028879 | Palsa | SYHYDRVKDNDKAPVDRPKRPWEVAGKPVAAKAVAAKKGRA |
| Ga0302154_103737831 | 3300028882 | Bog | DSYHYDRLKDDDKAPVDRPKRPWEVAGKAVAAKKGRA |
| Ga0307308_105461652 | 3300028884 | Soil | HYDRIQDRDKPKAERPKRPWEKAGTLSAAAAKKGRA |
| Ga0222749_101834143 | 3300029636 | Soil | VSEAYQYDRIEDRDKPAVQRPKRPWEVAGKPAVAAAKKGRA |
| Ga0302277_13419882 | 3300029982 | Bog | RIADRDKAPVDRPKRPWESAGKAVAAKAVAVKKGRA |
| Ga0311370_104252592 | 3300030503 | Palsa | LGTVSESYHYDRIEDRDKPVAGRPKRPWEVAGKPAAAAAKKGRA |
| Ga0302194_101016751 | 3300030506 | Bog | YHYDRLKDDDKAPVDRPKRPWEVAGKAATVKAVAAKKGRA |
| Ga0302309_102245802 | 3300030687 | Palsa | YDRLKDDDKAPVDRPKRPWEVAGKAVASKAVAAKKGRA |
| Ga0310039_102926311 | 3300030706 | Peatlands Soil | YDRIENRDKPATERPKRPWERAGAMAAAAAKKSPA |
| Ga0265771_10286812 | 3300031010 | Soil | GTVSDSYHYDRLKDDDKPPVDRPKRPWEVAGKTAAVKAAAAKKGRA |
| Ga0170820_129669701 | 3300031446 | Forest Soil | YQYDRIKDRDKPAADRPKRPWEKAGKLNAAAAKKGRA |
| Ga0310686_1017656171 | 3300031708 | Soil | VSESYHYDRVKDNDKAPVDRPKRPWEVAGKAAVVKAVAAKKGRA |
| Ga0310686_1124125931 | 3300031708 | Soil | ESLCTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAAAAKKGRA |
| Ga0310686_1151428831 | 3300031708 | Soil | NEALGTVSESYHYDRIEDRDKAVVDRPKRPWEVAGKAAVAAKKGRA |
| Ga0307469_109376043 | 3300031720 | Hardwood Forest Soil | DSYHYDRLKDDDKAPVDRPKRPWEVAGRAVAAKKGRA |
| Ga0307477_101757921 | 3300031753 | Hardwood Forest Soil | QYDRIEDRDKPATERPKRPWEKLGVAAVTVVKKKTRA |
| Ga0306923_101689385 | 3300031910 | Soil | YHYDRIEDRDKPQAERRKRPWERAEQLTAAAAKKNPA |
| Ga0311301_102917722 | 3300032160 | Peatlands Soil | VSESYHYDRIEDRDKAAVDRPKRPWEVAGKEAAVAAKKGRA |
| Ga0307471_1002814864 | 3300032180 | Hardwood Forest Soil | SYQYDRIENRDKPEADRPKRPWEKAGTLAAAAKKGRA |
| Ga0306920_1032630231 | 3300032261 | Soil | YHYDRIENRDQAALDRPKRPWEVAGKQAAIAAKKGRA |
| Ga0348332_139046431 | 3300032515 | Plant Litter | VSESYHYDRIEDRDKPAVDRPKRPWEVAGKQAVVAAKKGRA |
| Ga0335078_100603461 | 3300032805 | Soil | YQYDRVKDRDKPTVERPKRPWEVAGKQAIAAKKGRA |
| Ga0335078_104492561 | 3300032805 | Soil | GSVSESYHYDRIENRDKPAVDRPKRPWEVAGKETAVAAKKGRA |
| Ga0335080_120592931 | 3300032828 | Soil | YHYDRIENRDKPAAERPKRPWEKAGAIAAALAKKSPA |
| Ga0335070_110055651 | 3300032829 | Soil | SLGTVSESYQYDRIENRDKPATERPKRPWERAGVMAAAVAKKSPA |
| Ga0335081_111808942 | 3300032892 | Soil | SLGTVAEAYQYDRIENRDKPAVERPKRPWEVAGQQAAAAKKGRA |
| Ga0335069_123592511 | 3300032893 | Soil | DRIQERDKPVAERRKRPWEKAGAAVAAAIAKKSPA |
| Ga0335076_100328344 | 3300032955 | Soil | GTVAEAYQYDRIENRDKPAVERPKRPWEVAGRQAVAAKKGRA |
| Ga0335073_104418183 | 3300033134 | Soil | IKDRDKPTVERPKRPWEIAGSGAGGRAVAVKKGRG |
| Ga0326728_106040162 | 3300033402 | Peat Soil | YDRIENRDKAVVDRPKRPWEVAGKEAAVAAKKGRA |
| ⦗Top⦘ |