NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037136

Metagenome / Metatranscriptome Family F037136

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037136
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 40 residues
Representative Sequence MIFMRVYKHWLDYDVAALAFLIVGIAAVELIAIII
Number of Associated Samples 114
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.10 %
% of genes near scaffold ends (potentially truncated) 55.36 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.381 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.571 % of family members)
Environment Ontology (ENVO) Unclassified
(41.071 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.976 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.38%    β-sheet: 0.00%    Coil/Unstructured: 47.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF04392ABC_sub_bind 5.36
PF03401TctC 1.79
PF00582Usp 1.79
PF01384PHO4 1.19
PF07859Abhydrolase_3 1.19
PF00872Transposase_mut 1.19
PF00126HTH_1 0.60
PF04218CENP-B_N 0.60
PF01068DNA_ligase_A_M 0.60
PF07508Recombinase 0.60
PF00227Proteasome 0.60
PF14534DUF4440 0.60
PF00285Citrate_synt 0.60
PF14312FG-GAP_2 0.60
PF01202SKI 0.60
PF00248Aldo_ket_red 0.60
PF00005ABC_tran 0.60
PF00589Phage_integrase 0.60
PF08327AHSA1 0.60
PF04972BON 0.60
PF04191PEMT 0.60
PF02371Transposase_20 0.60
PF01609DDE_Tnp_1 0.60
PF13180PDZ_2 0.60
PF13432TPR_16 0.60
PF01321Creatinase_N 0.60
PF00106adh_short 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 5.36
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.79
COG0306Phosphate/sulfate permeaseInorganic ion transport and metabolism [P] 1.19
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 1.19
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 1.19
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.60
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.60
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.60
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 0.60
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.60
COG0372Citrate synthaseEnergy production and conversion [C] 0.60
COG3293TransposaseMobilome: prophages, transposons [X] 0.60
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.60
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.60
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 0.60
COG3547TransposaseMobilome: prophages, transposons [X] 0.60
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 0.60
COG5421TransposaseMobilome: prophages, transposons [X] 0.60
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.60
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.38 %
UnclassifiedrootN/A47.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FHA1B5K04XHS5HNot Available507Open in IMG/M
2088090014|GPIPI_17490720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2543Open in IMG/M
3300000550|F24TB_10418679Not Available675Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1036679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria762Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1075264Not Available512Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10122890Not Available633Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1013211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1571Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10055646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria876Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10122040Not Available544Open in IMG/M
3300000956|JGI10216J12902_104905471Not Available1089Open in IMG/M
3300000956|JGI10216J12902_107173486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3154Open in IMG/M
3300001867|JGI12627J18819_10360809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300002911|JGI25390J43892_10049313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7996Open in IMG/M
3300002914|JGI25617J43924_10266695Not Available583Open in IMG/M
3300004633|Ga0066395_10370213Not Available800Open in IMG/M
3300005178|Ga0066688_10263922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1104Open in IMG/M
3300005187|Ga0066675_10567117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria852Open in IMG/M
3300005332|Ga0066388_101393047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1217Open in IMG/M
3300005332|Ga0066388_104888557Not Available681Open in IMG/M
3300005332|Ga0066388_106103016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria608Open in IMG/M
3300005363|Ga0008090_15851748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300005436|Ga0070713_100655630Not Available1000Open in IMG/M
3300005436|Ga0070713_102471246Not Available502Open in IMG/M
3300005467|Ga0070706_100934094Not Available801Open in IMG/M
3300005713|Ga0066905_100813080All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300005713|Ga0066905_101905445Not Available550Open in IMG/M
3300005764|Ga0066903_100637863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1858Open in IMG/M
3300005764|Ga0066903_101691183All Organisms → cellular organisms → Bacteria → Proteobacteria1204Open in IMG/M
3300005764|Ga0066903_101818282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1164Open in IMG/M
3300005764|Ga0066903_102519468Not Available996Open in IMG/M
3300005764|Ga0066903_104432906Not Available749Open in IMG/M
3300005764|Ga0066903_104827415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium717Open in IMG/M
3300005764|Ga0066903_105121698Not Available694Open in IMG/M
3300005764|Ga0066903_105387601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300005764|Ga0066903_105598261All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005764|Ga0066903_107799050Not Available550Open in IMG/M
3300006049|Ga0075417_10199518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria947Open in IMG/M
3300006051|Ga0075364_10882141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300006797|Ga0066659_10671846All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300006844|Ga0075428_101926389Not Available614Open in IMG/M
3300006854|Ga0075425_101392002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium794Open in IMG/M
3300006904|Ga0075424_100280237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1773Open in IMG/M
3300007076|Ga0075435_101790354Not Available539Open in IMG/M
3300007255|Ga0099791_10607946Not Available535Open in IMG/M
3300009137|Ga0066709_103877218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300009792|Ga0126374_10110730Not Available1582Open in IMG/M
3300009792|Ga0126374_10153597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1399Open in IMG/M
3300009792|Ga0126374_10174065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1333Open in IMG/M
3300010043|Ga0126380_10685096Not Available821Open in IMG/M
3300010043|Ga0126380_11452162Not Available605Open in IMG/M
3300010043|Ga0126380_11601525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. HDIP04581Open in IMG/M
3300010046|Ga0126384_10456487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1092Open in IMG/M
3300010046|Ga0126384_10501885Not Available1046Open in IMG/M
3300010046|Ga0126384_10734199Not Available878Open in IMG/M
3300010048|Ga0126373_10930084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria934Open in IMG/M
3300010048|Ga0126373_11459819Not Available749Open in IMG/M
3300010358|Ga0126370_10743635Not Available867Open in IMG/M
3300010359|Ga0126376_10771487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium935Open in IMG/M
3300010361|Ga0126378_10330954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1631Open in IMG/M
3300010376|Ga0126381_101181126Not Available1106Open in IMG/M
3300010376|Ga0126381_101313266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1046Open in IMG/M
3300010398|Ga0126383_13402420Not Available520Open in IMG/M
3300010863|Ga0124850_1002683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68605276Open in IMG/M
3300012189|Ga0137388_10882583Not Available827Open in IMG/M
3300012198|Ga0137364_10120699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1868Open in IMG/M
3300012199|Ga0137383_10611677Not Available797Open in IMG/M
3300012200|Ga0137382_10570909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria807Open in IMG/M
3300012202|Ga0137363_10036865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3420Open in IMG/M
3300012202|Ga0137363_10280729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1362Open in IMG/M
3300012208|Ga0137376_10858350Not Available780Open in IMG/M
3300012285|Ga0137370_10772246Not Available596Open in IMG/M
3300012351|Ga0137386_10952243Not Available613Open in IMG/M
3300012353|Ga0137367_10271773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1217Open in IMG/M
3300012354|Ga0137366_10085888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2391Open in IMG/M
3300012358|Ga0137368_10816006All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300012362|Ga0137361_11809725Not Available529Open in IMG/M
3300012363|Ga0137390_10051519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3994Open in IMG/M
3300012582|Ga0137358_10697086Not Available679Open in IMG/M
3300012924|Ga0137413_11552555Not Available540Open in IMG/M
3300012948|Ga0126375_10697509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium790Open in IMG/M
3300012971|Ga0126369_12356380Not Available619Open in IMG/M
3300012971|Ga0126369_12781805Not Available572Open in IMG/M
3300012972|Ga0134077_10567029Not Available510Open in IMG/M
3300012988|Ga0164306_11269969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria621Open in IMG/M
3300016319|Ga0182033_11197413Not Available680Open in IMG/M
3300016319|Ga0182033_12108323All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300016341|Ga0182035_11801572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium554Open in IMG/M
3300016357|Ga0182032_10291598Not Available1285Open in IMG/M
3300016387|Ga0182040_10215374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1421Open in IMG/M
3300016404|Ga0182037_11717943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria560Open in IMG/M
3300018468|Ga0066662_11780765Not Available644Open in IMG/M
3300021168|Ga0210406_10624130Not Available839Open in IMG/M
3300021560|Ga0126371_10906458Not Available1025Open in IMG/M
3300021560|Ga0126371_12334590Not Available646Open in IMG/M
3300025910|Ga0207684_11073725Not Available671Open in IMG/M
3300025928|Ga0207700_11020912Not Available740Open in IMG/M
3300025928|Ga0207700_12020648Not Available503Open in IMG/M
3300026319|Ga0209647_1034988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2887Open in IMG/M
3300026551|Ga0209648_10033990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae4442Open in IMG/M
3300027855|Ga0209693_10119463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1305Open in IMG/M
3300027874|Ga0209465_10069351All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300031543|Ga0318516_10413972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria776Open in IMG/M
3300031546|Ga0318538_10061305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1867Open in IMG/M
3300031546|Ga0318538_10564682Not Available617Open in IMG/M
3300031546|Ga0318538_10795280Not Available513Open in IMG/M
3300031546|Ga0318538_10819883Not Available505Open in IMG/M
3300031564|Ga0318573_10691151Not Available548Open in IMG/M
3300031572|Ga0318515_10740665Not Available519Open in IMG/M
3300031573|Ga0310915_10086549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2094Open in IMG/M
3300031573|Ga0310915_10218344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae1336Open in IMG/M
3300031573|Ga0310915_10289901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1155Open in IMG/M
3300031573|Ga0310915_11162873Not Available534Open in IMG/M
3300031573|Ga0310915_11182623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300031640|Ga0318555_10164061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1192Open in IMG/M
3300031640|Ga0318555_10662769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium564Open in IMG/M
3300031679|Ga0318561_10265226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria937Open in IMG/M
3300031681|Ga0318572_10265193Not Available1011Open in IMG/M
3300031681|Ga0318572_10837926Not Available546Open in IMG/M
3300031682|Ga0318560_10250410Not Available951Open in IMG/M
3300031719|Ga0306917_10036120All Organisms → cellular organisms → Bacteria3223Open in IMG/M
3300031719|Ga0306917_10173981All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300031719|Ga0306917_10985286Not Available658Open in IMG/M
3300031744|Ga0306918_10909097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300031744|Ga0306918_11190352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → Methylosinus sporium588Open in IMG/M
3300031747|Ga0318502_10971562Not Available517Open in IMG/M
3300031748|Ga0318492_10143869All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300031748|Ga0318492_10702842Not Available542Open in IMG/M
3300031764|Ga0318535_10038748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1948Open in IMG/M
3300031768|Ga0318509_10019913All Organisms → cellular organisms → Bacteria → Proteobacteria3120Open in IMG/M
3300031768|Ga0318509_10792087Not Available524Open in IMG/M
3300031770|Ga0318521_10849020Not Available557Open in IMG/M
3300031777|Ga0318543_10096934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1264Open in IMG/M
3300031793|Ga0318548_10550257Not Available562Open in IMG/M
3300031794|Ga0318503_10096629Not Available936Open in IMG/M
3300031879|Ga0306919_10023224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3793Open in IMG/M
3300031880|Ga0318544_10111649Not Available1035Open in IMG/M
3300031893|Ga0318536_10675314Not Available515Open in IMG/M
3300031910|Ga0306923_11063947Not Available874Open in IMG/M
3300031912|Ga0306921_10155985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2671Open in IMG/M
3300031912|Ga0306921_10415525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1569Open in IMG/M
3300031941|Ga0310912_10481845Not Available967Open in IMG/M
3300031941|Ga0310912_11398237Not Available528Open in IMG/M
3300031941|Ga0310912_11532182Not Available501Open in IMG/M
3300031942|Ga0310916_11036415Not Available683Open in IMG/M
3300031942|Ga0310916_11136733Not Available648Open in IMG/M
3300031954|Ga0306926_10089127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3765Open in IMG/M
3300031954|Ga0306926_10474306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1540Open in IMG/M
3300031954|Ga0306926_12056903All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031959|Ga0318530_10057011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1483Open in IMG/M
3300032001|Ga0306922_10125379All Organisms → cellular organisms → Bacteria2732Open in IMG/M
3300032001|Ga0306922_10234801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1970Open in IMG/M
3300032009|Ga0318563_10089081All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Botrimarina → Botrimarina colliarenosi1620Open in IMG/M
3300032025|Ga0318507_10488011Not Available536Open in IMG/M
3300032051|Ga0318532_10274684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → Methylosinus sporium598Open in IMG/M
3300032052|Ga0318506_10031944All Organisms → cellular organisms → Bacteria → Proteobacteria2022Open in IMG/M
3300032052|Ga0318506_10467929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium559Open in IMG/M
3300032055|Ga0318575_10007242All Organisms → cellular organisms → Bacteria → Proteobacteria4065Open in IMG/M
3300032059|Ga0318533_10317565Not Available1132Open in IMG/M
3300032059|Ga0318533_11256354Not Available541Open in IMG/M
3300032063|Ga0318504_10461436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
3300032066|Ga0318514_10067933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1757Open in IMG/M
3300032066|Ga0318514_10273972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria890Open in IMG/M
3300032076|Ga0306924_11126752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium854Open in IMG/M
3300032261|Ga0306920_100694770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1499Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.10%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil10.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.57%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.60%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.60%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.60%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.60%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_073337002070309004Green-Waste CompostMIFMRVHKHWLDYDVVALAFLVIGIAAVELLALIF
GPIPI_025140002088090014SoilMIFMRMPHKHWLDYDVAALAFLILGIAAVEVLAIIL
F24TB_1041867913300000550SoilVVLIPQWSTIFMRVHTHWLDYDVAALAFLIVGIAAVGLLAIII*
AF_2010_repII_A01DRAFT_103667933300000580Forest SoilIRASRSFFNGRMIFMRVHKHWLDYDVVALPFLIIGIAAVELFAPIF*
AF_2010_repII_A01DRAFT_107526413300000580Forest SoilMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII*
AF_2010_repII_A1DRAFT_1012289023300000597Forest SoilMIFMRVHKYWLDYDLAALALLIIGMVAVELLALMM*
AF_2010_repII_A100DRAFT_101321113300000655Forest SoilWLVIRASRSFFNGRMIFMRVHKHWLDYDVVALAFLIIGIAAVELFALIF*
AF_2010_repII_A001DRAFT_1005564623300000793Forest SoilSFFNGRMIFMRVHKHWLDYDVVALPFLIIGIAAVELFAPIF*
AF_2010_repII_A001DRAFT_1012204013300000793Forest SoilMIFMRVHKHWLDYDVVALAFLIIGIAAVELFALIF*
JGI10216J12902_10490547133300000956SoilMIFMRVHKYWLEYDAAALAFLVVGIAVVGLLAIII*
JGI10216J12902_10717348613300000956SoilVHLAHLQWKMIFMRVHKYWLDYDVAAVAFLIVGIAVVGLLALII*
JGI12627J18819_1036080913300001867Forest SoilFILNGETIFMRLYKHWLDHDVAALAFLILGMTAVELLAMII*
JGI25390J43892_1004931333300002911Grasslands SoilMRPKRCNRRSTIFMRVHTHWLDYDVAALAFLIVGIAAVGLLAIII*
JGI25617J43924_1026669513300002914Grasslands SoilKSVFIHSFILEWRMIFMRVDKHCLDYDVTALAFLIVGIAAVELIAIII*
Ga0066395_1037021323300004633Tropical Forest SoilLILQWRMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII*
Ga0066688_1026392233300005178SoilHHSLIVQWGMTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII*
Ga0066675_1056711723300005187SoilCTSLITQWSTIFMRVHTHWLDYDVAAVAFLIVGIASVGLLAIII*
Ga0066388_10139304713300005332Tropical Forest SoilSLILAWGMIFVRVYKHWLDYDAAALAFLIVGIAAVGLLAIVI*
Ga0066388_10488855713300005332Tropical Forest SoilVQRWVTFMRVHTHWLDCDAAAWTFLIVGIAAVGLLVIII*
Ga0066388_10610301623300005332Tropical Forest SoilASRSFFNGRMIFMRVHKHWLDYDVVALAFLVIAIAAVELLALIF*
Ga0008090_1585174823300005363Tropical Rainforest SoilLVIRASRSFFNGRMIFMRVHKHWLDYDVVALAFLVIGIAAVELLALIF*
Ga0070714_10192675923300005435Agricultural SoilSLMSARWGTNLMRVQKYWLDYDLAALALLLIGLAAVEVLALVLI*
Ga0070713_10065563023300005436Corn, Switchgrass And Miscanthus RhizosphereMTSLFKGGMIFMGVYKHWLDYDAAALAFLIVGIAAVGLIAIII*
Ga0070713_10182256213300005436Corn, Switchgrass And Miscanthus RhizosphereMSARWGTNLMRVQKYWLDYDLAALALLLIGLAAVEVLALVLI*
Ga0070713_10247124613300005436Corn, Switchgrass And Miscanthus RhizosphereSLILQRRMIFMRMPHKHWLDYDVAALAFLILGIAAVEVLAIIL*
Ga0070710_1047746613300005437Corn, Switchgrass And Miscanthus RhizosphereMSARWGTNLMRVQKYWLDYDLAAVALLLIGLAAVEVLALVLI*
Ga0070706_10093409413300005467Corn, Switchgrass And Miscanthus RhizosphereMIFMRAHKHWLDYDVVALAFLIIGIAAVELFALIF*LQPHP
Ga0066905_10081308023300005713Tropical Forest SoilMIFMRVHKYWLDYDLAALALLIIGMAAVELLALIM*
Ga0066905_10190544513300005713Tropical Forest SoilLFDGMIFMRVRKYWLDYDAAALAFLIIGIAAIEVLALIIM*
Ga0066903_10063786323300005764Tropical Forest SoilMTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII*
Ga0066903_10169118343300005764Tropical Forest SoilMTFMRVHTHWLECDAGAWTFLIVGIAAVGLLVIII*
Ga0066903_10181828233300005764Tropical Forest SoilMIFMRVHKHWLDYDVVALAFLVIGIAAVELLALIF*
Ga0066903_10251946813300005764Tropical Forest SoilFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII*
Ga0066903_10443290623300005764Tropical Forest SoilLILQWRMIFMRVYKHWLDYDVAALAFLIGGIAAVELIAIII*
Ga0066903_10482741533300005764Tropical Forest SoilMILMRVYKHWLDYDVAALAFLIFGMAAVGLLAIII*
Ga0066903_10512169823300005764Tropical Forest SoilMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM*
Ga0066903_10538760123300005764Tropical Forest SoilMIFMRVHKHWLDYDVVALPFLIIGIAAVELFAPIF*
Ga0066903_10559826123300005764Tropical Forest SoilVHVARWRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM*
Ga0066903_10779905013300005764Tropical Forest SoilLHGGMIFVRVYKHWLDYDAAALAFLIVGIAAVGLLAIII*
Ga0075417_1019951813300006049Populus RhizosphereCSPLIPQWSTIFMRVHIHWLDYDVAALAFLIVGIAAVGLLAIMI*
Ga0075364_1088214123300006051Populus EndosphereIHHSLILQWGMIFMRVNKHWLDHDVAALAFLIVGIAAVELLAIII*
Ga0066659_1067184623300006797SoilMIFMRVHKYWLEYDVAALAFLIVGLAAVGLLAMII*
Ga0075428_10192638923300006844Populus RhizosphereLGLQRRRLLRGRKHWLEYDVAALVLLIVGMAAVGLLALMI*
Ga0075425_10139200213300006854Populus RhizosphereMFFMRVHKYWLEYDAAALAFLIVGMAAVGLLAVVI*
Ga0075424_10028023733300006904Populus RhizosphereCSRRRTRIFMRVHKYWLEHDPAALAFLIIGIAVVGLLAIII*
Ga0075435_10179035413300007076Populus RhizosphereMLFMRVHKYWLEYDAAALAFLAVGMAVVGLLAIII*
Ga0099791_1060794613300007255Vadose Zone SoilMIFMRVHKHWLDYDVAALAFLIVGIAAVEVLAIIL*
Ga0066709_10387721823300009137Grasslands SoilMLFMRVHKYWLEYDAAALAFLIVGIAAVGLLVIII*
Ga0126374_1011073033300009792Tropical Forest SoilGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII*
Ga0126374_1015359723300009792Tropical Forest SoilMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII*
Ga0126374_1017406533300009792Tropical Forest SoilMILMRVHKHWLDYDVVALAFLIIGIAAVELVALIF*
Ga0126380_1068509623300010043Tropical Forest SoilMILMRVHKHWLDYDVVALAFLIIGIAAVELFALIF*
Ga0126380_1145216223300010043Tropical Forest SoilMIFVRVYKHWLDYDAAALAFLIVGIAAVGLLAIII*
Ga0126380_1160152513300010043Tropical Forest SoilHHSLILAWGMIFVRVYKHWLDYDAAALAFLIVGIAAVELLAMII*
Ga0126384_1045648723300010046Tropical Forest SoilMIFVRVYKHWLDYDAAALAFLIVGIAAVELLAMII*
Ga0126384_1050188523300010046Tropical Forest SoilMIFMRALHKHWLDYDVAALAFLIVGIAAVEVLAIIL*
Ga0126384_1073419923300010046Tropical Forest SoilMIFMRVHKHWLDYDVVALAFLIIGIAAVELVALIF*
Ga0126373_1093008413300010048Tropical Forest SoilFQGCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII*
Ga0126373_1145981913300010048Tropical Forest SoilIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM*
Ga0126370_1074363513300010358Tropical Forest SoilMIFMRVLHKHWLDYDVAALAFLIVGIAAVEVLAIIL*
Ga0126376_1077148713300010359Tropical Forest SoilMIFMRTHKHWLDYDVAALAFLILGMAAVEVLAIIL*
Ga0126378_1033095433300010361Tropical Forest SoilLAWGMIFVRVYKHWLDYDAAALAFLIVGIAVVGLLAIII*
Ga0126381_10118112613300010376Tropical Forest SoilMIFMRAYKHWLDHDVAALAFLIVGIAAVELLAAII*
Ga0126381_10131326613300010376Tropical Forest SoilNFQGCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII*
Ga0126383_1340242013300010398Tropical Forest SoilWRMIFMRVHKYWLDYDLAALALLIIGMVAVELLALMM*
Ga0124850_100268363300010863Tropical Forest SoilGCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII*
Ga0137388_1088258313300012189Vadose Zone SoilSVFIHSFILEWRMIFMRVDKHCLDYDVTALAFLIVGIAAVELIAIII*
Ga0137364_1012069933300012198Vadose Zone SoilMIFMRVHKYWLEYDAAALAFLIVGIAVVELLAIII*
Ga0137383_1061167723300012199Vadose Zone SoilMIFMRAHKHWLDYDVVALAFLIIGIAAVELFALIF*
Ga0137382_1057090913300012200Vadose Zone SoilIPRSFFNGGTIFMRLYKHWLDHDVAALAFLIVGMTAVELLAMII*
Ga0137363_1003686533300012202Vadose Zone SoilMIFMRVHKHWLDYDVAAVAFLIVGIAAVGLLALII*
Ga0137363_1028072923300012202Vadose Zone SoilMIFMRVHKHWLDYDVVALAFLVVGIAAVELLALIF*
Ga0137376_1085835013300012208Vadose Zone SoilMIIMRVLHKHWLDSDVAALAFLIVGLAAVEVLAIIL*
Ga0137370_1077224613300012285Vadose Zone SoilMLFMRVHKYWLEYDAAALAFLIVGIAVVGLLAIII*
Ga0137386_1095224313300012351Vadose Zone SoilMIFMRVLHKHWLDYDVAALAFLILGIAAVEVLAIIL*
Ga0137367_1027177313300012353Vadose Zone SoilIFMRVHTHWLDYDVAALAFLIVGIAAVGLLAIII*
Ga0137366_1008588833300012354Vadose Zone SoilHWCTSLITQWSTIFMRVHTHWLDYDVAAVAFLIVGIAAVGLLAIII*
Ga0137368_1081600613300012358Vadose Zone SoilTSLIPQWSTIFMRVHKHWLDYDVAALAFLIVGIAAVGLLAIII*
Ga0137361_1180972513300012362Vadose Zone SoilFIPRSFFNGGTIFMHVYKHWLDHDVAALAFLIVGMTAVELLAMII*
Ga0137390_1005151943300012363Vadose Zone SoilMIFMRVDKHCLDYDVTALAFLIVGIAAVELIAIII*
Ga0137358_1069708623300012582Vadose Zone SoilMIFMRVHKHWLDYDVVALAFLVIGIAVVELLALIF*
Ga0137413_1155255513300012924Vadose Zone SoilMIFMRVHKHWLDYDVVALAFLVISIAAVELLALIF*
Ga0126375_1069750943300012948Tropical Forest SoilMIFMMLHKHWLDYDVAALAFLIVGIAAVEVLAIIL*
Ga0126369_1235638013300012971Tropical Forest SoilMENIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM*
Ga0126369_1278180523300012971Tropical Forest SoilMIFMRVRKYWLDYDLAALALLIIGMAAVELLALIM*
Ga0134077_1056702913300012972Grasslands SoilQWSTIFMRVHTHWLDYDVAAVAFLIVGIASVGLLAIII*
Ga0164306_1126996923300012988SoilFIPRSFFNGGTIFMRLYKHWLDHDVAALAFLIVGMTAVELLAMII*
Ga0164305_1094775623300012989SoilRWGTNLMRVQKYWLDYDLAALALLLIGLAAVEVLALVLI*
Ga0182033_1119741323300016319SoilMIFMRVHKHWLDYDVVALALLVIAIAAVELLTLIF
Ga0182033_1210832313300016319SoilPRSFFNGGTIFMRVYKHWLDHDVAALAFLIVGMTAVELLAMII
Ga0182035_1180157223300016341SoilNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0182032_1029159843300016357SoilFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0182040_1021537413300016387SoilMIFMRVRKHWLDYDVVALAFLIIGIAAVELVALIF
Ga0182037_1171794313300016404SoilMIFMRVHKHWLDYDVVALALLVIAIAAVELLALAF
Ga0066662_1178076513300018468Grasslands SoilILQWRMIFMRALHKHWLDYDVAALAFLIVGIAAVEVLAIIL
Ga0210406_1062413023300021168SoilMIFMRVHKHWLDYDVVALAFLVISIAVVELLALIF
Ga0126371_1090645823300021560Tropical Forest SoilQGCLHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0126371_1233459013300021560Tropical Forest SoilETIFMRVYKHWLDHDVAALAFLIVGMTAVELLAMII
Ga0207684_1107372513300025910Corn, Switchgrass And Miscanthus RhizosphereMIFMRAHKHWLDYDVVALAFLIIGIAAVELFALIF
Ga0207700_1102091213300025928Corn, Switchgrass And Miscanthus RhizosphereMTSLFKGGMIFMGVYKHWLDYDAAALAFLIVGIAAVGLIAIII
Ga0207700_1202064823300025928Corn, Switchgrass And Miscanthus RhizosphereRSLILQRRMIFMRMPHKHWLDYDVAALAFLILGIAAVEVLAIIL
Ga0209647_103498873300026319Grasslands SoilFNGGTIFMRLYKHWLDHDVAALAFLIVGMTAVELLAMII
Ga0209648_1003399023300026551Grasslands SoilMIFMRVHKYWLDYDLAALTLLIIGLAAVELLALII
Ga0209693_1011946343300027855SoilFNGGTIFMRVYKHWLDHDVAALAFLIVGMTAVELLAMII
Ga0209465_1006935113300027874Tropical Forest SoilMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM
Ga0318516_1041397223300031543SoilFIHWLILQWRMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII
Ga0318538_1006130513300031546SoilIWLVIRASRSFFNGRMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF
Ga0318538_1056468213300031546SoilMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII
Ga0318538_1079528023300031546SoilVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318538_1081988313300031546SoilMIFVRVYKHWLDYDVAALAFLICGIAAVELIAIII
Ga0318573_1069115123300031564SoilFQGCIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318515_1074066513300031572SoilNFQGCIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0310915_1008654963300031573SoilIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0310915_1021834433300031573SoilMIFMRVHKYWLDHDLAALALLIIGMAAVELLALMM
Ga0310915_1028990133300031573SoilMIFMRVHKHWLDYDVVALAFLIIGIAAVELFALIF
Ga0310915_1116287323300031573SoilMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0310915_1118262313300031573SoilMIFVRVYKHWLDYDAAALAFLIVGIAAVGLLAIII
Ga0318555_1016406113300031640SoilVIRASRSFFNGRMIFMRVHKHWLDYDVVALAFLIIGIAAVELVALVF
Ga0318555_1066276923300031640SoilQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318561_1026522623300031679SoilVIRASRSFFNGRMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF
Ga0318572_1026519313300031681SoilMILMRVHKHWLDYDVVALAFLIIGIAAVELVALIF
Ga0318572_1083792623300031681SoilHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318560_1025041013300031682SoilSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0306917_1003612013300031719SoilVARWRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM
Ga0306917_1017398153300031719SoilNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0306917_1098528623300031719SoilLHSAHYSIGVTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII
Ga0306918_1090909723300031744SoilMIFMRVHKHWLDYDVVALALLVIAIAAVELLALIF
Ga0306918_1119035233300031744SoilIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318502_1097156213300031747SoilVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318492_1014386923300031748SoilMIFMRVHKHWLDYDVVALAFLIIGIAAVELVALIF
Ga0318492_1070284213300031748SoilIGVTCMRVHKHWLECDAAAWTFLIVGIAAVGLLVIII
Ga0318535_1003874813300031764SoilFFNGRMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF
Ga0318509_1001991363300031768SoilLQWRMIFMRVKHWLDYDVAALALLIVGIAAVEVLAIIL
Ga0318509_1079208713300031768SoilVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0318521_1084902023300031770SoilLVFKSAFIHWLILQWRMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII
Ga0318543_1009693413300031777SoilMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF
Ga0318548_1055025723300031793SoilCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318503_1009662913300031794SoilCIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0306919_1002322413300031879SoilTIFMRVYKHWLDHDVAALAFLIVGIVAVELLAMII
Ga0318544_1011164923300031880SoilMILMRVHKHWLDYDVVALAFLIIGIAAVELFALIF
Ga0318536_1067531413300031893SoilMRVSPVEVLQWRMIFMRVKHWLDYDVAALALLIVGIAAVEVLAIIL
Ga0306923_1106394723300031910SoilMIFMRVYEHWLDYDAAALAFLIVGIGAVELLAIII
Ga0306921_1015598513300031912SoilNGRMILMRVHKHWLDYDVVALAFLIIGIAAVELVALVF
Ga0306921_1041552553300031912SoilFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0310912_1048184533300031941SoilGMIFMRVYEHWLDYDAAALAFLIVGIGAVELLAIII
Ga0310912_1139823713300031941SoilFNFQGCIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0310912_1153218213300031941SoilIIQWGMTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII
Ga0310916_1103641513300031942SoilAHYSIGVTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII
Ga0310916_1113673313300031942SoilRLHSAHYSIGVTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII
Ga0306926_1008912773300031954SoilMILMRVHKHWPDYDVVALAFLIIGIAAVELVALVF
Ga0306926_1047430633300031954SoilRWRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM
Ga0306926_1205690323300031954SoilMIFMRVYKHWLDYDVAALAFLIVGIAAVELIAIII
Ga0318530_1005701113300031959SoilWRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM
Ga0306922_1012537963300032001SoilHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0306922_1023480143300032001SoilHYSIGVTFMRVHTHWLECDAAAWTFLIVGIAAVGLLVIII
Ga0318563_1008908123300032009SoilCIHQSVFINGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318507_1048801113300032025SoilFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318532_1027468433300032051SoilFQGCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318506_1003194413300032052SoilRMIFMRVHKYWLDYDLAALALLIIGMAAVELLALMM
Ga0318506_1046792913300032052SoilSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAVII
Ga0318575_1000724213300032055SoilSTGNDMRVYKHWLDHDVAALAFLIVGIAAVELLAIII
Ga0318533_1031756533300032059SoilFIHWLILQWRMIFVRVYKHWLDYDVAALAFLICGIAAVELIAIII
Ga0318533_1125635423300032059SoilGTIFMRVYKHWLDHDVAALAFLIVGIAAVELLAMII
Ga0318504_1046143613300032063SoilWLVIRASRSFFNGKMIFMRVRKHWLDYDVVALAFLIIGIAAVELVALIF
Ga0318514_1006793333300032066SoilLVIRASRSFFNGRMIFMRVRKHWLDYDVVALAFLIIGIAAVELVALIF
Ga0318514_1027397223300032066SoilLILQWRMIFMPVYKHWLDYDVAALAFLIVGIAAVELIAIII
Ga0306924_1112675243300032076SoilMIFMRVRKNWLDYDIAAVTLLMIGLAAVELLAFVIN
Ga0306920_10069477013300032261SoilCIHQSVFFNGGMIFMHVYKHWLDHDVAALAFLIVGIAAVELLAIII


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.