Basic Information | |
---|---|
Family ID | F037113 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 46 residues |
Representative Sequence | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVIVEEVA |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.14 % |
% of genes near scaffold ends (potentially truncated) | 19.64 % |
% of genes from short scaffolds (< 2000 bps) | 72.62 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.69 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (46.429 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.191 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.476 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.57% β-sheet: 20.27% Coil/Unstructured: 62.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF00145 | DNA_methylase | 5.36 |
PF02767 | DNA_pol3_beta_2 | 4.17 |
PF07659 | DUF1599 | 1.79 |
PF13362 | Toprim_3 | 1.19 |
PF04545 | Sigma70_r4 | 1.19 |
PF02467 | Whib | 0.60 |
PF01391 | Collagen | 0.60 |
PF08281 | Sigma70_r4_2 | 0.60 |
PF09723 | Zn-ribbon_8 | 0.60 |
PF00565 | SNase | 0.60 |
PF12705 | PDDEXK_1 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 5.36 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 4.17 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.57 % |
Unclassified | root | N/A | 46.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002161|JGI24766J26685_10001038 | Not Available | 8136 | Open in IMG/M |
3300002408|B570J29032_109371450 | Not Available | 719 | Open in IMG/M |
3300002835|B570J40625_100286789 | All Organisms → Viruses → Predicted Viral | 1681 | Open in IMG/M |
3300003277|JGI25908J49247_10020305 | All Organisms → Viruses → Predicted Viral | 1982 | Open in IMG/M |
3300003394|JGI25907J50239_1070171 | Not Available | 695 | Open in IMG/M |
3300004054|Ga0063232_10180309 | Not Available | 624 | Open in IMG/M |
3300004126|Ga0066179_10141191 | Not Available | 646 | Open in IMG/M |
3300004448|Ga0065861_1023429 | Not Available | 11033 | Open in IMG/M |
3300004461|Ga0066223_1012538 | Not Available | 4488 | Open in IMG/M |
3300005517|Ga0070374_10152080 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
3300005517|Ga0070374_10371617 | Not Available | 721 | Open in IMG/M |
3300005525|Ga0068877_10056665 | All Organisms → Viruses → Predicted Viral | 2561 | Open in IMG/M |
3300005527|Ga0068876_10589400 | Not Available | 603 | Open in IMG/M |
3300005581|Ga0049081_10163478 | Not Available | 810 | Open in IMG/M |
3300005581|Ga0049081_10291755 | Not Available | 564 | Open in IMG/M |
3300005584|Ga0049082_10090984 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
3300005940|Ga0073913_10084565 | Not Available | 539 | Open in IMG/M |
3300005943|Ga0073926_10113188 | Not Available | 560 | Open in IMG/M |
3300006030|Ga0075470_10141983 | Not Available | 704 | Open in IMG/M |
3300006805|Ga0075464_10847840 | Not Available | 569 | Open in IMG/M |
3300007538|Ga0099851_1262724 | Not Available | 615 | Open in IMG/M |
3300007542|Ga0099846_1173444 | Not Available | 769 | Open in IMG/M |
3300008055|Ga0108970_10006988 | Not Available | 2948 | Open in IMG/M |
3300008055|Ga0108970_10472778 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
3300008107|Ga0114340_1094146 | All Organisms → Viruses → Predicted Viral | 1936 | Open in IMG/M |
3300008107|Ga0114340_1182417 | Not Available | 731 | Open in IMG/M |
3300008108|Ga0114341_10059100 | All Organisms → Viruses → Predicted Viral | 2458 | Open in IMG/M |
3300008116|Ga0114350_1153631 | Not Available | 637 | Open in IMG/M |
3300008116|Ga0114350_1195312 | Not Available | 505 | Open in IMG/M |
3300008120|Ga0114355_1084919 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
3300008264|Ga0114353_1188191 | Not Available | 990 | Open in IMG/M |
3300008266|Ga0114363_1017132 | All Organisms → Viruses → Predicted Viral | 3257 | Open in IMG/M |
3300008266|Ga0114363_1060310 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
3300008266|Ga0114363_1086499 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
3300008266|Ga0114363_1132024 | Not Available | 852 | Open in IMG/M |
3300008448|Ga0114876_1009740 | Not Available | 5577 | Open in IMG/M |
3300008448|Ga0114876_1021865 | All Organisms → Viruses → Predicted Viral | 3298 | Open in IMG/M |
3300008448|Ga0114876_1095116 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
3300008448|Ga0114876_1210079 | Not Available | 647 | Open in IMG/M |
3300008450|Ga0114880_1064731 | All Organisms → Viruses → Predicted Viral | 1500 | Open in IMG/M |
3300008450|Ga0114880_1263054 | Not Available | 529 | Open in IMG/M |
3300009068|Ga0114973_10011456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5713 | Open in IMG/M |
3300009081|Ga0105098_10357900 | Not Available | 715 | Open in IMG/M |
3300009146|Ga0105091_10493924 | Not Available | 621 | Open in IMG/M |
3300009151|Ga0114962_10146203 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
3300009155|Ga0114968_10143498 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
3300009158|Ga0114977_10010213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5949 | Open in IMG/M |
3300009158|Ga0114977_10084848 | Not Available | 1932 | Open in IMG/M |
3300009159|Ga0114978_10027859 | Not Available | 4067 | Open in IMG/M |
3300009164|Ga0114975_10101554 | Not Available | 1663 | Open in IMG/M |
3300009164|Ga0114975_10136870 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
3300009165|Ga0105102_10470356 | Not Available | 678 | Open in IMG/M |
3300009181|Ga0114969_10270809 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
3300009182|Ga0114959_10346304 | Not Available | 734 | Open in IMG/M |
3300009183|Ga0114974_10091544 | All Organisms → Viruses → Predicted Viral | 1969 | Open in IMG/M |
3300009183|Ga0114974_10284943 | Not Available | 977 | Open in IMG/M |
3300010160|Ga0114967_10293369 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300010293|Ga0116204_1211943 | Not Available | 625 | Open in IMG/M |
3300010885|Ga0133913_10181624 | All Organisms → cellular organisms → Bacteria | 5615 | Open in IMG/M |
3300010885|Ga0133913_11981361 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300011184|Ga0136709_1035615 | Not Available | 688 | Open in IMG/M |
3300012666|Ga0157498_1052157 | Not Available | 627 | Open in IMG/M |
3300012757|Ga0157628_1167068 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300013004|Ga0164293_10271783 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
3300013014|Ga0164295_10734645 | Not Available | 763 | Open in IMG/M |
3300013087|Ga0163212_1052552 | Not Available | 1366 | Open in IMG/M |
3300017701|Ga0181364_1024601 | Not Available | 984 | Open in IMG/M |
3300017701|Ga0181364_1072459 | Not Available | 527 | Open in IMG/M |
3300017716|Ga0181350_1101511 | Not Available | 707 | Open in IMG/M |
3300017716|Ga0181350_1136064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300017716|Ga0181350_1166244 | Not Available | 509 | Open in IMG/M |
3300017722|Ga0181347_1027735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1771 | Open in IMG/M |
3300017723|Ga0181362_1054184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
3300017736|Ga0181365_1123997 | Not Available | 618 | Open in IMG/M |
3300017747|Ga0181352_1162868 | Not Available | 585 | Open in IMG/M |
3300017761|Ga0181356_1065910 | Not Available | 1223 | Open in IMG/M |
3300017774|Ga0181358_1118739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
3300017777|Ga0181357_1202939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300017778|Ga0181349_1110382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1022 | Open in IMG/M |
3300017778|Ga0181349_1186599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300017780|Ga0181346_1075463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1335 | Open in IMG/M |
3300017780|Ga0181346_1223586 | Not Available | 669 | Open in IMG/M |
3300017784|Ga0181348_1280397 | Not Available | 565 | Open in IMG/M |
3300017785|Ga0181355_1189240 | Not Available | 814 | Open in IMG/M |
3300017785|Ga0181355_1261762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300017788|Ga0169931_10003303 | All Organisms → cellular organisms → Bacteria | 25645 | Open in IMG/M |
3300019784|Ga0181359_1011568 | Not Available | 3174 | Open in IMG/M |
3300019784|Ga0181359_1011774 | Not Available | 3147 | Open in IMG/M |
3300019784|Ga0181359_1016731 | All Organisms → Viruses → Predicted Viral | 2728 | Open in IMG/M |
3300019784|Ga0181359_1020529 | All Organisms → Viruses → Predicted Viral | 2499 | Open in IMG/M |
3300019784|Ga0181359_1021713 | Not Available | 2435 | Open in IMG/M |
3300019784|Ga0181359_1051289 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
3300019784|Ga0181359_1060504 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
3300019784|Ga0181359_1075895 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
3300019784|Ga0181359_1083685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
3300019784|Ga0181359_1132883 | Not Available | 875 | Open in IMG/M |
3300020530|Ga0208235_1003512 | All Organisms → Viruses → Predicted Viral | 2308 | Open in IMG/M |
3300020536|Ga0207939_1047547 | Not Available | 527 | Open in IMG/M |
3300020570|Ga0208465_1002141 | All Organisms → Viruses → Predicted Viral | 3848 | Open in IMG/M |
3300022190|Ga0181354_1028655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1812 | Open in IMG/M |
3300022198|Ga0196905_1058786 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
3300022407|Ga0181351_1206412 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300023174|Ga0214921_10013012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9840 | Open in IMG/M |
3300025115|Ga0209835_1165733 | Not Available | 530 | Open in IMG/M |
3300025283|Ga0208048_1068096 | Not Available | 807 | Open in IMG/M |
3300027656|Ga0209357_1192052 | Not Available | 523 | Open in IMG/M |
3300027659|Ga0208975_1026949 | All Organisms → Viruses → Predicted Viral | 1855 | Open in IMG/M |
3300027659|Ga0208975_1070384 | Not Available | 1046 | Open in IMG/M |
3300027708|Ga0209188_1011263 | Not Available | 5044 | Open in IMG/M |
3300027733|Ga0209297_1052655 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
3300027734|Ga0209087_1010905 | All Organisms → cellular organisms → Bacteria | 4639 | Open in IMG/M |
3300027744|Ga0209355_1141961 | Not Available | 1036 | Open in IMG/M |
3300027756|Ga0209444_10125298 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
3300027759|Ga0209296_1137404 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
3300027764|Ga0209134_10294601 | Not Available | 552 | Open in IMG/M |
3300027782|Ga0209500_10072666 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
3300027793|Ga0209972_10006186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8633 | Open in IMG/M |
3300027805|Ga0209229_10002038 | Not Available | 8261 | Open in IMG/M |
3300027963|Ga0209400_1107871 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
3300027971|Ga0209401_1005643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7543 | Open in IMG/M |
3300027974|Ga0209299_1239422 | Not Available | 651 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1002050 | Not Available | 31782 | Open in IMG/M |
3300028025|Ga0247723_1008400 | All Organisms → Viruses → Predicted Viral | 4269 | Open in IMG/M |
3300028025|Ga0247723_1031054 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
3300028025|Ga0247723_1090374 | Not Available | 789 | Open in IMG/M |
3300028025|Ga0247723_1095247 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300028025|Ga0247723_1111228 | Not Available | 679 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1200726 | Not Available | 761 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1128509 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300031772|Ga0315288_11487238 | Not Available | 560 | Open in IMG/M |
3300031787|Ga0315900_10037531 | All Organisms → cellular organisms → Bacteria | 5282 | Open in IMG/M |
3300031787|Ga0315900_10332335 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300031787|Ga0315900_10806735 | Not Available | 646 | Open in IMG/M |
3300031787|Ga0315900_10874526 | Not Available | 608 | Open in IMG/M |
3300031857|Ga0315909_10017779 | Not Available | 7250 | Open in IMG/M |
3300031857|Ga0315909_10040907 | All Organisms → Viruses → Predicted Viral | 4384 | Open in IMG/M |
3300031857|Ga0315909_10062249 | All Organisms → Viruses → Predicted Viral | 3385 | Open in IMG/M |
3300031857|Ga0315909_10065326 | All Organisms → Viruses → Predicted Viral | 3282 | Open in IMG/M |
3300031857|Ga0315909_10195659 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
3300031857|Ga0315909_10242932 | All Organisms → Viruses → Predicted Viral | 1388 | Open in IMG/M |
3300031857|Ga0315909_10483419 | Not Available | 860 | Open in IMG/M |
3300031951|Ga0315904_10044115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5039 | Open in IMG/M |
3300031951|Ga0315904_10215582 | All Organisms → Viruses → Predicted Viral | 1870 | Open in IMG/M |
3300031951|Ga0315904_10328830 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
3300031951|Ga0315904_10528799 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
3300031952|Ga0315294_10069320 | All Organisms → Viruses → Predicted Viral | 3717 | Open in IMG/M |
3300031963|Ga0315901_10566605 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300032050|Ga0315906_10304170 | All Organisms → Viruses → Predicted Viral | 1435 | Open in IMG/M |
3300032116|Ga0315903_10862723 | Not Available | 652 | Open in IMG/M |
3300032116|Ga0315903_11156393 | Not Available | 526 | Open in IMG/M |
3300033979|Ga0334978_0061395 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
3300033981|Ga0334982_0017025 | All Organisms → Viruses → Predicted Viral | 4263 | Open in IMG/M |
3300033981|Ga0334982_0021408 | All Organisms → Viruses → Predicted Viral | 3761 | Open in IMG/M |
3300033981|Ga0334982_0120193 | All Organisms → Viruses → Predicted Viral | 1365 | Open in IMG/M |
3300034012|Ga0334986_0114438 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
3300034012|Ga0334986_0473780 | Not Available | 621 | Open in IMG/M |
3300034012|Ga0334986_0637409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 502 | Open in IMG/M |
3300034061|Ga0334987_0085621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2470 | Open in IMG/M |
3300034062|Ga0334995_0028132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4882 | Open in IMG/M |
3300034101|Ga0335027_0084536 | All Organisms → Viruses → Predicted Viral | 2458 | Open in IMG/M |
3300034101|Ga0335027_0100289 | All Organisms → Viruses → Predicted Viral | 2211 | Open in IMG/M |
3300034101|Ga0335027_0104329 | All Organisms → Viruses → Predicted Viral | 2156 | Open in IMG/M |
3300034104|Ga0335031_0007296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8171 | Open in IMG/M |
3300034106|Ga0335036_0023554 | Not Available | 4913 | Open in IMG/M |
3300034106|Ga0335036_0025425 | All Organisms → Viruses → Predicted Viral | 4707 | Open in IMG/M |
3300034106|Ga0335036_0391383 | Not Available | 896 | Open in IMG/M |
3300034112|Ga0335066_0334034 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300034418|Ga0348337_185728 | Not Available | 537 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.19% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.07% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.69% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.31% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.57% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.57% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.98% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.19% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.19% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 1.19% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.19% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.19% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.19% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.19% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.60% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24766J26685_100010389 | 3300002161 | Freshwater And Sediment | MSKWTVWVGGSEINWQHYAYKIDAERIAEFWREVKGYDDVVVEEIA* |
B570J29032_1093714501 | 3300002408 | Freshwater | MSKWTVWVGGSEVNWKHYTHKIDAERVAEFYREVKGYDDVIVEEIA* |
B570J40625_1002867892 | 3300002835 | Freshwater | MNKSWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIA* |
JGI25908J49247_100203059 | 3300003277 | Freshwater Lake | MWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVA* |
JGI25907J50239_10701713 | 3300003394 | Freshwater Lake | MWTVWVGGSEINWQHYSHKIDAERVAEFWRKVKGYDDVIVEKVA* |
Ga0063232_101803091 | 3300004054 | Freshwater Lake | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDEVVVEEVA* |
Ga0066179_101411913 | 3300004126 | Freshwater Lake | MSKWTVWAGGSEVNWHHYTHKIDAERIAEFWREVKGYDDVIVEEVA* |
Ga0065861_102342912 | 3300004448 | Marine | MSKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVVVEEVA* |
Ga0066223_101253814 | 3300004461 | Marine | QVMSKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVVVEEVA* |
Ga0070374_101520802 | 3300005517 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR* |
Ga0070374_103716172 | 3300005517 | Freshwater Lake | MSKWTVWVGGNEINWQHYTHKIDAERVAEFWREIIRADDVVVKEVA* |
Ga0068877_100566655 | 3300005525 | Freshwater Lake | MSKGWTVWVGGSEINWQHYTHKIDAERIAEFWREVKGYDDVRVEEVA* |
Ga0068876_105894001 | 3300005527 | Freshwater Lake | MSKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVVVGEVE* |
Ga0049081_101634782 | 3300005581 | Freshwater Lentic | MNKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVVVEEVA* |
Ga0049081_102917552 | 3300005581 | Freshwater Lentic | MSKWTVWVGGSEINWQHYTHKIDAERIAEFWRKVKGYDDVVVEEVA* |
Ga0049082_100909842 | 3300005584 | Freshwater Lentic | VTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR* |
Ga0073913_100845653 | 3300005940 | Sand | MDKGWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIA* |
Ga0073926_101131881 | 3300005943 | Sand | MNKSWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIV* |
Ga0075470_101419832 | 3300006030 | Aqueous | VSKWTVWVGGSEINWQRYTHKIDAERVAEFWREVKGYDDVIVEEVA* |
Ga0075464_108478403 | 3300006805 | Aqueous | MSKWTVWAGGSEINWQHYTHKIDAERIAEFWREVKGYDDVIVEEVA* |
Ga0099851_12627242 | 3300007538 | Aqueous | MSKWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVLVEEVK* |
Ga0099846_11734441 | 3300007542 | Aqueous | LGGKEMSKWTVWVGGSEINWQHYSYKIDAERVAEFWREVKGYDDVLVEEVK* |
Ga0108970_100069888 | 3300008055 | Estuary | MNKGWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEVA* |
Ga0108970_104727784 | 3300008055 | Estuary | MWTVWAGGSEINWQHYTHKIDAERVAEFWREVKGYDDVVVEEVVA* |
Ga0114340_10941468 | 3300008107 | Freshwater, Plankton | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWRKVKGYDDVIVEEVA* |
Ga0114340_11824172 | 3300008107 | Freshwater, Plankton | MWTVWVDGSEINWQQYAHKIDAERIAEFWREVKGYDDVIVERVA* |
Ga0114341_100591009 | 3300008108 | Freshwater, Plankton | MNKGWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVRVEEVA* |
Ga0114350_11536314 | 3300008116 | Freshwater, Plankton | PRRVRERAMSKWTVWVGGSEINWQHYAYKIDAERVAEFWREVKGYDDVVVEEIA* |
Ga0114350_11953123 | 3300008116 | Freshwater, Plankton | VSKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVIVEEVAL* |
Ga0114355_10849196 | 3300008120 | Freshwater, Plankton | VSKWTVWVGGSEINWQRYTHKIDAERVAEFWREVKGYDDVIVEEVAL* |
Ga0114353_11881911 | 3300008264 | Freshwater, Plankton | GGSEINWQHYTHKIDAERIAEFWREVKGYDDVRVEEVA* |
Ga0114363_10171328 | 3300008266 | Freshwater, Plankton | MSKWTVWAGGSEVNWQYYTHKIDAERIAEFWREVKGYDDVIVEEVA* |
Ga0114363_10603105 | 3300008266 | Freshwater, Plankton | MSKWTVWVGGSEINWQHYAYKIDAERVAEFWREVKGYDDVVVEEIA* |
Ga0114363_10864993 | 3300008266 | Freshwater, Plankton | MAKGWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIA* |
Ga0114363_11320242 | 3300008266 | Freshwater, Plankton | VSKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVIVEEVA* |
Ga0114876_100974011 | 3300008448 | Freshwater Lake | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVIVEEVA* |
Ga0114876_10218657 | 3300008448 | Freshwater Lake | MSKWTVWVGGSEVNWKHYTHKIDAERIAEFWREVKGYDDVIVEEVA* |
Ga0114876_10951161 | 3300008448 | Freshwater Lake | MSKWTVWAGGSEINWQHYTHKIDAERVAEFWREVKGYDDVVIEEVA* |
Ga0114876_12100792 | 3300008448 | Freshwater Lake | MNKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVLVEKVSK* |
Ga0114880_10647315 | 3300008450 | Freshwater Lake | MTILRERERVMSKWTVWAGGSEVNWHHYTHKIDAERIAEFWREVKGY |
Ga0114880_12630544 | 3300008450 | Freshwater Lake | MSKWTVWAGGSEVNWHHYTHKIDAERIAEFWREVKGYDDVVVEEVA* |
Ga0114973_1001145614 | 3300009068 | Freshwater Lake | MSKWTVWVGAYEVNWQHYAYKIDADRVAEFYREVKGYDDVIVKEVA* |
Ga0105098_103579003 | 3300009081 | Freshwater Sediment | MSKWTVWVGGSEVNWQHYTHKIDAERVAEFWREVKGYDDVMIEEVA* |
Ga0105091_104939244 | 3300009146 | Freshwater Sediment | MSKWTVWVGAYEVNWQHYAYRIDAERVAEFYREVKGYDDVVVEEIA* |
Ga0114962_101462033 | 3300009151 | Freshwater Lake | MTVWTVWAGGSEINWQHYTHKIDAERVAEFWREVKGYSDVIVEEIK* |
Ga0114968_101434984 | 3300009155 | Freshwater Lake | MSKWTVWAGGSEVNWQHYAYKIDADRIAEFWREVKGYDDVIVEEVA* |
Ga0114977_1001021311 | 3300009158 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAK* |
Ga0114977_100848482 | 3300009158 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWRKVKGYDDVIVEKVTV* |
Ga0114978_100278592 | 3300009159 | Freshwater Lake | MNSWTVWVGGSEINWQHYTHKIDAERIAEFWRKVKGYDDVVVEEVSDE* |
Ga0114975_101015544 | 3300009164 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVTV* |
Ga0114975_101368704 | 3300009164 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKV |
Ga0105102_104703562 | 3300009165 | Freshwater Sediment | MSKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVMIEEVA* |
Ga0114969_102708091 | 3300009181 | Freshwater Lake | MSKWTVWVGGSEINWQHYAYKIDADRIAEFWREVKGYDDVIVEEVA* |
Ga0114959_103463041 | 3300009182 | Freshwater Lake | MTVWTVWAGDSEINWQHYTHKIDAERVAEFWREVKGYSDVIVEEIK* |
Ga0114974_100915445 | 3300009183 | Freshwater Lake | MSNWTVWVGGSEVNWQHYAYKIDADRIAEFWREVKGYDDVIVEEVA* |
Ga0114974_102849431 | 3300009183 | Freshwater Lake | VWVGGSEINWQHYTHKIDAERIAEFWRKVKGYDGVVVEEVA* |
Ga0114967_102933694 | 3300010160 | Freshwater Lake | VECYQQKGRVRMSKWTVRIGGSEVNWQHYTHTIDAERVAEFYREVKGYDDVIVEEVA* |
Ga0116204_12119433 | 3300010293 | Anoxic Lake Water | MSKGWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVRVEEVA* |
Ga0133913_101816247 | 3300010885 | Freshwater Lake | MTMSKWTVWVGAYEVNWQHYAYKIDADRVAEFYREVKGYDDVIVKEVA* |
Ga0133913_119813611 | 3300010885 | Freshwater Lake | SEINWQHYTYKIDAERIAEFWREVKGYDDVIVEEVA* |
Ga0136709_10356152 | 3300011184 | Freshwater | MSKWTVWVGAYEVNWQHYAYKIDAERVAEFYREVKGYDDVIVEEIA* |
Ga0157498_10521573 | 3300012666 | Freshwater, Surface Ice | YYPLMRERVMSKWTVWVGGSEVNWQHYTHKIDAERIAEFWRKVKGYDDVIVEEVA* |
Ga0157628_11670683 | 3300012757 | Freshwater | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVIVEEIA* |
Ga0164293_102717833 | 3300013004 | Freshwater | MSKWTVWVGGSEVNWKHYTHKIDAERVAEFYREVKGYDDVVLEEVA* |
Ga0164295_107346453 | 3300013014 | Freshwater | MSKWTVWAGGSEINWQHYTHKIDAERVAEFWREVKGYDDVIVEEVA* |
Ga0163212_10525523 | 3300013087 | Freshwater | MWSVWVGGSEINWQHYTHKIDAERIAEFWREVKGYDDVRVEKVSTCN* |
Ga0181364_10246012 | 3300017701 | Freshwater Lake | MWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0181364_10724592 | 3300017701 | Freshwater Lake | MSKWTVWAGGSEVNWQHYAYKIDAERIAEFWREVKGYDDVIVEEVA |
Ga0181350_11015111 | 3300017716 | Freshwater Lake | KRERETMSKWTVWVGGNEINWQHYTHKIDAERVAEFWREIIRADDVVVKEVA |
Ga0181350_11360642 | 3300017716 | Freshwater Lake | MSWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAV |
Ga0181350_11662443 | 3300017716 | Freshwater Lake | MSKWTVWVGGSEVNWQHYAYKIDADRVAEFWREVKGYDDVIVKEVA |
Ga0181347_10277355 | 3300017722 | Freshwater Lake | MSWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0181362_10541841 | 3300017723 | Freshwater Lake | VSWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0181365_11239972 | 3300017736 | Freshwater Lake | MTWTVWLGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAI |
Ga0181352_11628682 | 3300017747 | Freshwater Lake | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVVVEEVA |
Ga0181356_10659101 | 3300017761 | Freshwater Lake | DISMTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0181358_11187391 | 3300017774 | Freshwater Lake | MTWTVWVGGSEINWQHCSHKIDAERVAEFWREVKGYDDVIVEKV |
Ga0181357_12029393 | 3300017777 | Freshwater Lake | MSWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVA |
Ga0181349_11103821 | 3300017778 | Freshwater Lake | VSWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKV |
Ga0181349_11865993 | 3300017778 | Freshwater Lake | MSWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEK |
Ga0181346_10754633 | 3300017780 | Freshwater Lake | MTWTEWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0181346_12235863 | 3300017780 | Freshwater Lake | ISMTWTVWVGGSEINWQHYSHKIDAERVAGFWREVKGYDDVIVEKVAR |
Ga0181348_12803972 | 3300017784 | Freshwater Lake | MSKWTVWVGGSEVNWHHYTHKIDAERIAEFWREVKGYEDVIVEEVA |
Ga0181355_11892401 | 3300017785 | Freshwater Lake | KVNWQHYAYKIDADRIAEFWREVKGYDDVIVEEVA |
Ga0181355_12617623 | 3300017785 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVI |
Ga0169931_1000330329 | 3300017788 | Freshwater | MWTVWVGGSEINWQHYTHKIDAERIAEFWREVKGYDDVIVEKVSA |
Ga0181359_10115688 | 3300019784 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAI |
Ga0181359_10117749 | 3300019784 | Freshwater Lake | MSKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDEVVVEEVA |
Ga0181359_101673111 | 3300019784 | Freshwater Lake | MWTVWVGGSEINWQHYSHKIDAERVAEFWRKVKGYDDVIVEKVA |
Ga0181359_10205298 | 3300019784 | Freshwater Lake | MSKWTVWVGGNEINWQHYTHKIDAERVAEFWREIIRADDVVVKEVA |
Ga0181359_10217136 | 3300019784 | Freshwater Lake | VSWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVKL |
Ga0181359_10512895 | 3300019784 | Freshwater Lake | VSWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVEL |
Ga0181359_10605044 | 3300019784 | Freshwater Lake | MSRWTVWAGGSEVNWQHYAYKIDAERIAEFWREVKGYDDVIVEEVA |
Ga0181359_10758953 | 3300019784 | Freshwater Lake | MWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVA |
Ga0181359_10836852 | 3300019784 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0181359_11328834 | 3300019784 | Freshwater Lake | MSKWTVWAGGSEVNWQHYAYKIDADRIAEFWREVKGYDDVIVEEVA |
Ga0208235_10035124 | 3300020530 | Freshwater | MSKWTVWVGAYEVNWQHYAYKIDAERVAEFYREVKGYDDVIVEEIA |
Ga0207939_10475473 | 3300020536 | Freshwater | MSKWTVWVGGSEVNWKHYTHKIDAERVAEFYREVKGYDDVIVEEIA |
Ga0208465_10021415 | 3300020570 | Freshwater | MNKSWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIA |
Ga0181354_10286554 | 3300022190 | Freshwater Lake | VTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVERVAR |
Ga0196905_10587864 | 3300022198 | Aqueous | MSKWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVLVEEVK |
Ga0181351_12064122 | 3300022407 | Freshwater Lake | MSKWTVWAGGSEVNWHHYTHKIDAERIAEFWREVKGYDDVMVEEVA |
Ga0214921_1001301212 | 3300023174 | Freshwater | MSKWTVWVGGSEINWQHYTHRIDAERIAEFWRKVKGYDDVVVEEVA |
Ga0209835_11657333 | 3300025115 | Anoxic Lake Water | MSKGWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVRVEEVA |
Ga0208048_10680963 | 3300025283 | Freshwater | MWSVWVGGSEINWQHYTHKIDAERIAEFWREVKGYDDVRVEKVSTCN |
Ga0209357_11920522 | 3300027656 | Freshwater Lake | GDISMTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0208975_10269495 | 3300027659 | Freshwater Lentic | MNKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVVVEEVA |
Ga0208975_10703842 | 3300027659 | Freshwater Lentic | MSKWTVWVGGSEINWQHYTHKIDAERIAEFWRKVKGYDDVVVEEVA |
Ga0209188_10112636 | 3300027708 | Freshwater Lake | MTVWTVWAGGSEINWQHYTHKIDAERVAEFWREVKGYSDVIVEEIK |
Ga0209297_10526558 | 3300027733 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAK |
Ga0209087_10109059 | 3300027734 | Freshwater Lake | MTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVTV |
Ga0209355_11419616 | 3300027744 | Freshwater Lake | VGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0209444_101252985 | 3300027756 | Freshwater Lake | DIGMTWTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVIVEKVAR |
Ga0209296_11374044 | 3300027759 | Freshwater Lake | MSNWTVWVGGSEVNWQHYAYKIDADRIAEFWREVKGYDDVIVEEVA |
Ga0209134_102946013 | 3300027764 | Freshwater Lake | MNKGWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIA |
Ga0209500_100726665 | 3300027782 | Freshwater Lake | MNSWTVWVGGSEINWQHYTHKIDAERIAEFWRKVKGYDDVVVEEVSDE |
Ga0209972_100061869 | 3300027793 | Freshwater Lake | MSKGWTVWVGGSEINWQHYTHKIDAERIAEFWREVKGYDDVRVEEVA |
Ga0209229_100020388 | 3300027805 | Freshwater And Sediment | MSKWTVWVGGSEINWQHYAYKIDAERIAEFWREVKGYDDVVVEEIA |
Ga0209400_11078715 | 3300027963 | Freshwater Lake | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVIVEEVA |
Ga0209401_10056439 | 3300027971 | Freshwater Lake | MSKWTVWVGAYEVNWQHYAYKIDADRVAEFYREVKGYDDVIVKEVA |
Ga0209299_12394223 | 3300027974 | Freshwater Lake | MSKWTVWVGGSEINWQHYTHKIDAERIAEFWRKVKGYDDVVVEEVSDEXLYRGQN |
(restricted) Ga0247834_10020503 | 3300027977 | Freshwater | MNKGWTVWVGGSEINWQHYTHKIDAERIAEFWREVKGYDDVRVEEVA |
Ga0247723_10084006 | 3300028025 | Deep Subsurface Sediment | MSKWTVWVGSSEINWQHYTHKIDAERVAEFWREVKGYDDVIVEEVA |
Ga0247723_10310544 | 3300028025 | Deep Subsurface Sediment | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVVVEEIA |
Ga0247723_10903743 | 3300028025 | Deep Subsurface Sediment | MNKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVVVGEVV |
Ga0247723_10952471 | 3300028025 | Deep Subsurface Sediment | VWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVTIEEVA |
Ga0247723_11112284 | 3300028025 | Deep Subsurface Sediment | VWVGGSEINWKRYTHKIDAERIAEFWREVKGYDDVIVEEIK |
(restricted) Ga0247843_12007263 | 3300028569 | Freshwater | MSKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVVVEEVA |
(restricted) Ga0247844_11285091 | 3300028571 | Freshwater | MSKWTVWAGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVVVEEVR |
Ga0315288_114872383 | 3300031772 | Sediment | MNKWTVWAGGSEVNWQHYTHKIDAERVAEFWREVKGYDDVLVEEGK |
Ga0315900_100375311 | 3300031787 | Freshwater | GGSEINWQHYTHKIDAERVAEFWREVKGYDDVVVGEVE |
Ga0315900_103323353 | 3300031787 | Freshwater | MSKWTVWVGGSEVNWKHYTHKIDAERIAEFWREVKGYDDVIVEEVA |
Ga0315900_108067351 | 3300031787 | Freshwater | MNKGWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVRVEEVA |
Ga0315900_108745263 | 3300031787 | Freshwater | VSKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVIVEEVTL |
Ga0315909_1001777912 | 3300031857 | Freshwater | MSKWTVWVGGSEINWQHYAYKIDAERVAEFWREVKGYDDVVVEEIA |
Ga0315909_100409075 | 3300031857 | Freshwater | MSKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVVVGEVE |
Ga0315909_100622492 | 3300031857 | Freshwater | MSKWTVWVGSSEINWQHYTHKIDAERVAEFWREVKGYDDVVVEEVA |
Ga0315909_100653263 | 3300031857 | Freshwater | MSKWTVWVGGSEINWQHYAYRIDAERVAEFYREVKGYDDVVVEEVA |
Ga0315909_101956595 | 3300031857 | Freshwater | MSKWTVWVGGSEINWQHYAYKIDAERIAEFWREVKGYDDVVVEK |
Ga0315909_102429326 | 3300031857 | Freshwater | MSKWTVWAGGSEVNWHHYTHKIDAERIAEFWREVKGYDDVVVEEVA |
Ga0315909_104834191 | 3300031857 | Freshwater | MSKWTVWVGGSEINWQHYAYKIDAERVAEFWREVKGYDDVVVEEVA |
Ga0315904_100441158 | 3300031951 | Freshwater | VSKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVIVEEVA |
Ga0315904_102155825 | 3300031951 | Freshwater | VSKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVIVEEVAL |
Ga0315904_103288304 | 3300031951 | Freshwater | MAKGWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIA |
Ga0315904_105287991 | 3300031951 | Freshwater | TRERVMSKWTVWVGGSEVNWKHYTHKIDAERIAEFWREVKGYDDVIVEEVA |
Ga0315294_100693207 | 3300031952 | Sediment | MNKWTVWAGGSEVNWQHYTHKIDAERVAEFWREVKGYDDVLVERVA |
Ga0315901_105666051 | 3300031963 | Freshwater | EYYPLMRERVMSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVIVEEVA |
Ga0315906_103041703 | 3300032050 | Freshwater | MSKWTVWAGGSEVNWQYYTHKIDAERIAEFWREVKGYDDVIVEEVA |
Ga0315903_108627231 | 3300032116 | Freshwater | RRARERAMSKWTVWVGGSEINWQHYAYKIDAERIAEFWREVKGYDDVVVEEIA |
Ga0315903_111563931 | 3300032116 | Freshwater | RRARERAMSKWTVWVGGSEINWQHYAYKIDAERVAEFWREVKGYDDVVVEEVA |
Ga0334978_0061395_727_870 | 3300033979 | Freshwater | VNKGWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIA |
Ga0334982_0017025_2986_3126 | 3300033981 | Freshwater | MSKWTVWAGGSEINWQHYAYRIDAERVAEFWREVKGYDDVVVEEVA |
Ga0334982_0021408_511_651 | 3300033981 | Freshwater | MNKWTVWVGAYEVNWQHYAYKIDAERVAEFYREVKGYDDVVIKEVA |
Ga0334982_0120193_463_603 | 3300033981 | Freshwater | MSKWTVWVGGSEVNWQHYTHKIDAERIAEFWREVKGYDDVIVEEIA |
Ga0334986_0114438_77_232 | 3300034012 | Freshwater | MRERAMSKWTVWVGGSEVNWKHYTHKIDAERVAEFYREVKGYDDVIVEEVA |
Ga0334986_0473780_410_550 | 3300034012 | Freshwater | MSKWTVWVGAYEVNWQHYAYKIDAERVAEFWREVKGYDDVVVEEIA |
Ga0334986_0637409_282_419 | 3300034012 | Freshwater | MWTVWAGGSEINWQHYTHKIDAERVAEFWREVKGYDDVVVEEVMA |
Ga0334987_0085621_402_542 | 3300034061 | Freshwater | MSKWTVWAGGSEVNWQHYTHKIDAERVAEFWREIKGYDDVIVEEVK |
Ga0334995_0028132_4289_4429 | 3300034062 | Freshwater | MSRWTVWVGGSELNWQHYTHKIDAERVAEFWREVKGYDDVVVEQVK |
Ga0335027_0084536_1428_1568 | 3300034101 | Freshwater | MNRWTVWAGGSEVNWQHYTHKIDAERVAEFWREVKGYDDVIVEEIK |
Ga0335027_0100289_1127_1267 | 3300034101 | Freshwater | MSKWTVWVGGSEVNWQYYTHKIDAERVAEFYREVKGYDDVVVEEVA |
Ga0335027_0104329_211_351 | 3300034101 | Freshwater | MSKWTVWVGGSEINWQHYTHKIDAERVAEFWREVKGYDDVVVGEVA |
Ga0335031_0007296_4127_4315 | 3300034104 | Freshwater | VGEGESERYLLTRERESMNWTVWVGGSEINWKHYSHKIDAERVAEFWREVKGYDDVIVEEVK |
Ga0335036_0023554_3026_3163 | 3300034106 | Freshwater | MSYTVWVGGSEINWQHYSHKIDAERVAEFWREVKGYDDVVVEEVK |
Ga0335036_0025425_3319_3462 | 3300034106 | Freshwater | VSKWTVWVGGSEINWQRYTHKIDAERVAEFWREVKGYDDVIVEEVAL |
Ga0335036_0391383_459_599 | 3300034106 | Freshwater | MSKWTVWVGGSEVNWKHYTHKIDAERVAEFYREVKGYDDVVVEEVA |
Ga0335066_0334034_9_161 | 3300034112 | Freshwater | MRTTMSKWTVWAGGSEVNWQHYAYKIDADRVAEFWREVKGYDDVIVEEVA |
Ga0348337_185728_80_247 | 3300034418 | Aqueous | MTILRRATMNKSWTVWVGGSEINWKHYTHKIDAERIAEFWREVKGYDDVRVEEIA |
⦗Top⦘ |