| Basic Information | |
|---|---|
| Family ID | F037103 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 168 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MLSQKEKAQIRAVLEEEQKRLARKSENALSYSMNHERNIGRDSIDESME |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 168 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.81 % |
| % of genes from short scaffolds (< 2000 bps) | 97.02 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.619 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.84% β-sheet: 0.00% Coil/Unstructured: 44.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 168 Family Scaffolds |
|---|---|---|
| PF10431 | ClpB_D2-small | 97.02 |
| PF06224 | HTH_42 | 0.60 |
| PF00486 | Trans_reg_C | 0.60 |
| PF00069 | Pkinase | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.38 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.62 % |
| Unclassified | root | N/A | 2.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_101189688 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300002568|C688J35102_120585497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1209 | Open in IMG/M |
| 3300004047|Ga0055499_10081687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300004062|Ga0055500_10160248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300004114|Ga0062593_101366235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300004153|Ga0063455_100177368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1021 | Open in IMG/M |
| 3300004153|Ga0063455_101520454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300004156|Ga0062589_102505436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300004463|Ga0063356_104671811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 589 | Open in IMG/M |
| 3300004463|Ga0063356_105584403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300004479|Ga0062595_100711537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 809 | Open in IMG/M |
| 3300004480|Ga0062592_100552164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 966 | Open in IMG/M |
| 3300004480|Ga0062592_102072693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300004480|Ga0062592_102444230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300004803|Ga0058862_11913797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 536 | Open in IMG/M |
| 3300005328|Ga0070676_10732153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300005329|Ga0070683_102174574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300005332|Ga0066388_106778418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300005332|Ga0066388_108280202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300005341|Ga0070691_11087955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300005347|Ga0070668_102096506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300005355|Ga0070671_101189771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300005364|Ga0070673_101669825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 602 | Open in IMG/M |
| 3300005367|Ga0070667_100638372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 983 | Open in IMG/M |
| 3300005434|Ga0070709_11502825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300005439|Ga0070711_101695121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300005441|Ga0070700_101929871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300005456|Ga0070678_102178075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300005459|Ga0068867_102202626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300005466|Ga0070685_11260045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 564 | Open in IMG/M |
| 3300005526|Ga0073909_10410565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300005529|Ga0070741_11023173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300005538|Ga0070731_10575473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300005541|Ga0070733_11034931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300005541|Ga0070733_11231414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300005614|Ga0068856_101080754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300005615|Ga0070702_101621803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005616|Ga0068852_101064222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300005617|Ga0068859_100466915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1358 | Open in IMG/M |
| 3300005842|Ga0068858_100858320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300005842|Ga0068858_101577832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300005843|Ga0068860_101443204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300005995|Ga0066790_10290856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300006847|Ga0075431_101417918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300006854|Ga0075425_102093115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300007004|Ga0079218_11543777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300009094|Ga0111539_12134401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300009101|Ga0105247_10344674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 1046 | Open in IMG/M |
| 3300009157|Ga0105092_10542044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300009176|Ga0105242_12045278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300009179|Ga0115028_11514775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300009583|Ga0115598_1218530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300009609|Ga0105347_1307017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300010352|Ga0116247_10348995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 1170 | Open in IMG/M |
| 3300010359|Ga0126376_12192527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300010362|Ga0126377_12207677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300010362|Ga0126377_12484236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300010375|Ga0105239_12441863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300010397|Ga0134124_11896457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300010399|Ga0134127_13119522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300010400|Ga0134122_12465547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300010867|Ga0126347_1166499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300011424|Ga0137439_1092306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300012038|Ga0137431_1127566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300012046|Ga0136634_10497887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 519 | Open in IMG/M |
| 3300012212|Ga0150985_101015822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300012212|Ga0150985_101817767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300012212|Ga0150985_111498850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300012212|Ga0150985_111529748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1561 | Open in IMG/M |
| 3300012212|Ga0150985_117995352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300012212|Ga0150985_121406580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300012357|Ga0137384_11188879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300012469|Ga0150984_109829631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300012895|Ga0157309_10129416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 730 | Open in IMG/M |
| 3300012896|Ga0157303_10064067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300012898|Ga0157293_10096763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300012905|Ga0157296_10177964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300012913|Ga0157298_10135955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300012916|Ga0157310_10041970 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300012916|Ga0157310_10243807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300012955|Ga0164298_11141147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300012958|Ga0164299_10767403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300013308|Ga0157375_13302760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300014304|Ga0075340_1053106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 715 | Open in IMG/M |
| 3300014496|Ga0182011_10975311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300014745|Ga0157377_11523035 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300014863|Ga0180060_1063185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300015200|Ga0173480_10418706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300016270|Ga0182036_10734972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 800 | Open in IMG/M |
| 3300016270|Ga0182036_11442053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300016294|Ga0182041_11822877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300016445|Ga0182038_11615369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300018422|Ga0190265_11857747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300018466|Ga0190268_10944451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300018476|Ga0190274_13269879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300019361|Ga0173482_10116857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 993 | Open in IMG/M |
| 3300019788|Ga0182028_1349005 | Not Available | 1498 | Open in IMG/M |
| 3300021082|Ga0210380_10026126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 2487 | Open in IMG/M |
| 3300021180|Ga0210396_11751651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300021181|Ga0210388_10956630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300021404|Ga0210389_11491164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300021475|Ga0210392_11013679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300022503|Ga0242650_1013129 | Not Available | 634 | Open in IMG/M |
| 3300022708|Ga0242670_1007608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300023254|Ga0224524_1013623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1752 | Open in IMG/M |
| 3300023261|Ga0247796_1122127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300025885|Ga0207653_10367394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300025909|Ga0207705_10705909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300025912|Ga0207707_10362158 | Not Available | 1248 | Open in IMG/M |
| 3300025913|Ga0207695_10860517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300025928|Ga0207700_10662843 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300025949|Ga0207667_11956422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300025981|Ga0207640_11086835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300025986|Ga0207658_11908376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300026023|Ga0207677_10659251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300026035|Ga0207703_10841207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300026089|Ga0207648_11102698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300026095|Ga0207676_10738215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 957 | Open in IMG/M |
| 3300026142|Ga0207698_12123396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 575 | Open in IMG/M |
| 3300026215|Ga0209849_1052144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300026281|Ga0209863_10206406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300027867|Ga0209167_10511395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300028653|Ga0265323_10045934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1567 | Open in IMG/M |
| 3300028653|Ga0265323_10155672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 730 | Open in IMG/M |
| 3300028653|Ga0265323_10287801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300028800|Ga0265338_10128861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 2002 | Open in IMG/M |
| 3300028800|Ga0265338_10976574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300029987|Ga0311334_11652803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300029990|Ga0311336_10959988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300029990|Ga0311336_11781747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300030294|Ga0311349_10281171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1570 | Open in IMG/M |
| 3300030339|Ga0311360_10998434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300030491|Ga0302211_10093368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 869 | Open in IMG/M |
| 3300030988|Ga0308183_1192272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031058|Ga0308189_10269647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300031093|Ga0308197_10453047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031099|Ga0308181_1185782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300031100|Ga0308180_1020379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300031100|Ga0308180_1032779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 548 | Open in IMG/M |
| 3300031231|Ga0170824_111488376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1442 | Open in IMG/M |
| 3300031232|Ga0302323_101661869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300031232|Ga0302323_103083400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 531 | Open in IMG/M |
| 3300031344|Ga0265316_10073884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 2625 | Open in IMG/M |
| 3300031562|Ga0310886_10559607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300031595|Ga0265313_10192249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 852 | Open in IMG/M |
| 3300031712|Ga0265342_10113544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1531 | Open in IMG/M |
| 3300031712|Ga0265342_10574106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300031718|Ga0307474_10509223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19 | 944 | Open in IMG/M |
| 3300031726|Ga0302321_103192755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031753|Ga0307477_10067225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2475 | Open in IMG/M |
| 3300031754|Ga0307475_10146449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1873 | Open in IMG/M |
| 3300031764|Ga0318535_10298921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300031897|Ga0318520_10720246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300031902|Ga0302322_102000317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300031902|Ga0302322_102509564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300031902|Ga0302322_103141033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300031918|Ga0311367_11579497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300031941|Ga0310912_11137698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 595 | Open in IMG/M |
| 3300031947|Ga0310909_11179614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300031965|Ga0326597_11211400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300032010|Ga0318569_10419553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300032179|Ga0310889_10103744 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300033407|Ga0214472_11353538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300034161|Ga0370513_180650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300034659|Ga0314780_200118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300034660|Ga0314781_137970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300034820|Ga0373959_0110249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.50% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 5.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.98% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.79% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.19% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.19% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.19% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.19% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.19% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.60% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.60% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.60% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.60% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.60% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.60% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009583 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014863 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022503 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023254 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T75 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034161 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_18 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1011896882 | 3300001213 | Wetland | MLSHSEKEQLRGVLDAARKRLAKTGQNALNYSMNHERNIGRDSIDESME |
| JGIcombinedJ13530_1088569941 | 3300001213 | Wetland | MLTKTEKEQLTGVLETARKRLAKVGQSALNYSMNHERNIGRDSIDESM |
| C688J35102_1205854971 | 3300002568 | Soil | MLSPKEKVQIRTVLEDEQRRLVKKSENALSYAMNHERNIGRDSID |
| Ga0055499_100816871 | 3300004047 | Natural And Restored Wetlands | MLSQKEKNEIRKVLEEEHKRLSRTSQNALTYSMNHERNIGRDSIDESMEEEIFSTEM |
| Ga0055500_101602481 | 3300004062 | Natural And Restored Wetlands | MLSPKEKSQIRAVLAEEKRRLVKKSENALSYSMNHERNIGRDSIDESM |
| Ga0062593_1013662351 | 3300004114 | Soil | MLTESEKGQIRKVLEDNKKKLARTGQHALSYSMNHERNIGRDSIDESMEEELFS |
| Ga0063455_1001773681 | 3300004153 | Soil | MLNQKEKAQIRAVLAEELRRLAKKGESALSYSMNHERNIGRDSI |
| Ga0063455_1015204542 | 3300004153 | Soil | MLSQKEKNEIRKVLEEEQRRLSRTSQNALAYSMNHERNIGRDSIDESMEEEIFSTE |
| Ga0062589_1025054361 | 3300004156 | Soil | MLNQKEKAQIRAVLAEELRRLSKKAESALSYSMNHERNIGRDSID |
| Ga0063356_1046718112 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLSQKEKAQIRAVLAEELRRLTKKGESALSYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0063356_1055844031 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLNQKEKAQIRAVLAEELRRLSKKGESALSYSMNHERNIGRDSIDESMEEE |
| Ga0062595_1007115371 | 3300004479 | Soil | MLSQKEKAQIRAVLAEELKRLSKKAETALSYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0062592_1005521642 | 3300004480 | Soil | MLTESEKGQIRKVLEDNKKKLARTGQHALSYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0062592_1020726932 | 3300004480 | Soil | MLSSKEKAQIRAVLAEELRRLTKKAESALSYSMNHERNIGRDSIDESMEE |
| Ga0062592_1024442301 | 3300004480 | Soil | MLNQKEKGQIRAVLAEELRRLSKKAESALSYSMNHERNIGRDSIDE |
| Ga0058862_119137971 | 3300004803 | Host-Associated | MLSQKEKNEIRRVLEDEQRRLSRTSQNALSYSMNHERNIGRDSIDESMEEEIFSTEMRLH |
| Ga0070676_107321531 | 3300005328 | Miscanthus Rhizosphere | MLSPKEKAQIRAVLAEELRRLTKKAESALSYSMNHERNIGRDSID |
| Ga0070683_1021745741 | 3300005329 | Corn Rhizosphere | MLNQKEKTQIRAVLAEELRRLSKKGESALSYSMNHERNIGRDSIDESMEEE |
| Ga0066388_1067784182 | 3300005332 | Tropical Forest Soil | MLTEKEKAQIRSVLEDEQKRLARTSQNALSYSMNHERNIGRDSIDESM |
| Ga0066388_1082802021 | 3300005332 | Tropical Forest Soil | MLSQKEKNQIRAVLAEELRRLSKKGESALSYSMNHERNIGRDSIDESMEEELFSTEM |
| Ga0070691_110879551 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPKEKVQIRTVLEDEQRRLVKKSENALSYAMNHERNIGRDSIDESMEEEIF |
| Ga0070668_1020965062 | 3300005347 | Switchgrass Rhizosphere | MLSESEKTQIRKVLEQARAKLQRTSQNALAYSMNHERNIGRDSIDESMEEELFST |
| Ga0070671_1011897712 | 3300005355 | Switchgrass Rhizosphere | MLNQKEKGQIRAVLAEELRRLSKKAESALSYSMNLERNIGRDSID |
| Ga0070673_1016698251 | 3300005364 | Switchgrass Rhizosphere | MLNQKEKAQIRAVLSEELRRLSKKAENALSYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0070667_1006383721 | 3300005367 | Switchgrass Rhizosphere | MLSQKEKAQIRAVLAEELKRLSKKAESALSYSMNHERNIGR |
| Ga0070709_115028252 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNQKEKTQIRAVLAEELRRLSKKGESALSYSMNHERNIGRDSIHESMEEELFSTE |
| Ga0070711_1016951211 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPKEKTQIRTVLEDEQRRLAKKSENALAYSMNHERNIGRD |
| Ga0070700_1019298712 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSEKERTQIRAVLEEEQRRLAKTSQNALNYSMNHERNIGR |
| Ga0070678_1021780752 | 3300005456 | Miscanthus Rhizosphere | MLSPKEKAQIRTVLEDEQRRLVKKSENALSYSMNHERNIGRDSIDESMEE |
| Ga0068867_1022026261 | 3300005459 | Miscanthus Rhizosphere | MLTEKEKSQIRTVLEEQQKRLARTSQNALSYSMNHERNIGRDSID |
| Ga0070685_112600452 | 3300005466 | Switchgrass Rhizosphere | MLSQKEKAEIRRVLEDEQRRLSRTSQNALSYSMNHERNIGRDSIDESMEEELFSTEMRL |
| Ga0073909_104105652 | 3300005526 | Surface Soil | MLSQKEKAQIRAVLAEELKRLSKKAETALSYSMNHERNIGRDSID |
| Ga0070741_110231732 | 3300005529 | Surface Soil | MLSEKEKAQIRTVLEDEQKRLARTSQNALSYSMNHERNIGRDSIDESMEEEIFS |
| Ga0070731_105754731 | 3300005538 | Surface Soil | MLSEKEKKQIRVVLEDEQKRLAKTSQNALAYSMNHERNIGRDSIDESMEEEIF |
| Ga0070733_110349312 | 3300005541 | Surface Soil | MLSEKEKKQIRAVLEDEQRRLAKTSQNALNYSMNHERNIG |
| Ga0070733_112314141 | 3300005541 | Surface Soil | MLSPKEKTQIRTVLEDEQRRLAKKSENALAYSMNHERNIG |
| Ga0068856_1010807541 | 3300005614 | Corn Rhizosphere | MLNQKEKNQIRAVLAEELRRLSKKGESALSYSMNHERNIGRDSIDESMEEELFS |
| Ga0070702_1016218031 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSEKEKGQIRAVLEDEQKRLVRKSENALSYSMNHERNIGRDSI |
| Ga0068852_1010642222 | 3300005616 | Corn Rhizosphere | MLSQKEKNEIRKVLEEEQRRLSRTSQNALSYSMNH |
| Ga0068859_1004669151 | 3300005617 | Switchgrass Rhizosphere | MLNQKEKGQIRAVLAEELRRLSKKAESALSYSMNHERNIGRDSIDESMEEELFSTEMR |
| Ga0068858_1008583202 | 3300005842 | Switchgrass Rhizosphere | MLSQKEKAQIRAVLAEELKRLSKKGESALSYSMNHERNIG |
| Ga0068858_1015778321 | 3300005842 | Switchgrass Rhizosphere | MLSQKEKNEIRKVLEEEQRRLSRTSQNALSYSMNHERNIGRDSIDE |
| Ga0068860_1014432041 | 3300005843 | Switchgrass Rhizosphere | MLNQKEKAQIRAVLAEELRRLSKKGESALSYSMNHERNIGRDSIDESMEEELFSTEMR |
| Ga0066790_102908561 | 3300005995 | Soil | MLSPKEKAQIRGVLEEEQKRLVKKSENALSYSMNHERNIGRD |
| Ga0075431_1014179181 | 3300006847 | Populus Rhizosphere | MLTESEKGQIRKVLEDNKKKLTRTGQHALSYSMNHE |
| Ga0075425_1020931151 | 3300006854 | Populus Rhizosphere | MLSEKERMQIRAVLEEEQRRLAKTSQNALAYSMNHERNIGRDSIDESMEEEIFSTEM |
| Ga0079218_115437772 | 3300007004 | Agricultural Soil | MLTESEKGQIRKVLEDSKKKLTRTGQHALTYSMNHERNIGRDS |
| Ga0111539_121344012 | 3300009094 | Populus Rhizosphere | MLSQKEKEQIRGVLADELRRLAKKGESALSYSMNHERNIGRDSIDESMEEEIFSTE |
| Ga0105247_103446742 | 3300009101 | Switchgrass Rhizosphere | MLSQKEKAQIRAVLAEELKRLSKKAESALSYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0105092_105420442 | 3300009157 | Freshwater Sediment | MLNQKEKAQIRAVLAEELRRLTKKAESALSYSMNHERNIGRDSIAESVEDELFSTEMRLHAGEKFLLGKINN |
| Ga0105242_120452781 | 3300009176 | Miscanthus Rhizosphere | MLSQKEKAQIRAVLAEELKRLSKKAETALSYSMNH |
| Ga0115028_115147751 | 3300009179 | Wetland | MLSNSEKEQLLGVLETARKRLAKVGQNALNYSMNHERNIGRDSIDESMEEE |
| Ga0115598_12185302 | 3300009583 | Wetland | MLSNSEKEQLLGVLETARKRLAKVGQNALNYSMNHERNIGRDSIDESMEEELFSTEMR |
| Ga0105347_13070172 | 3300009609 | Soil | MLTEAEKNQIRKVLEEARQRLQRKSESALSYSMNHERNIGRDSIDES |
| Ga0116247_103489952 | 3300010352 | Anaerobic Digestor Sludge | MLTENQKKEIRGVLEGTRKRLARTGQDALSYSMNHERNIGRDSIDESMEEEIFSTEMRLHDR |
| Ga0126376_121925271 | 3300010359 | Tropical Forest Soil | MLSEKEKAQIRAVLEEEQRRLARTSQNALSYSMNHERN |
| Ga0126377_122076771 | 3300010362 | Tropical Forest Soil | MLSEKEKAQIRAVLQDEQRRLARKSENALSYSMNHERNIG |
| Ga0126377_124842362 | 3300010362 | Tropical Forest Soil | MLSEKEKAQIRTVLEDEQKRLARTSQNALSYSMNHERNIGRDSIDESMEE |
| Ga0105239_124418631 | 3300010375 | Corn Rhizosphere | MLSQKEKNEIRRVLEDEQRRLSRTSQNALSYSMNHERNIGRDSIDESMEEEIF |
| Ga0134124_118964572 | 3300010397 | Terrestrial Soil | MLSESEKTQIRKVLEQARAKLQRTSQNALAYSMNH |
| Ga0134127_131195221 | 3300010399 | Terrestrial Soil | MLSEKEKAQIRAVLEEQQRRLARTSQNALSYSMNHERNIGRD |
| Ga0134122_124655471 | 3300010400 | Terrestrial Soil | MLSESEKTQIRKVLETARAKLQRTSQNALAYSMNHERNI |
| Ga0126347_11664991 | 3300010867 | Boreal Forest Soil | MLTAKEKAQIRSVLEDEQKRLVKKSENALSYSMNHERNI |
| Ga0137439_10923061 | 3300011424 | Soil | MLSEIERAQIRKVLEDAKKKLARTGQNALSYSMNHERNIGRDSIDESMEEEIF |
| Ga0137431_11275661 | 3300012038 | Soil | MLNPKEKAQIRAVLAEELRRLTKKAESALSYSMNHE |
| Ga0136634_104978872 | 3300012046 | Polar Desert Sand | MLSQKEKNEIRRVLEDEQKRLSRTSQNALAYSMNHERNIGRDSIDESMEEEIFSTEMRLH |
| Ga0150985_1010158222 | 3300012212 | Avena Fatua Rhizosphere | MLSESEKAKIRKVLEENRQKLQRTSQNALTYSMNHERNIGRDSIDESMEEEIFST |
| Ga0150985_1018177671 | 3300012212 | Avena Fatua Rhizosphere | MLSESEKAKIRKVLEENRQKLQSKSQNALNYSMNHERNIGRDSIDESM |
| Ga0150985_1114988501 | 3300012212 | Avena Fatua Rhizosphere | MLSPKEKVQIRTVLDDEQRRLVKKSENALSYAMNHERNIGRDSIDESMEEEIFSTE |
| Ga0150985_1115297482 | 3300012212 | Avena Fatua Rhizosphere | MLSPKEKSQLRVVLEDEQRRLLRKSENALSYSMNHERNIGRDSIDESM* |
| Ga0150985_1179953521 | 3300012212 | Avena Fatua Rhizosphere | MLTESEKGQIRKVLEDNKKKLARTGQHALSYSMNHERNIGRDSIDESMEEELFSTEMR |
| Ga0150985_1214065802 | 3300012212 | Avena Fatua Rhizosphere | MLIPKEETQIRSVLEDEQRRLVKKSENALSYSMNHERN |
| Ga0137384_111888792 | 3300012357 | Vadose Zone Soil | LTEKEKSQIRTVLEDEQKRLAKTSQNALAYSMNHERNIGRDS |
| Ga0150984_1098296311 | 3300012469 | Avena Fatua Rhizosphere | MLSESEKAKIRKVLEENRQKLQRTSQNALTYSMNHERNIGRDSIDE |
| Ga0157309_101294162 | 3300012895 | Soil | MLNQKEKAQIRAVLAEELRRLSKKAESALSYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0157303_100640672 | 3300012896 | Soil | MLNQKEKGQIRAVLAEELRRLSKKAESALSYSMNHERNIGRDSI |
| Ga0157293_100967631 | 3300012898 | Soil | MLSPKEKAQIRAVLAEELRRLTKKGESALSYSMNHERNIGRDS |
| Ga0157296_101779642 | 3300012905 | Soil | MLNQKEKAQIRAVLAEELRRLSKKGESALSYSMNHE |
| Ga0157298_101359551 | 3300012913 | Soil | MLSQKEKVEIRRVLEDEQRRLSRTSQNALSYSMNHERNIGRDSIDESMEEEI |
| Ga0157310_100419701 | 3300012916 | Soil | MLNQKEKAQIRAVLAEELRRLTKKGESALSYSMNHERNIGRDSIDES |
| Ga0157310_102438072 | 3300012916 | Soil | MLNQKEKGQIRAVLAEELRRLSKKAENALSYSMNHERNIGRDSIDESME |
| Ga0164298_111411471 | 3300012955 | Soil | MLNPKEKAQIRAVLAEEQRRLTKKAESDLSYSMNHERNIG |
| Ga0164299_107674032 | 3300012958 | Soil | MLSQKEKAQIRAVLAEELKRLSKKAESALSYSMNHERNIGRDSNDESMEEELFSTEM |
| Ga0157375_133027601 | 3300013308 | Miscanthus Rhizosphere | MLSPKEKVQIRTVLEDEQRRLVKKSENALSYAMNHERNIGRDSIDESMEE |
| Ga0075340_10531062 | 3300014304 | Natural And Restored Wetlands | MLSNTEKEQLRSVLESARKRLAKVGQSALNYSMNHERNIGRDSIDESMEEEIFSTEMRLH |
| Ga0182011_109753112 | 3300014496 | Fen | MLTESEKTQIRAVLEGAKKRLARTGQDALTYSMNHERNI |
| Ga0157377_115230352 | 3300014745 | Miscanthus Rhizosphere | MLNQKEKNQIRAVLAEELRRLSKKGESALAYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0180060_10631852 | 3300014863 | Soil | MLSDKERTQIRGVLEDEQKRLAKTSQNALAYSMNHERNIGRD |
| Ga0173480_104187062 | 3300015200 | Soil | MLSQKEKAQIRAVLAEELRRLTKKGESALSYSMNHERNIGRDSIDESME |
| Ga0182036_107349721 | 3300016270 | Soil | MLSEKEKKQIRAVLEDEQKRLAKTSQNALNYSMNHERNIGRDSIDES |
| Ga0182036_114420531 | 3300016270 | Soil | MLSPKEKTQIRTVLEDEQRRLAKKSENALAYSMNHERNI |
| Ga0182041_118228772 | 3300016294 | Soil | MLNDKEKAQIRVVLEDEQRRLAKKSENALSYSMNHERNIGRDSIDESM |
| Ga0182038_116153692 | 3300016445 | Soil | MLNDKEKAQIRVVLEDEQRRLAKKSENALSYSMNH |
| Ga0190265_118577471 | 3300018422 | Soil | MLTDSEKSQIRKVLEDARQRLQRTSQNALAYSMNHERNI |
| Ga0190268_109444511 | 3300018466 | Soil | MLSQKEKEQIRGVLADELRRLAKKGESALSYSMNHE |
| Ga0190274_132698791 | 3300018476 | Soil | MLSPKEKTQIRTVLEDEQRRLVKKSENAFSYSMNHERNIGRD |
| Ga0173482_101168572 | 3300019361 | Soil | MLNQKEKGQIRAVLAEELRRLSKKAESALSYSMNHE |
| Ga0182028_13490051 | 3300019788 | Fen | MLTESEKTQIREVLRGRKASGTTGQHALSYSMNHERNHQA |
| Ga0210380_100261261 | 3300021082 | Groundwater Sediment | MLNQKEKAQIRAVLAEELRRLTKKGESALSYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0210396_117516511 | 3300021180 | Soil | MLSPKEKAQIRTVLEDEQRRLAKKSENALAYSMNHERNIGRD |
| Ga0210388_109566302 | 3300021181 | Soil | MLSPKERTQIRTVLEDEQKRLVKKSENALAYSMNHERNIGRDSID |
| Ga0210389_114911642 | 3300021404 | Soil | MLSPKEKAQIRTVLEDEQRRLAKKSENALAYSMNHERNIGRDSIDESME |
| Ga0210392_110136791 | 3300021475 | Soil | MLSTKEKAQIRAVLEEEQKRLVKKSENALSYSMNHERNIGRDSIDESMEEEIFSTE |
| Ga0242650_10131291 | 3300022503 | Soil | MLSEKEKAQIRTVLEDEQKRLARTSQNALSYSMNHERNIG |
| Ga0242670_10076082 | 3300022708 | Soil | MLSPKEKAQIRTVLEDEQRRLAKKSENALAYSMNHERNIGR |
| Ga0224524_10136231 | 3300023254 | Soil | MLTESEKAQIREVLQGAKKRLARTGQDALSYSMNHERNIGRDSIDESM |
| Ga0247796_11221272 | 3300023261 | Soil | MLSQKEKGQIRAVLAEELRRLSKKAESALSYSMNHERNIGRDSIDESMEEELFSTE |
| Ga0207653_103673942 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSQKEKNEIRKVLEEEHKRLSRTSQNALAYSMNHERNI |
| Ga0207705_107059092 | 3300025909 | Corn Rhizosphere | MLSQKEKNEIRRVLEEEQRRLSRTSQNALSYSMNHERNIGRDSIDESMEEEI |
| Ga0207707_103621581 | 3300025912 | Corn Rhizosphere | MLSQKEKNEIRRVLEEEQRRLSRTSQNALSYSMNHERNIGRDSIDESMEEEIF |
| Ga0207695_108605172 | 3300025913 | Corn Rhizosphere | MLSPKEKKEIRTVLEDEQRRLAKKSENALAYSMNHELN |
| Ga0207700_106628432 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPKEKAQIRTVLEDEQKRLARKSENALAYSMNHE |
| Ga0207667_119564222 | 3300025949 | Corn Rhizosphere | MLSQKEKNEIRRVLEDEQRRLSRTSQNALSYSMNHER |
| Ga0207640_110868351 | 3300025981 | Corn Rhizosphere | MLSQKEKNEIRKVLEEEQRRLSRTSQNALSYSMNHERNI |
| Ga0207658_119083761 | 3300025986 | Switchgrass Rhizosphere | MLSQKEKNEIRKVLEEEQRRLSRTSQNALSYSMNHERNIGRDSIDESM |
| Ga0207677_106592511 | 3300026023 | Miscanthus Rhizosphere | MLNQKEKAQIRAVLAEELRRLSKKAESALSYSMNHERNIGRDSIDESMEEELFS |
| Ga0207703_108412071 | 3300026035 | Switchgrass Rhizosphere | MLSQKEKAQIRAVLAEELKRLSKKAESALSYSMNHE |
| Ga0207648_111026982 | 3300026089 | Miscanthus Rhizosphere | MLTEKEKSQIRTVLEEQQKRLARTSQNALSYSMNHERNIGRDSIDESMEE |
| Ga0207676_107382151 | 3300026095 | Switchgrass Rhizosphere | MLSEKEKTQIRAVLEDEQRRLAKTSQNALNYSMNHERNIG |
| Ga0207698_121233961 | 3300026142 | Corn Rhizosphere | MLSPKEKAQIRTVLEDEQKRLARKSENALAYSMNHERNIGRDSIDESMEEEIFSTEMRLH |
| Ga0209849_10521441 | 3300026215 | Soil | MNEKEKKQIRQVLEEEQKRLAKTSQNALAYSMNHERNIGRDSIDESMEEEI |
| Ga0209863_102064061 | 3300026281 | Prmafrost Soil | MLSEKEKKQIRVVLEDEQKRLAKTSQNALAYSMNHERNIG |
| Ga0209167_105113952 | 3300027867 | Surface Soil | MLSEKEKKQIRAVLEDEQRRLAKTSQNALNYSMNHERNIGRDS |
| Ga0265323_100459341 | 3300028653 | Rhizosphere | MLSQTEKEQLRAVLETAKKRLAKVGQNALNYSMNHERNIGRDSIDESMEEELF |
| Ga0265323_101556721 | 3300028653 | Rhizosphere | MLTNSEKEQLRGVLEAASKRLAKVGQNALNYSMNHERNIGRDSIDESMEEEMFSTEMRLH |
| Ga0265323_102878012 | 3300028653 | Rhizosphere | MLTHSEKEQLREVLDSAKKRLAKVGQNALNYSMNHERNIGRDSIDESMEEELFSTEM |
| Ga0265338_101288613 | 3300028800 | Rhizosphere | MLTENEKARIREVLEGAKKRLARTGQDALSYSMNHERNIGRDSID |
| Ga0265338_109765741 | 3300028800 | Rhizosphere | MLSPKEKSQIRTVLEEEQKRLAKKSENALNYSMNHERN |
| Ga0311334_116528032 | 3300029987 | Fen | MLTESQKAQIRQVLEEAKKRLARTGQHALNYSMTHERNIGRDS |
| Ga0311336_109599881 | 3300029990 | Fen | MLTESEKAQIREVLEGAKQRLARTGQHALSYSMNHERNIGRDSIDESMEEEIFST |
| Ga0311336_117817471 | 3300029990 | Fen | MLSPKERAQIRTVLEDEQRRLVKKSENVLSYAMNHERNIGRDSIDESMEEEIFS |
| Ga0311349_102811712 | 3300030294 | Fen | MLTESEKAQIREVLEGAKQRLARTGQHALSYSMNHERNIGRDSIDESMEEEIFSTEMR |
| Ga0311360_109984342 | 3300030339 | Bog | MLTESEKAQIREVLEGAKKRLARTGQDALSYSMNHERN |
| Ga0302211_100933681 | 3300030491 | Fen | MLTESQKAQIRQVLEEAKKRLARTGQHALNYSMTHERNIGRDSIDESMEEEIFSTEMRLH |
| Ga0308183_11922722 | 3300030988 | Soil | MLSQKEKAQIRAVLAEELRRLSKKAESALSYSMNHERNIGRDSIDESMEEELFS |
| Ga0308189_102696472 | 3300031058 | Soil | MLSQKEKAEIRRVLEDEQRRLSRTSQNALSYSMNHERNIGRDSIDESMEEEIFS |
| Ga0308197_104530471 | 3300031093 | Soil | MLSESEKAKIRKVLEENRQKLQRTSQNALTYSMNHERNIGR |
| Ga0308181_11857822 | 3300031099 | Soil | MLSQKEKVEIRRVLEDEQRRLSRTSQNALSYSMNH |
| Ga0308180_10203792 | 3300031100 | Soil | MLSQKEKEQIRGVLADELRRLTKKAESALSYSMNHERNIGRDSIDESMEE |
| Ga0308180_10327792 | 3300031100 | Soil | MLTESEKGQIRKVLEDNKKKLTRTGQHALNYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0170824_1114883761 | 3300031231 | Forest Soil | MLSPKEKVQIRTVLEDEQRRLVKKSENALSYAMNHERNIGRDSI |
| Ga0302323_1016618692 | 3300031232 | Fen | MLTKTEKEQLQGVLETARKRLAKVGQSALNFSMNHERNIGRDSIDESMEEEIFSTE |
| Ga0302323_1030834001 | 3300031232 | Fen | MLSQPEKEQLRAVLDVAKKRLAKTGQNALNYSMNHERNIGRDSIDESMEEELFSTEMRLH |
| Ga0265316_100738843 | 3300031344 | Rhizosphere | MLSQTEKEQLRAVLETAKKRLAKVGQNALNYSMNHERNIGRDSIDESMEEELFS |
| Ga0310886_105596072 | 3300031562 | Soil | MLSPKEKAQIRAVLAEELRRLTKKAESALSYSMNHERNIGRDSIDESME |
| Ga0265313_101922492 | 3300031595 | Rhizosphere | MLSTKEKAQIRAVLEEERKRLMKKSENALSYSMNHERNIGRDSIDESMEEEIFSTEMRLHDR |
| Ga0265342_101135441 | 3300031712 | Rhizosphere | MLTESEKTQIRAVLEGAKKRLARTGQDALSYSMNHERNIGRDSIDESMEEEIFST |
| Ga0265342_105741061 | 3300031712 | Rhizosphere | MLTENEKTQIRQVLEGAKKRLVRTGQHALNYSMNHERNIGRDSIDES |
| Ga0307474_105092231 | 3300031718 | Hardwood Forest Soil | MLSPKEKTQIRTVLEDEQRRLAKKSENALAYSMNHERNIGRDSIDESMEE |
| Ga0302321_1031927552 | 3300031726 | Fen | MLSPKEKAQIRTVLEDEQRRLVKKSENALSYAMNHERNIGRDSI |
| Ga0307477_100672251 | 3300031753 | Hardwood Forest Soil | MLSEKEKKQIRAVLEDEQKRLAKTSQNALAYSMTHERTIGRDSIDESMEEEIF |
| Ga0307475_101464491 | 3300031754 | Hardwood Forest Soil | MLSEKEKKQIRAVLEDEQKRLAKTSQNALAYSMNHERNIGRDSIDE |
| Ga0318535_102989212 | 3300031764 | Soil | MLNDKEKAQIRVVLEDEQRRLAKKSENALSYSMNHERNIGRDSIDESMEEEIFSTEM |
| Ga0318520_107202462 | 3300031897 | Soil | MLSEKEKKQIRAVLEDEQRRLAKTSQNALNYSMNHERNIGRDSIDESM |
| Ga0302322_1020003172 | 3300031902 | Fen | MLTKAEKEQLLGVLEKARIRLAKVGQNALNYSMNHERNIGRDSIDESMEEEIFSTEM |
| Ga0302322_1025095641 | 3300031902 | Fen | MLTESEKAQIREVLEGAKKRLARTGQHALSYSMNHERNIGRDSIAESMEEEIFS |
| Ga0302322_1031410332 | 3300031902 | Fen | MLTEGEKAQIREVLEGAKKRLARTGQHALSYSMNHERNIGRDSIDESMEEEIFSTEM |
| Ga0311367_115794971 | 3300031918 | Fen | MLTESQKAQIRQVLEEAKKRLARTGQHALNYSMTHERNIGRDSIDESMEEEIFSTEMR |
| Ga0310912_111376981 | 3300031941 | Soil | MLSQKEKAQIRAVLEEEQKRLARKSENALSYSMNHERNIGRDSIDESMEEEIFSTEMRLHDR |
| Ga0310909_111796142 | 3300031947 | Soil | MLSPKEKTQIRTVLEDEQRRLAKKSENALAYSMNHERNIGRDSIDESMEEEIFSTEMRL |
| Ga0326597_112114002 | 3300031965 | Soil | MLSENEKGQIRKVLEDARQKLSNKSKNALSYSMNYERN |
| Ga0318569_104195531 | 3300032010 | Soil | MLSQKEKAQIRAVLEEEQKRLARKSENALSYSMNHERNIGRDSIDESME |
| Ga0310889_101037441 | 3300032179 | Soil | MLSPKEKAQIRAVLAEELRRLTKKAESALSYSMNHE |
| Ga0214472_113535381 | 3300033407 | Soil | MLSDNEKGQIRKVLEDARQRLTNKSKNALSYSMNYERNIGRDS |
| Ga0370513_180650_2_184 | 3300034161 | Untreated Peat Soil | MLTNAEKEQLGGVLETARKRLAKVGERALNYSMNHERNIGRDSIDESMEEEIFSTEMRLH |
| Ga0314780_200118_401_520 | 3300034659 | Soil | MLSESEKAKIRKVLEENRQKLQRTSQNALTYSMNHERNIG |
| Ga0314781_137970_1_129 | 3300034660 | Soil | MLTESEKSQIRKVLEQARQRLQRTSQNALNYSMNHERNIGRDS |
| Ga0373959_0110249_538_663 | 3300034820 | Rhizosphere Soil | MLNQKEKAQIRAVLAEELRRLSKKAESALSYSMNHERNIGRD |
| ⦗Top⦘ |