Basic Information | |
---|---|
Family ID | F037088 |
Family Type | Metagenome |
Number of Sequences | 168 |
Average Sequence Length | 41 residues |
Representative Sequence | EMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 14.02 % |
% of genes near scaffold ends (potentially truncated) | 85.12 % |
% of genes from short scaffolds (< 2000 bps) | 92.86 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.810 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.738 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.071 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 3.57 |
PF00072 | Response_reg | 1.79 |
PF00816 | Histone_HNS | 1.79 |
PF14237 | GYF_2 | 1.79 |
PF13629 | T2SS-T3SS_pil_N | 1.19 |
PF01527 | HTH_Tnp_1 | 1.19 |
PF14175 | YaaC | 0.60 |
PF13683 | rve_3 | 0.60 |
PF13424 | TPR_12 | 0.60 |
PF13365 | Trypsin_2 | 0.60 |
PF13557 | Phenol_MetA_deg | 0.60 |
PF00581 | Rhodanese | 0.60 |
PF14255 | Cys_rich_CPXG | 0.60 |
PF08734 | GYD | 0.60 |
PF13458 | Peripla_BP_6 | 0.60 |
PF13586 | DDE_Tnp_1_2 | 0.60 |
PF00589 | Phage_integrase | 0.60 |
PF13356 | Arm-DNA-bind_3 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.57 |
COG2916 | DNA-binding protein H-NS | Transcription [K] | 1.79 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.81 % |
Unclassified | root | N/A | 26.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10106428 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10115893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1042609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300005332|Ga0066388_100080905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3620 | Open in IMG/M |
3300005332|Ga0066388_101154369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1318 | Open in IMG/M |
3300005332|Ga0066388_102461544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 945 | Open in IMG/M |
3300005332|Ga0066388_105747439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
3300005332|Ga0066388_108373853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
3300005332|Ga0066388_108400790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
3300005332|Ga0066388_108429682 | Not Available | 513 | Open in IMG/M |
3300005713|Ga0066905_100407099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1105 | Open in IMG/M |
3300005713|Ga0066905_100642879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
3300005713|Ga0066905_100694800 | Not Available | 872 | Open in IMG/M |
3300005713|Ga0066905_100839482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 799 | Open in IMG/M |
3300005713|Ga0066905_100943926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
3300005713|Ga0066905_101070534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
3300005713|Ga0066905_101187591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 681 | Open in IMG/M |
3300005713|Ga0066905_101387955 | Not Available | 635 | Open in IMG/M |
3300005713|Ga0066905_101858682 | Not Available | 556 | Open in IMG/M |
3300005713|Ga0066905_102075862 | Not Available | 528 | Open in IMG/M |
3300005713|Ga0066905_102091692 | Not Available | 526 | Open in IMG/M |
3300005713|Ga0066905_102263749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
3300005764|Ga0066903_100130659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3530 | Open in IMG/M |
3300005764|Ga0066903_100655696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1836 | Open in IMG/M |
3300005764|Ga0066903_104019924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
3300005764|Ga0066903_105355501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300005764|Ga0066903_106514563 | Not Available | 608 | Open in IMG/M |
3300005764|Ga0066903_106594363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
3300005764|Ga0066903_106632063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
3300006028|Ga0070717_11331820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
3300006904|Ga0075424_101417490 | Not Available | 738 | Open in IMG/M |
3300010043|Ga0126380_11114801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300010043|Ga0126380_11486905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
3300010043|Ga0126380_11969260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300010046|Ga0126384_10257622 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300010046|Ga0126384_10931651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
3300010046|Ga0126384_11215134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
3300010047|Ga0126382_10788993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
3300010358|Ga0126370_10707620 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300010358|Ga0126370_12298224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
3300010359|Ga0126376_10733072 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300010360|Ga0126372_12517831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
3300010361|Ga0126378_10768751 | Not Available | 1073 | Open in IMG/M |
3300010362|Ga0126377_10784791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1010 | Open in IMG/M |
3300010366|Ga0126379_10560442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1223 | Open in IMG/M |
3300010366|Ga0126379_10954645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
3300010366|Ga0126379_11899208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
3300010376|Ga0126381_100666717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1485 | Open in IMG/M |
3300010376|Ga0126381_102571305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
3300010376|Ga0126381_102882125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
3300010376|Ga0126381_103608781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300010398|Ga0126383_10713696 | Not Available | 1082 | Open in IMG/M |
3300010398|Ga0126383_11226803 | Not Available | 840 | Open in IMG/M |
3300010398|Ga0126383_11269544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
3300010398|Ga0126383_11635550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 733 | Open in IMG/M |
3300010398|Ga0126383_12208314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
3300012948|Ga0126375_10224516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1252 | Open in IMG/M |
3300012948|Ga0126375_10543170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
3300012948|Ga0126375_10743934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
3300012948|Ga0126375_11382270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
3300012971|Ga0126369_10363281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1474 | Open in IMG/M |
3300012971|Ga0126369_11392157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
3300012971|Ga0126369_11564715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
3300012971|Ga0126369_12003692 | Not Available | 667 | Open in IMG/M |
3300012971|Ga0126369_12869542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
3300016270|Ga0182036_11346204 | Not Available | 597 | Open in IMG/M |
3300016270|Ga0182036_11905906 | Not Available | 504 | Open in IMG/M |
3300016294|Ga0182041_10718619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
3300016294|Ga0182041_10771882 | Not Available | 857 | Open in IMG/M |
3300016294|Ga0182041_11153837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
3300016294|Ga0182041_11359078 | Not Available | 651 | Open in IMG/M |
3300016294|Ga0182041_12038925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300016341|Ga0182035_12078696 | Not Available | 516 | Open in IMG/M |
3300016357|Ga0182032_10025648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3514 | Open in IMG/M |
3300016357|Ga0182032_10256359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1362 | Open in IMG/M |
3300016357|Ga0182032_10639285 | Not Available | 888 | Open in IMG/M |
3300016357|Ga0182032_11833835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
3300016371|Ga0182034_10348149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 1202 | Open in IMG/M |
3300016371|Ga0182034_10432321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1086 | Open in IMG/M |
3300016371|Ga0182034_11174890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
3300016387|Ga0182040_10778056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
3300016387|Ga0182040_11734322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300016404|Ga0182037_10476310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1043 | Open in IMG/M |
3300016422|Ga0182039_11058467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
3300016422|Ga0182039_11164815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
3300016422|Ga0182039_12189360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300016445|Ga0182038_11086736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 711 | Open in IMG/M |
3300027548|Ga0209523_1094713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
3300028047|Ga0209526_10126589 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
3300031543|Ga0318516_10617768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
3300031545|Ga0318541_10491022 | Not Available | 687 | Open in IMG/M |
3300031546|Ga0318538_10117560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C9 | 1386 | Open in IMG/M |
3300031561|Ga0318528_10057487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1979 | Open in IMG/M |
3300031572|Ga0318515_10339601 | Not Available | 805 | Open in IMG/M |
3300031573|Ga0310915_10504688 | Not Available | 859 | Open in IMG/M |
3300031668|Ga0318542_10422345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C9 | 690 | Open in IMG/M |
3300031679|Ga0318561_10278508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
3300031679|Ga0318561_10798449 | Not Available | 518 | Open in IMG/M |
3300031680|Ga0318574_10762279 | Not Available | 567 | Open in IMG/M |
3300031682|Ga0318560_10299024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300031719|Ga0306917_11009902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300031723|Ga0318493_10160996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
3300031723|Ga0318493_10504485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300031744|Ga0306918_10434549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1025 | Open in IMG/M |
3300031768|Ga0318509_10404087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 764 | Open in IMG/M |
3300031768|Ga0318509_10409539 | Not Available | 758 | Open in IMG/M |
3300031768|Ga0318509_10455876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 715 | Open in IMG/M |
3300031770|Ga0318521_10340044 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300031770|Ga0318521_10901139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
3300031771|Ga0318546_10330303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1059 | Open in IMG/M |
3300031781|Ga0318547_10306175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 966 | Open in IMG/M |
3300031796|Ga0318576_10571648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
3300031797|Ga0318550_10102552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1350 | Open in IMG/M |
3300031819|Ga0318568_10295365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1006 | Open in IMG/M |
3300031831|Ga0318564_10165409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
3300031833|Ga0310917_10239178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1220 | Open in IMG/M |
3300031833|Ga0310917_10501284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
3300031845|Ga0318511_10603415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300031860|Ga0318495_10196454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 908 | Open in IMG/M |
3300031879|Ga0306919_10717555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
3300031879|Ga0306919_11476442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300031890|Ga0306925_11734068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
3300031896|Ga0318551_10180109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1164 | Open in IMG/M |
3300031897|Ga0318520_10346351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
3300031910|Ga0306923_11440720 | Not Available | 723 | Open in IMG/M |
3300031912|Ga0306921_11012336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
3300031941|Ga0310912_10361505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
3300031941|Ga0310912_11302169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300031942|Ga0310916_10276872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1418 | Open in IMG/M |
3300031942|Ga0310916_10554730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 978 | Open in IMG/M |
3300031942|Ga0310916_10719637 | Not Available | 844 | Open in IMG/M |
3300031946|Ga0310910_10082136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2351 | Open in IMG/M |
3300031946|Ga0310910_11082700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300031947|Ga0310909_10153561 | Not Available | 1894 | Open in IMG/M |
3300031947|Ga0310909_10419533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1123 | Open in IMG/M |
3300031947|Ga0310909_11672519 | Not Available | 503 | Open in IMG/M |
3300031954|Ga0306926_10144237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2946 | Open in IMG/M |
3300031954|Ga0306926_10176211 | All Organisms → cellular organisms → Bacteria | 2652 | Open in IMG/M |
3300031954|Ga0306926_10800127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1136 | Open in IMG/M |
3300031954|Ga0306926_11374926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 820 | Open in IMG/M |
3300031954|Ga0306926_12293399 | Not Available | 598 | Open in IMG/M |
3300031954|Ga0306926_12633049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
3300031981|Ga0318531_10306077 | Not Available | 718 | Open in IMG/M |
3300032001|Ga0306922_10976428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 875 | Open in IMG/M |
3300032001|Ga0306922_11631906 | Not Available | 640 | Open in IMG/M |
3300032010|Ga0318569_10238254 | Not Available | 845 | Open in IMG/M |
3300032041|Ga0318549_10289164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300032042|Ga0318545_10015502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2370 | Open in IMG/M |
3300032042|Ga0318545_10162378 | Not Available | 795 | Open in IMG/M |
3300032044|Ga0318558_10506847 | Not Available | 602 | Open in IMG/M |
3300032051|Ga0318532_10172397 | Not Available | 768 | Open in IMG/M |
3300032051|Ga0318532_10328222 | Not Available | 543 | Open in IMG/M |
3300032066|Ga0318514_10608766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
3300032068|Ga0318553_10433232 | Not Available | 689 | Open in IMG/M |
3300032076|Ga0306924_10095681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3351 | Open in IMG/M |
3300032076|Ga0306924_10589364 | Not Available | 1259 | Open in IMG/M |
3300032091|Ga0318577_10155722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1088 | Open in IMG/M |
3300032261|Ga0306920_100664321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 1538 | Open in IMG/M |
3300032261|Ga0306920_101152000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
3300032261|Ga0306920_103274352 | Not Available | 604 | Open in IMG/M |
3300033289|Ga0310914_10244077 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300033289|Ga0310914_10441694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1177 | Open in IMG/M |
3300033289|Ga0310914_10688157 | Not Available | 918 | Open in IMG/M |
3300033290|Ga0318519_10865949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 21.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.07% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_101064281 | 3300000597 | Forest Soil | LMGLDDEVLKRYGLPRPMVDRALLEAYQTVVLNQQRNRDYS* |
AF_2010_repII_A1DRAFT_101158931 | 3300000597 | Forest Soil | FAEFKMLMTLDYEVLKPCGLPKSMAEQALIKVYETVVLDQQRNRDHA* |
AP72_2010_repI_A100DRAFT_10426091 | 3300000837 | Forest Soil | MLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQRYRDHS* |
Ga0066388_1000809058 | 3300005332 | Tropical Forest Soil | SFAEFQMLMGLDDEALKRYGLPKSIVERALKEAYQTVVLDQER* |
Ga0066388_1011543691 | 3300005332 | Tropical Forest Soil | EFTMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQRNRDHS* |
Ga0066388_1024615441 | 3300005332 | Tropical Forest Soil | EFEMLMALDDEVLKRYGLPKSMVERALIKVYETVVLGQQR* |
Ga0066388_1057474391 | 3300005332 | Tropical Forest Soil | GLDDEVLKRYGLPRPMVDRALLEAYQTVVLNQQRNRDHS* |
Ga0066388_1083738531 | 3300005332 | Tropical Forest Soil | LMGLDDEALKRYGLPKPMIERALLEAYQTVVLDQERSQSV* |
Ga0066388_1084007901 | 3300005332 | Tropical Forest Soil | FEMLMGLDDEVLKRYGLPTPMVDRALLEAYQTVVLDQQRNRDHS* |
Ga0066388_1084296821 | 3300005332 | Tropical Forest Soil | MLMFDDELLKRYGLSKPMIERALIKVYETVVFDQQRNRDHS* |
Ga0066905_1004070991 | 3300005713 | Tropical Forest Soil | EMLMGFDDEALKRYGLPKPMVERALLEAYQTVVLDQQR* |
Ga0066905_1006428791 | 3300005713 | Tropical Forest Soil | AEFEMLMGFDDGVLKRYGLPKPMVERALLEAYQTVVLDQQG* |
Ga0066905_1006948002 | 3300005713 | Tropical Forest Soil | FAEFEMMMRFDDEALKRYGLPKPMVERALLEAYQTVVLDHQR* |
Ga0066905_1008394823 | 3300005713 | Tropical Forest Soil | MLMGFNDGVLKRYGLPKPMVERALIEVYQTVVLDQQR* |
Ga0066905_1009439261 | 3300005713 | Tropical Forest Soil | MLMGLDDEVLKRYGLPKPTVERALLEVYQTVVLGQQNRDHS* |
Ga0066905_1010705343 | 3300005713 | Tropical Forest Soil | LMGLDDEALKRYGLPKPIVDRTLIEVYRTVVLDRERP* |
Ga0066905_1011875911 | 3300005713 | Tropical Forest Soil | ALKRYGLSKPMVERVLLKVYQTVVLGQQRYSDHS* |
Ga0066905_1013879551 | 3300005713 | Tropical Forest Soil | QASFAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR* |
Ga0066905_1018586822 | 3300005713 | Tropical Forest Soil | FEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRYSDHS* |
Ga0066905_1020758622 | 3300005713 | Tropical Forest Soil | MGFDDEALKRYGLPKPMVERALLEAYQTVVLDQQR* |
Ga0066905_1020916922 | 3300005713 | Tropical Forest Soil | ASFAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLGEQR* |
Ga0066905_1022637491 | 3300005713 | Tropical Forest Soil | EFEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLGWNHS* |
Ga0066903_1001306596 | 3300005764 | Tropical Forest Soil | AEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLGQQRNRDHS* |
Ga0066903_1006556965 | 3300005764 | Tropical Forest Soil | EFEMLMGLDDEVLKRYGLPTPMVDRALLEAYQTVVLDQQRNRDHS* |
Ga0066903_1040199241 | 3300005764 | Tropical Forest Soil | ARLNQHFRQASFAEFEMLMGFDDGVSKRYGLPKPMVERALLEAYQTIVLDQQR* |
Ga0066903_1053555011 | 3300005764 | Tropical Forest Soil | EEFKMLTGLDDAALKRYGLPRVMVKRAHIEVYETVVLGQQRSRDYP* |
Ga0066903_1065145633 | 3300005764 | Tropical Forest Soil | FEMLMTFDYEVLKRYGLPKSRVKRALIKVYETVVLDQQR* |
Ga0066903_1065943631 | 3300005764 | Tropical Forest Soil | RQASFAEFEMLMGLDDEALKRYGLPKPTVVRALMEAYQIVVLDPKR* |
Ga0066903_1066320632 | 3300005764 | Tropical Forest Soil | MLMVDDEILKRYGLPKPMVERALIEVYQTVVLDQQRNRDHS* |
Ga0070717_113318202 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QASFSEFEMLMGLDDEVLKRYGLPKPTVKRALLKVYQTVVLDQQR* |
Ga0075424_1014174902 | 3300006904 | Populus Rhizosphere | MSHGDDEVLKRYGLPKPMVERALMEVYQTVVLDQQR* |
Ga0126380_111148012 | 3300010043 | Tropical Forest Soil | DEALKRYGLSKPMVEQALIKVYRTVVLGQQRNRDHS* |
Ga0126380_114869052 | 3300010043 | Tropical Forest Soil | MLMGIDDGVLKRYGLPEPMVKRALIEVYQTVVLDQQR* |
Ga0126380_119692601 | 3300010043 | Tropical Forest Soil | QASFAEFEMLMGFDDGVLKRYGLPKPMVERALLEAYQTVVLDQQR* |
Ga0126384_102576221 | 3300010046 | Tropical Forest Soil | QASFAEFEMLMGVDDGVLKRYGLPKPMVKRALIEVYETVVLDQQR* |
Ga0126384_109316511 | 3300010046 | Tropical Forest Soil | MLMTLDYEVLKRCGLPKSMVERALIKVYETVVLDQQRNRDHA* |
Ga0126384_112151342 | 3300010046 | Tropical Forest Soil | AEFTMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDRQR* |
Ga0126382_107889931 | 3300010047 | Tropical Forest Soil | EVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHS* |
Ga0126370_107076201 | 3300010358 | Tropical Forest Soil | MLMIDDEALKRYGLPKPMVDRALLEAYQTVVLDQQR* |
Ga0126370_122982242 | 3300010358 | Tropical Forest Soil | QASFAEFTMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQRNRDHS* |
Ga0126376_107330721 | 3300010359 | Tropical Forest Soil | MLMGLDDEVLKRYGLPTPMVDRALLEAYQIVVLDQQRNRDHS* |
Ga0126372_125178312 | 3300010360 | Tropical Forest Soil | AVDDEALKRDGLPKSMVEQALSEVYETVVFGQERYTDHS* |
Ga0126378_107687511 | 3300010361 | Tropical Forest Soil | KMLIAFDGVLKRYGLPKSMVERALIKVYETVVLDQQR* |
Ga0126377_107847913 | 3300010362 | Tropical Forest Soil | FRQASFAEFEMLMGFDEEALKRYGLPKPMVERALLEAYQTVVLDQQR* |
Ga0126377_131149052 | 3300010362 | Tropical Forest Soil | LMGLDDEVLKRYGLPKPTVKRALLEVYQTVVLGWDHS* |
Ga0126379_105604423 | 3300010366 | Tropical Forest Soil | MLMGLDDEVWKRYRLPKPTVERALLEVYQTVVLDQQRNRDHS* |
Ga0126379_109546452 | 3300010366 | Tropical Forest Soil | MLMGLDDEVLKRYGLPKPTVERALLEVYQTVVLDQQR* |
Ga0126379_118992081 | 3300010366 | Tropical Forest Soil | EMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS* |
Ga0126381_1006667173 | 3300010376 | Tropical Forest Soil | AEFTMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQRNRDHS* |
Ga0126381_1025713053 | 3300010376 | Tropical Forest Soil | ARLNQRFRQASFAEFEMLMGLDDDVLKRYGLPKPNVVRALMEAYQTVVLDQER* |
Ga0126381_1028821251 | 3300010376 | Tropical Forest Soil | MLMGLDHEILKRYGLPKPMVEQALSEVYETVVLQQER* |
Ga0126381_1036087812 | 3300010376 | Tropical Forest Soil | LDDEALKRYGLPKPMVERALIKVYETVVLGWDHS* |
Ga0126381_1038152141 | 3300010376 | Tropical Forest Soil | MLMAFEAFDDEALKRYGLSKPMVERALLEVYQTVVLDQQRYRNHSRCGANGRS* |
Ga0126383_107136961 | 3300010398 | Tropical Forest Soil | QASFAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLGQQR* |
Ga0126383_112268031 | 3300010398 | Tropical Forest Soil | DDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS* |
Ga0126383_112695442 | 3300010398 | Tropical Forest Soil | MGFDDEVLKRYGLPKPMVERALLEVYQTVVLGYRNHS* |
Ga0126383_116355502 | 3300010398 | Tropical Forest Soil | LMGLDDEVLKRYGLPKPTVERALLEVYQTVVLGQQNRDHS* |
Ga0126383_122083141 | 3300010398 | Tropical Forest Soil | MLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQR* |
Ga0124844_13090302 | 3300010868 | Tropical Forest Soil | DEALKRYGLSKPMVERVLIKVYQTVVLGQQRYRDHS* |
Ga0126375_102245162 | 3300012948 | Tropical Forest Soil | MLMGVDDGVLKRYGLPKPMAERALIEVYETVVLGQQRYRDHS* |
Ga0126375_105431701 | 3300012948 | Tropical Forest Soil | NQHFRQASFAEFEMMMGFDDEALKRYGLPKPMVELALLEAYQTVVLDQQR* |
Ga0126375_107439341 | 3300012948 | Tropical Forest Soil | EFEMLMGLDDEVLKRYGLPKPTVKRALIQVYQTVVLDQQR* |
Ga0126375_113822702 | 3300012948 | Tropical Forest Soil | MLMGFDDEVLKRYGLPKPMVERALIKAYETVVLD* |
Ga0126369_103632811 | 3300012971 | Tropical Forest Soil | MLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQRNRDHS* |
Ga0126369_113921571 | 3300012971 | Tropical Forest Soil | LMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS* |
Ga0126369_115647151 | 3300012971 | Tropical Forest Soil | MLMAFVAFDDEALKRYGLPKPMVERALIKVYETVVLG |
Ga0126369_120036922 | 3300012971 | Tropical Forest Soil | MLMTLDYEVLKPCGLPKSMAEQALIKVYETVVLDQQRNRD |
Ga0126369_128695421 | 3300012971 | Tropical Forest Soil | MLMAFDDEVLKRYGLPKPIVERALIEVYEAVVLGYGDHF* |
Ga0182036_113462042 | 3300016270 | Soil | LDDGILKRYGLPKPMVERALIQVYQTVVLGEQIYRDHS |
Ga0182036_119059061 | 3300016270 | Soil | AEFEMLMVDDEVLKRYGLPKPMVERALIEVYHTVVLDQRRYRDHS |
Ga0182041_107186193 | 3300016294 | Soil | MLMRVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRD |
Ga0182041_107718821 | 3300016294 | Soil | EMLMVDDEVLKRYGLPKPMVERALIEVYHTVVLDQRRYRDHS |
Ga0182041_111538372 | 3300016294 | Soil | NQHFRQASFAEFEMLMVYDGVLKRYGLPKPMVERALLEAYQTVVLDQQR |
Ga0182041_113590782 | 3300016294 | Soil | LMAFDDEALKRYGLPKPMVEQALIEVYETVVLGQQRYRDHF |
Ga0182041_120389252 | 3300016294 | Soil | SFAEFEMLMEVDDRVLKRYGLPKPTVKRALIEVYQTVVLDQQR |
Ga0182035_120786962 | 3300016341 | Soil | DDEVLKRYGLPKPMVERALIEVYHTVVLDQRRYRDHS |
Ga0182032_100256481 | 3300016357 | Soil | AEFEMLMGLDDEVLKRYGLPKPTVERALLEVYQTVVLDQRR |
Ga0182032_102563593 | 3300016357 | Soil | RQASFAEFEMLMGFDDEALKRYGLPKPMVERALLEAYQTVVLDQQR |
Ga0182032_106392851 | 3300016357 | Soil | EVLKRYGLPKPMVDRALLEAYQTVVLDQQRNRDHS |
Ga0182032_118338351 | 3300016357 | Soil | ASFAEFEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLDQQRYRDHS |
Ga0182034_103481493 | 3300016371 | Soil | EFEMLMALDDEVLKRYGLLKSMVKQALIKVYETVVLDQQR |
Ga0182034_104323214 | 3300016371 | Soil | EMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLDQQRYRDHS |
Ga0182034_111748902 | 3300016371 | Soil | MGLDDEVLKRYGLPRPMVDRALLEAYQTVVLDQQS |
Ga0182040_107780563 | 3300016387 | Soil | ASFSEFEMLMGLDDEVLKRYGLPKPTVKRALLEVYQTVVLDQQR |
Ga0182040_117343222 | 3300016387 | Soil | FAEFEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS |
Ga0182037_104763103 | 3300016404 | Soil | RHASFAEFEMLMGLDDEVLKRYGLPEPMVDRALLEAYQTAVLDQQRNRDHS |
Ga0182039_110584671 | 3300016422 | Soil | LDDEALKRYGLPKPMVERALIKVYETVVLGQQRYRDHS |
Ga0182039_111648153 | 3300016422 | Soil | ASFAEFEMLMGFDDEVLKRYGLPKPMVERALLEAYQTVMLDQQR |
Ga0182039_121893602 | 3300016422 | Soil | MGVDDGVLKRYGLPKPMVERALIEVYETVVLDQQRYRDHS |
Ga0182038_110867361 | 3300016445 | Soil | MLIGLDDEVLKRYGLPKPLVDRALLEAYQTVVLDQQR |
Ga0209523_10947131 | 3300027548 | Forest Soil | MLMGLDDEVLKRYGLPKPMVERALLEAYKTVVLDQQR |
Ga0209526_101265892 | 3300028047 | Forest Soil | MLMGLDDGILKRYGLPKPMVERALIQVYQTVVLGEQRYRDHS |
Ga0318516_106177682 | 3300031543 | Soil | MLMVDDEVLKRYGLPKPMVERALIKVYQTVVLDQQRYRDHS |
Ga0318541_104910222 | 3300031545 | Soil | RDLFVFLLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS |
Ga0318538_101175603 | 3300031546 | Soil | EFEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR |
Ga0318528_100574871 | 3300031561 | Soil | MLMGFDDEVLKRYGLPKPMVERALLEVYQTVALDQQRYRDHS |
Ga0318515_103396011 | 3300031572 | Soil | TSFAEFKMLMTFDYEVLKRYGLPKSMVERALIKVYETVVLDQQR |
Ga0310915_105046881 | 3300031573 | Soil | LMVDDEVLKRYGLPKPMVERALIEVYHTVVLDQRRYRDHS |
Ga0318542_104223451 | 3300031668 | Soil | MGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR |
Ga0318561_102785083 | 3300031679 | Soil | EMLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQRYRDHS |
Ga0318561_107984492 | 3300031679 | Soil | DDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS |
Ga0318574_107622791 | 3300031680 | Soil | DGVLKRYGLPKPMAERALIEVYETVVLGQQRYRDHS |
Ga0318560_102990241 | 3300031682 | Soil | FAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR |
Ga0306917_110099023 | 3300031719 | Soil | QASFAEFEMLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQR |
Ga0318493_101609961 | 3300031723 | Soil | DEVLKRYGLPKPMVERALIKVYQTVVLDQQRYRDHS |
Ga0318493_105044853 | 3300031723 | Soil | SFSEFEMLMGLDDEVLKRYGLPKPTVKRALLEVYQTVVLDQQR |
Ga0306918_104345491 | 3300031744 | Soil | GLDDEVLKRYGLPEPMVDRALLEAYQTAVLDQQRNRDHS |
Ga0318509_104040871 | 3300031768 | Soil | ADFEMLMGFDDGVLKRYGLPKPMVERALIEVYQTVVLDQQR |
Ga0318509_104095391 | 3300031768 | Soil | RQASFAEFEMLMVDDEILKRYGLPKSMVDRALLEAYQTVVLDQPK |
Ga0318509_104558761 | 3300031768 | Soil | FKMLMTFDYEVLKRYGLPKSMVERALIKVYQTVVLDQQR |
Ga0318521_103400441 | 3300031770 | Soil | LMTFDYEVLKRYGLPKSMVERALIKVYQTVVLDQQR |
Ga0318521_109011391 | 3300031770 | Soil | FAEFEMLMALDDEVLKRYGLPKSMVKQALIKVYETVVLDQQR |
Ga0318546_103303033 | 3300031771 | Soil | LMGLDDEVLKRYGLPKTMVDRALLEAYQTVVMFNQQRNRDHS |
Ga0318547_103061751 | 3300031781 | Soil | MLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQRYRDHS |
Ga0318576_105716483 | 3300031796 | Soil | EMLMGFDDEVLKRYGLPKPMVERALLEVYQTVALDQQRYRDHS |
Ga0318550_101025521 | 3300031797 | Soil | DEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC |
Ga0318568_102953654 | 3300031819 | Soil | AEFEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC |
Ga0318564_101654091 | 3300031831 | Soil | DDEVLKRYGLPKPMVERALLEVYQAVVLDQQRYRDHS |
Ga0310917_102391784 | 3300031833 | Soil | MLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS |
Ga0310917_105012843 | 3300031833 | Soil | MGLDDEVLKRYGLPKPTVKRALLEVYQTVVLDQQR |
Ga0318511_106034151 | 3300031845 | Soil | FAEFKMLMAFDDEALKRYGLPRPMVDRALLEAYQTVVLDQQRYRDHS |
Ga0318495_101964542 | 3300031860 | Soil | MLMTFDYEVLKRYGLPKSMVERALIKVYETVVLDQQR |
Ga0306919_107175551 | 3300031879 | Soil | MGLDDEVLKRYGLPKLTVKRALIKAYETVVLDQRR |
Ga0306919_114764422 | 3300031879 | Soil | LMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQR |
Ga0306925_117340681 | 3300031890 | Soil | HFRQASFEEFKMLMTFDDEVLKRYGLPKPMVERALIKVYETVVLDQQR |
Ga0318551_101801093 | 3300031896 | Soil | FEMLMALDDEVLKRYGLPKPMVKQALIKAYETVVLDQQR |
Ga0318520_103463513 | 3300031897 | Soil | EFEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS |
Ga0306923_114407202 | 3300031910 | Soil | MGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS |
Ga0306921_110123364 | 3300031912 | Soil | MLMAFDDEALKRYGLPKPMVDRALLEAYQTIVLDR |
Ga0310912_103615053 | 3300031941 | Soil | MLMVDDEVLKRYGLPKPMVERALIKVYETVVLAQQR |
Ga0310912_113021692 | 3300031941 | Soil | FAEFEMLMGLDDEALKRYGLPKPMVERALLEAYQTVVLDQQR |
Ga0310916_102768721 | 3300031942 | Soil | AEFEMLMGLDDEALKRYGLPKPMVQRALIKVYETVVLGQQR |
Ga0310916_105547301 | 3300031942 | Soil | FRQASFAEFKMLMAFDDEALKRYGLPKPMVDRALLEAYQTIVLDR |
Ga0310916_107196372 | 3300031942 | Soil | MRVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS |
Ga0310910_100821365 | 3300031946 | Soil | RQASFAEFEMLIGLDDEVLKRYGLPKPMVDRALLEAYQTVVLDQQRYRDHS |
Ga0310910_110827001 | 3300031946 | Soil | FEMLMGFDDEILKRYGLPKPMVERALLEVYQTVVLDQQR |
Ga0310909_101535611 | 3300031947 | Soil | MGLDDEVLKRYGLPEPMVDRALLEAYQTAVLDQQRNRDHS |
Ga0310909_104195334 | 3300031947 | Soil | EFEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS |
Ga0310909_116725191 | 3300031947 | Soil | MALDDEVLKRYGLLKSMVKQALIKVYETVVLDQQR |
Ga0306926_101442375 | 3300031954 | Soil | QASFAEFEMLMALDDEVLKRYGLPKPMVKQALIKAYETVVLDQQR |
Ga0306926_101762112 | 3300031954 | Soil | MLMALDDEVLKRYGLPKPMVKQALIKAYETVVLDQQR |
Ga0306926_108001273 | 3300031954 | Soil | FDDELLKRYGLPKPMAERALIKVYETVVLGQQRYRDHS |
Ga0306926_113749263 | 3300031954 | Soil | GVLKRYGLPKPMAERALIEVYETVVLGQQRYRDHS |
Ga0306926_122933991 | 3300031954 | Soil | LDNEVLKRYGLPRPIVERALLEVYQTVVLDQQRYRGHS |
Ga0306926_126330491 | 3300031954 | Soil | DQRFRGASFAEFEMLMGLDDEALKRYGLPKPMVERALLEAYQTVVLDQQR |
Ga0318531_103060771 | 3300031981 | Soil | DDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC |
Ga0306922_109764283 | 3300032001 | Soil | LMALDDEVLKRYGLPKSMVKQALIKVYETVVLDQQR |
Ga0306922_116319061 | 3300032001 | Soil | SFAEFEMLMVDDEVLKRYGLPKPMVERALIKVYETVVLAQQR |
Ga0306922_120530101 | 3300032001 | Soil | LMVDDEVLKRYGLPKPMVERALIKVYETVVLGWDHS |
Ga0318569_102382541 | 3300032010 | Soil | LMVDDEVLKRYGLPKPMVERALLEVYQTVVLDQQR |
Ga0318549_102891642 | 3300032041 | Soil | SAEFEMLMVDDEVLKRYGLPKPMVERALIKVYQTVVLDQQRYRDHS |
Ga0318545_100155025 | 3300032042 | Soil | EMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR |
Ga0318545_101623781 | 3300032042 | Soil | EMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC |
Ga0318558_105068471 | 3300032044 | Soil | VDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS |
Ga0318532_101723971 | 3300032051 | Soil | LMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC |
Ga0318532_103282223 | 3300032051 | Soil | LMTFDDEVLKRYGLPKPMVERALIKVYETVVLDQQR |
Ga0318514_106087661 | 3300032066 | Soil | QASFAEFEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR |
Ga0318553_104332322 | 3300032068 | Soil | MMGFDDEALKRYGLPKPMVERALLEAYQTVVLDQQR |
Ga0306924_100956816 | 3300032076 | Soil | MGLDDEVLKRYGLPKPTVERALLEVYQTVVLDQQR |
Ga0306924_105893641 | 3300032076 | Soil | AEFEMLMRVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS |
Ga0318577_101557221 | 3300032091 | Soil | RQASFAEFEMMMGFDDEPLKRYGLPKPMVERALLEAYQTVVLDQQR |
Ga0306920_1006643213 | 3300032261 | Soil | MLMAFDDEVLKRYGLPKPIVERALIEVYETVVRGWDHS |
Ga0306920_1011520003 | 3300032261 | Soil | LDDEVLKRYGLPKSMVKQALIKVYETVVLDQQRNRDHS |
Ga0306920_1032743522 | 3300032261 | Soil | MLMTFDDEVLKRYGLPKPMVERALIKVYETVVLDQQR |
Ga0310914_102440771 | 3300033289 | Soil | SFAEFEMLMGFDDEVLKRYGLPKPMVERALLEAYQTVMLDQQR |
Ga0310914_104416941 | 3300033289 | Soil | SFAEFEMLMVDDEVLKRYGLPKPMVERALIKVYETVVLGWDHS |
Ga0310914_106881571 | 3300033289 | Soil | FEMLMALDDEVLKRYGLLKSMVKQALIKVYETVVLDQQR |
Ga0318519_108659491 | 3300033290 | Soil | MTFDGEILKRYGLPKSMVERVLIKVYQTVVLGQQRNRDH |
⦗Top⦘ |