NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F037088

Metagenome Family F037088

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037088
Family Type Metagenome
Number of Sequences 168
Average Sequence Length 41 residues
Representative Sequence EMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR
Number of Associated Samples 81
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 14.02 %
% of genes near scaffold ends (potentially truncated) 85.12 %
% of genes from short scaffolds (< 2000 bps) 92.86 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.810 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.738 % of family members)
Environment Ontology (ENVO) Unclassified
(58.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(66.071 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.91%    β-sheet: 0.00%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF04392ABC_sub_bind 3.57
PF00072Response_reg 1.79
PF00816Histone_HNS 1.79
PF14237GYF_2 1.79
PF13629T2SS-T3SS_pil_N 1.19
PF01527HTH_Tnp_1 1.19
PF14175YaaC 0.60
PF13683rve_3 0.60
PF13424TPR_12 0.60
PF13365Trypsin_2 0.60
PF13557Phenol_MetA_deg 0.60
PF00581Rhodanese 0.60
PF14255Cys_rich_CPXG 0.60
PF08734GYD 0.60
PF13458Peripla_BP_6 0.60
PF13586DDE_Tnp_1_2 0.60
PF00589Phage_integrase 0.60
PF13356Arm-DNA-bind_3 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 3.57
COG2916DNA-binding protein H-NSTranscription [K] 1.79
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.81 %
UnclassifiedrootN/A26.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10106428All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10115893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria655Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1042609All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300005332|Ga0066388_100080905All Organisms → cellular organisms → Bacteria → Proteobacteria3620Open in IMG/M
3300005332|Ga0066388_101154369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1318Open in IMG/M
3300005332|Ga0066388_102461544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium945Open in IMG/M
3300005332|Ga0066388_105747439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300005332|Ga0066388_108373853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300005332|Ga0066388_108400790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300005332|Ga0066388_108429682Not Available513Open in IMG/M
3300005713|Ga0066905_100407099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1105Open in IMG/M
3300005713|Ga0066905_100642879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium903Open in IMG/M
3300005713|Ga0066905_100694800Not Available872Open in IMG/M
3300005713|Ga0066905_100839482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium799Open in IMG/M
3300005713|Ga0066905_100943926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300005713|Ga0066905_101070534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium714Open in IMG/M
3300005713|Ga0066905_101187591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7681Open in IMG/M
3300005713|Ga0066905_101387955Not Available635Open in IMG/M
3300005713|Ga0066905_101858682Not Available556Open in IMG/M
3300005713|Ga0066905_102075862Not Available528Open in IMG/M
3300005713|Ga0066905_102091692Not Available526Open in IMG/M
3300005713|Ga0066905_102263749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300005764|Ga0066903_100130659All Organisms → cellular organisms → Bacteria → Proteobacteria3530Open in IMG/M
3300005764|Ga0066903_100655696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1836Open in IMG/M
3300005764|Ga0066903_104019924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium788Open in IMG/M
3300005764|Ga0066903_105355501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300005764|Ga0066903_106514563Not Available608Open in IMG/M
3300005764|Ga0066903_106594363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300005764|Ga0066903_106632063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300006028|Ga0070717_11331820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300006904|Ga0075424_101417490Not Available738Open in IMG/M
3300010043|Ga0126380_11114801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300010043|Ga0126380_11486905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300010043|Ga0126380_11969260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300010046|Ga0126384_10257622All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300010046|Ga0126384_10931651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium787Open in IMG/M
3300010046|Ga0126384_11215134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300010047|Ga0126382_10788993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium808Open in IMG/M
3300010358|Ga0126370_10707620All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300010358|Ga0126370_12298224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300010359|Ga0126376_10733072All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300010360|Ga0126372_12517831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300010361|Ga0126378_10768751Not Available1073Open in IMG/M
3300010362|Ga0126377_10784791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1010Open in IMG/M
3300010366|Ga0126379_10560442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1223Open in IMG/M
3300010366|Ga0126379_10954645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium961Open in IMG/M
3300010366|Ga0126379_11899208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300010376|Ga0126381_100666717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1485Open in IMG/M
3300010376|Ga0126381_102571305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium729Open in IMG/M
3300010376|Ga0126381_102882125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium685Open in IMG/M
3300010376|Ga0126381_103608781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300010398|Ga0126383_10713696Not Available1082Open in IMG/M
3300010398|Ga0126383_11226803Not Available840Open in IMG/M
3300010398|Ga0126383_11269544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300010398|Ga0126383_11635550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium733Open in IMG/M
3300010398|Ga0126383_12208314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300012948|Ga0126375_10224516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1252Open in IMG/M
3300012948|Ga0126375_10543170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium876Open in IMG/M
3300012948|Ga0126375_10743934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium769Open in IMG/M
3300012948|Ga0126375_11382270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300012971|Ga0126369_10363281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1474Open in IMG/M
3300012971|Ga0126369_11392157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300012971|Ga0126369_11564715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300012971|Ga0126369_12003692Not Available667Open in IMG/M
3300012971|Ga0126369_12869542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300016270|Ga0182036_11346204Not Available597Open in IMG/M
3300016270|Ga0182036_11905906Not Available504Open in IMG/M
3300016294|Ga0182041_10718619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium887Open in IMG/M
3300016294|Ga0182041_10771882Not Available857Open in IMG/M
3300016294|Ga0182041_11153837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium705Open in IMG/M
3300016294|Ga0182041_11359078Not Available651Open in IMG/M
3300016294|Ga0182041_12038925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300016341|Ga0182035_12078696Not Available516Open in IMG/M
3300016357|Ga0182032_10025648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3514Open in IMG/M
3300016357|Ga0182032_10256359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1362Open in IMG/M
3300016357|Ga0182032_10639285Not Available888Open in IMG/M
3300016357|Ga0182032_11833835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300016371|Ga0182034_10348149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017)1202Open in IMG/M
3300016371|Ga0182034_10432321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1086Open in IMG/M
3300016371|Ga0182034_11174890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium667Open in IMG/M
3300016387|Ga0182040_10778056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium787Open in IMG/M
3300016387|Ga0182040_11734322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300016404|Ga0182037_10476310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1043Open in IMG/M
3300016422|Ga0182039_11058467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium729Open in IMG/M
3300016422|Ga0182039_11164815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300016422|Ga0182039_12189360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300016445|Ga0182038_11086736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium711Open in IMG/M
3300027548|Ga0209523_1094713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300028047|Ga0209526_10126589All Organisms → cellular organisms → Bacteria1794Open in IMG/M
3300031543|Ga0318516_10617768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300031545|Ga0318541_10491022Not Available687Open in IMG/M
3300031546|Ga0318538_10117560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C91386Open in IMG/M
3300031561|Ga0318528_10057487All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1979Open in IMG/M
3300031572|Ga0318515_10339601Not Available805Open in IMG/M
3300031573|Ga0310915_10504688Not Available859Open in IMG/M
3300031668|Ga0318542_10422345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C9690Open in IMG/M
3300031679|Ga0318561_10278508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300031679|Ga0318561_10798449Not Available518Open in IMG/M
3300031680|Ga0318574_10762279Not Available567Open in IMG/M
3300031682|Ga0318560_10299024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300031719|Ga0306917_11009902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300031723|Ga0318493_10160996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1167Open in IMG/M
3300031723|Ga0318493_10504485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300031744|Ga0306918_10434549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1025Open in IMG/M
3300031768|Ga0318509_10404087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales764Open in IMG/M
3300031768|Ga0318509_10409539Not Available758Open in IMG/M
3300031768|Ga0318509_10455876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium715Open in IMG/M
3300031770|Ga0318521_10340044All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300031770|Ga0318521_10901139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300031771|Ga0318546_10330303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1059Open in IMG/M
3300031781|Ga0318547_10306175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium966Open in IMG/M
3300031796|Ga0318576_10571648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300031797|Ga0318550_10102552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1350Open in IMG/M
3300031819|Ga0318568_10295365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1006Open in IMG/M
3300031831|Ga0318564_10165409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium987Open in IMG/M
3300031833|Ga0310917_10239178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1220Open in IMG/M
3300031833|Ga0310917_10501284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium826Open in IMG/M
3300031845|Ga0318511_10603415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031860|Ga0318495_10196454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium908Open in IMG/M
3300031879|Ga0306919_10717555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium770Open in IMG/M
3300031879|Ga0306919_11476442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031890|Ga0306925_11734068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300031896|Ga0318551_10180109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1164Open in IMG/M
3300031897|Ga0318520_10346351All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium901Open in IMG/M
3300031910|Ga0306923_11440720Not Available723Open in IMG/M
3300031912|Ga0306921_11012336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria936Open in IMG/M
3300031941|Ga0310912_10361505All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1128Open in IMG/M
3300031941|Ga0310912_11302169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300031942|Ga0310916_10276872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1418Open in IMG/M
3300031942|Ga0310916_10554730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales978Open in IMG/M
3300031942|Ga0310916_10719637Not Available844Open in IMG/M
3300031946|Ga0310910_10082136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2351Open in IMG/M
3300031946|Ga0310910_11082700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300031947|Ga0310909_10153561Not Available1894Open in IMG/M
3300031947|Ga0310909_10419533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1123Open in IMG/M
3300031947|Ga0310909_11672519Not Available503Open in IMG/M
3300031954|Ga0306926_10144237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2946Open in IMG/M
3300031954|Ga0306926_10176211All Organisms → cellular organisms → Bacteria2652Open in IMG/M
3300031954|Ga0306926_10800127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1136Open in IMG/M
3300031954|Ga0306926_11374926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium820Open in IMG/M
3300031954|Ga0306926_12293399Not Available598Open in IMG/M
3300031954|Ga0306926_12633049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300031981|Ga0318531_10306077Not Available718Open in IMG/M
3300032001|Ga0306922_10976428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium875Open in IMG/M
3300032001|Ga0306922_11631906Not Available640Open in IMG/M
3300032010|Ga0318569_10238254Not Available845Open in IMG/M
3300032041|Ga0318549_10289164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300032042|Ga0318545_10015502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2370Open in IMG/M
3300032042|Ga0318545_10162378Not Available795Open in IMG/M
3300032044|Ga0318558_10506847Not Available602Open in IMG/M
3300032051|Ga0318532_10172397Not Available768Open in IMG/M
3300032051|Ga0318532_10328222Not Available543Open in IMG/M
3300032066|Ga0318514_10608766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300032068|Ga0318553_10433232Not Available689Open in IMG/M
3300032076|Ga0306924_10095681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3351Open in IMG/M
3300032076|Ga0306924_10589364Not Available1259Open in IMG/M
3300032091|Ga0318577_10155722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1088Open in IMG/M
3300032261|Ga0306920_100664321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.1538Open in IMG/M
3300032261|Ga0306920_101152000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1122Open in IMG/M
3300032261|Ga0306920_103274352Not Available604Open in IMG/M
3300033289|Ga0310914_10244077All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300033289|Ga0310914_10441694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1177Open in IMG/M
3300033289|Ga0310914_10688157Not Available918Open in IMG/M
3300033290|Ga0318519_10865949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil21.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil16.07%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.79%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1010642813300000597Forest SoilLMGLDDEVLKRYGLPRPMVDRALLEAYQTVVLNQQRNRDYS*
AF_2010_repII_A1DRAFT_1011589313300000597Forest SoilFAEFKMLMTLDYEVLKPCGLPKSMAEQALIKVYETVVLDQQRNRDHA*
AP72_2010_repI_A100DRAFT_104260913300000837Forest SoilMLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQRYRDHS*
Ga0066388_10008090583300005332Tropical Forest SoilSFAEFQMLMGLDDEALKRYGLPKSIVERALKEAYQTVVLDQER*
Ga0066388_10115436913300005332Tropical Forest SoilEFTMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQRNRDHS*
Ga0066388_10246154413300005332Tropical Forest SoilEFEMLMALDDEVLKRYGLPKSMVERALIKVYETVVLGQQR*
Ga0066388_10574743913300005332Tropical Forest SoilGLDDEVLKRYGLPRPMVDRALLEAYQTVVLNQQRNRDHS*
Ga0066388_10837385313300005332Tropical Forest SoilLMGLDDEALKRYGLPKPMIERALLEAYQTVVLDQERSQSV*
Ga0066388_10840079013300005332Tropical Forest SoilFEMLMGLDDEVLKRYGLPTPMVDRALLEAYQTVVLDQQRNRDHS*
Ga0066388_10842968213300005332Tropical Forest SoilMLMFDDELLKRYGLSKPMIERALIKVYETVVFDQQRNRDHS*
Ga0066905_10040709913300005713Tropical Forest SoilEMLMGFDDEALKRYGLPKPMVERALLEAYQTVVLDQQR*
Ga0066905_10064287913300005713Tropical Forest SoilAEFEMLMGFDDGVLKRYGLPKPMVERALLEAYQTVVLDQQG*
Ga0066905_10069480023300005713Tropical Forest SoilFAEFEMMMRFDDEALKRYGLPKPMVERALLEAYQTVVLDHQR*
Ga0066905_10083948233300005713Tropical Forest SoilMLMGFNDGVLKRYGLPKPMVERALIEVYQTVVLDQQR*
Ga0066905_10094392613300005713Tropical Forest SoilMLMGLDDEVLKRYGLPKPTVERALLEVYQTVVLGQQNRDHS*
Ga0066905_10107053433300005713Tropical Forest SoilLMGLDDEALKRYGLPKPIVDRTLIEVYRTVVLDRERP*
Ga0066905_10118759113300005713Tropical Forest SoilALKRYGLSKPMVERVLLKVYQTVVLGQQRYSDHS*
Ga0066905_10138795513300005713Tropical Forest SoilQASFAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR*
Ga0066905_10185868223300005713Tropical Forest SoilFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRYSDHS*
Ga0066905_10207586223300005713Tropical Forest SoilMGFDDEALKRYGLPKPMVERALLEAYQTVVLDQQR*
Ga0066905_10209169223300005713Tropical Forest SoilASFAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLGEQR*
Ga0066905_10226374913300005713Tropical Forest SoilEFEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLGWNHS*
Ga0066903_10013065963300005764Tropical Forest SoilAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLGQQRNRDHS*
Ga0066903_10065569653300005764Tropical Forest SoilEFEMLMGLDDEVLKRYGLPTPMVDRALLEAYQTVVLDQQRNRDHS*
Ga0066903_10401992413300005764Tropical Forest SoilARLNQHFRQASFAEFEMLMGFDDGVSKRYGLPKPMVERALLEAYQTIVLDQQR*
Ga0066903_10535550113300005764Tropical Forest SoilEEFKMLTGLDDAALKRYGLPRVMVKRAHIEVYETVVLGQQRSRDYP*
Ga0066903_10651456333300005764Tropical Forest SoilFEMLMTFDYEVLKRYGLPKSRVKRALIKVYETVVLDQQR*
Ga0066903_10659436313300005764Tropical Forest SoilRQASFAEFEMLMGLDDEALKRYGLPKPTVVRALMEAYQIVVLDPKR*
Ga0066903_10663206323300005764Tropical Forest SoilMLMVDDEILKRYGLPKPMVERALIEVYQTVVLDQQRNRDHS*
Ga0070717_1133182023300006028Corn, Switchgrass And Miscanthus RhizosphereQASFSEFEMLMGLDDEVLKRYGLPKPTVKRALLKVYQTVVLDQQR*
Ga0075424_10141749023300006904Populus RhizosphereMSHGDDEVLKRYGLPKPMVERALMEVYQTVVLDQQR*
Ga0126380_1111480123300010043Tropical Forest SoilDEALKRYGLSKPMVEQALIKVYRTVVLGQQRNRDHS*
Ga0126380_1148690523300010043Tropical Forest SoilMLMGIDDGVLKRYGLPEPMVKRALIEVYQTVVLDQQR*
Ga0126380_1196926013300010043Tropical Forest SoilQASFAEFEMLMGFDDGVLKRYGLPKPMVERALLEAYQTVVLDQQR*
Ga0126384_1025762213300010046Tropical Forest SoilQASFAEFEMLMGVDDGVLKRYGLPKPMVKRALIEVYETVVLDQQR*
Ga0126384_1093165113300010046Tropical Forest SoilMLMTLDYEVLKRCGLPKSMVERALIKVYETVVLDQQRNRDHA*
Ga0126384_1121513423300010046Tropical Forest SoilAEFTMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDRQR*
Ga0126382_1078899313300010047Tropical Forest SoilEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHS*
Ga0126370_1070762013300010358Tropical Forest SoilMLMIDDEALKRYGLPKPMVDRALLEAYQTVVLDQQR*
Ga0126370_1229822423300010358Tropical Forest SoilQASFAEFTMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQRNRDHS*
Ga0126376_1073307213300010359Tropical Forest SoilMLMGLDDEVLKRYGLPTPMVDRALLEAYQIVVLDQQRNRDHS*
Ga0126372_1251783123300010360Tropical Forest SoilAVDDEALKRDGLPKSMVEQALSEVYETVVFGQERYTDHS*
Ga0126378_1076875113300010361Tropical Forest SoilKMLIAFDGVLKRYGLPKSMVERALIKVYETVVLDQQR*
Ga0126377_1078479133300010362Tropical Forest SoilFRQASFAEFEMLMGFDEEALKRYGLPKPMVERALLEAYQTVVLDQQR*
Ga0126377_1311490523300010362Tropical Forest SoilLMGLDDEVLKRYGLPKPTVKRALLEVYQTVVLGWDHS*
Ga0126379_1056044233300010366Tropical Forest SoilMLMGLDDEVWKRYRLPKPTVERALLEVYQTVVLDQQRNRDHS*
Ga0126379_1095464523300010366Tropical Forest SoilMLMGLDDEVLKRYGLPKPTVERALLEVYQTVVLDQQR*
Ga0126379_1189920813300010366Tropical Forest SoilEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS*
Ga0126381_10066671733300010376Tropical Forest SoilAEFTMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQRNRDHS*
Ga0126381_10257130533300010376Tropical Forest SoilARLNQRFRQASFAEFEMLMGLDDDVLKRYGLPKPNVVRALMEAYQTVVLDQER*
Ga0126381_10288212513300010376Tropical Forest SoilMLMGLDHEILKRYGLPKPMVEQALSEVYETVVLQQER*
Ga0126381_10360878123300010376Tropical Forest SoilLDDEALKRYGLPKPMVERALIKVYETVVLGWDHS*
Ga0126381_10381521413300010376Tropical Forest SoilMLMAFEAFDDEALKRYGLSKPMVERALLEVYQTVVLDQQRYRNHSRCGANGRS*
Ga0126383_1071369613300010398Tropical Forest SoilQASFAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLGQQR*
Ga0126383_1122680313300010398Tropical Forest SoilDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS*
Ga0126383_1126954423300010398Tropical Forest SoilMGFDDEVLKRYGLPKPMVERALLEVYQTVVLGYRNHS*
Ga0126383_1163555023300010398Tropical Forest SoilLMGLDDEVLKRYGLPKPTVERALLEVYQTVVLGQQNRDHS*
Ga0126383_1220831413300010398Tropical Forest SoilMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQR*
Ga0124844_130903023300010868Tropical Forest SoilDEALKRYGLSKPMVERVLIKVYQTVVLGQQRYRDHS*
Ga0126375_1022451623300012948Tropical Forest SoilMLMGVDDGVLKRYGLPKPMAERALIEVYETVVLGQQRYRDHS*
Ga0126375_1054317013300012948Tropical Forest SoilNQHFRQASFAEFEMMMGFDDEALKRYGLPKPMVELALLEAYQTVVLDQQR*
Ga0126375_1074393413300012948Tropical Forest SoilEFEMLMGLDDEVLKRYGLPKPTVKRALIQVYQTVVLDQQR*
Ga0126375_1138227023300012948Tropical Forest SoilMLMGFDDEVLKRYGLPKPMVERALIKAYETVVLD*
Ga0126369_1036328113300012971Tropical Forest SoilMLMTFDDEVLKRYGLPKSMVERALIKVYETVVLDQQRNRDHS*
Ga0126369_1139215713300012971Tropical Forest SoilLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS*
Ga0126369_1156471513300012971Tropical Forest SoilMLMAFVAFDDEALKRYGLPKPMVERALIKVYETVVLG
Ga0126369_1200369223300012971Tropical Forest SoilMLMTLDYEVLKPCGLPKSMAEQALIKVYETVVLDQQRNRD
Ga0126369_1286954213300012971Tropical Forest SoilMLMAFDDEVLKRYGLPKPIVERALIEVYEAVVLGYGDHF*
Ga0182036_1134620423300016270SoilLDDGILKRYGLPKPMVERALIQVYQTVVLGEQIYRDHS
Ga0182036_1190590613300016270SoilAEFEMLMVDDEVLKRYGLPKPMVERALIEVYHTVVLDQRRYRDHS
Ga0182041_1071861933300016294SoilMLMRVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRD
Ga0182041_1077188213300016294SoilEMLMVDDEVLKRYGLPKPMVERALIEVYHTVVLDQRRYRDHS
Ga0182041_1115383723300016294SoilNQHFRQASFAEFEMLMVYDGVLKRYGLPKPMVERALLEAYQTVVLDQQR
Ga0182041_1135907823300016294SoilLMAFDDEALKRYGLPKPMVEQALIEVYETVVLGQQRYRDHF
Ga0182041_1203892523300016294SoilSFAEFEMLMEVDDRVLKRYGLPKPTVKRALIEVYQTVVLDQQR
Ga0182035_1207869623300016341SoilDDEVLKRYGLPKPMVERALIEVYHTVVLDQRRYRDHS
Ga0182032_1002564813300016357SoilAEFEMLMGLDDEVLKRYGLPKPTVERALLEVYQTVVLDQRR
Ga0182032_1025635933300016357SoilRQASFAEFEMLMGFDDEALKRYGLPKPMVERALLEAYQTVVLDQQR
Ga0182032_1063928513300016357SoilEVLKRYGLPKPMVDRALLEAYQTVVLDQQRNRDHS
Ga0182032_1183383513300016357SoilASFAEFEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLDQQRYRDHS
Ga0182034_1034814933300016371SoilEFEMLMALDDEVLKRYGLLKSMVKQALIKVYETVVLDQQR
Ga0182034_1043232143300016371SoilEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLDQQRYRDHS
Ga0182034_1117489023300016371SoilMGLDDEVLKRYGLPRPMVDRALLEAYQTVVLDQQS
Ga0182040_1077805633300016387SoilASFSEFEMLMGLDDEVLKRYGLPKPTVKRALLEVYQTVVLDQQR
Ga0182040_1173432223300016387SoilFAEFEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS
Ga0182037_1047631033300016404SoilRHASFAEFEMLMGLDDEVLKRYGLPEPMVDRALLEAYQTAVLDQQRNRDHS
Ga0182039_1105846713300016422SoilLDDEALKRYGLPKPMVERALIKVYETVVLGQQRYRDHS
Ga0182039_1116481533300016422SoilASFAEFEMLMGFDDEVLKRYGLPKPMVERALLEAYQTVMLDQQR
Ga0182039_1218936023300016422SoilMGVDDGVLKRYGLPKPMVERALIEVYETVVLDQQRYRDHS
Ga0182038_1108673613300016445SoilMLIGLDDEVLKRYGLPKPLVDRALLEAYQTVVLDQQR
Ga0209523_109471313300027548Forest SoilMLMGLDDEVLKRYGLPKPMVERALLEAYKTVVLDQQR
Ga0209526_1012658923300028047Forest SoilMLMGLDDGILKRYGLPKPMVERALIQVYQTVVLGEQRYRDHS
Ga0318516_1061776823300031543SoilMLMVDDEVLKRYGLPKPMVERALIKVYQTVVLDQQRYRDHS
Ga0318541_1049102223300031545SoilRDLFVFLLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS
Ga0318538_1011756033300031546SoilEFEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR
Ga0318528_1005748713300031561SoilMLMGFDDEVLKRYGLPKPMVERALLEVYQTVALDQQRYRDHS
Ga0318515_1033960113300031572SoilTSFAEFKMLMTFDYEVLKRYGLPKSMVERALIKVYETVVLDQQR
Ga0310915_1050468813300031573SoilLMVDDEVLKRYGLPKPMVERALIEVYHTVVLDQRRYRDHS
Ga0318542_1042234513300031668SoilMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR
Ga0318561_1027850833300031679SoilEMLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQRYRDHS
Ga0318561_1079844923300031679SoilDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS
Ga0318574_1076227913300031680SoilDGVLKRYGLPKPMAERALIEVYETVVLGQQRYRDHS
Ga0318560_1029902413300031682SoilFAEFEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR
Ga0306917_1100990233300031719SoilQASFAEFEMLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQR
Ga0318493_1016099613300031723SoilDEVLKRYGLPKPMVERALIKVYQTVVLDQQRYRDHS
Ga0318493_1050448533300031723SoilSFSEFEMLMGLDDEVLKRYGLPKPTVKRALLEVYQTVVLDQQR
Ga0306918_1043454913300031744SoilGLDDEVLKRYGLPEPMVDRALLEAYQTAVLDQQRNRDHS
Ga0318509_1040408713300031768SoilADFEMLMGFDDGVLKRYGLPKPMVERALIEVYQTVVLDQQR
Ga0318509_1040953913300031768SoilRQASFAEFEMLMVDDEILKRYGLPKSMVDRALLEAYQTVVLDQPK
Ga0318509_1045587613300031768SoilFKMLMTFDYEVLKRYGLPKSMVERALIKVYQTVVLDQQR
Ga0318521_1034004413300031770SoilLMTFDYEVLKRYGLPKSMVERALIKVYQTVVLDQQR
Ga0318521_1090113913300031770SoilFAEFEMLMALDDEVLKRYGLPKSMVKQALIKVYETVVLDQQR
Ga0318546_1033030333300031771SoilLMGLDDEVLKRYGLPKTMVDRALLEAYQTVVMFNQQRNRDHS
Ga0318547_1030617513300031781SoilMLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQRYRDHS
Ga0318576_1057164833300031796SoilEMLMGFDDEVLKRYGLPKPMVERALLEVYQTVALDQQRYRDHS
Ga0318550_1010255213300031797SoilDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC
Ga0318568_1029536543300031819SoilAEFEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC
Ga0318564_1016540913300031831SoilDDEVLKRYGLPKPMVERALLEVYQAVVLDQQRYRDHS
Ga0310917_1023917843300031833SoilMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS
Ga0310917_1050128433300031833SoilMGLDDEVLKRYGLPKPTVKRALLEVYQTVVLDQQR
Ga0318511_1060341513300031845SoilFAEFKMLMAFDDEALKRYGLPRPMVDRALLEAYQTVVLDQQRYRDHS
Ga0318495_1019645423300031860SoilMLMTFDYEVLKRYGLPKSMVERALIKVYETVVLDQQR
Ga0306919_1071755513300031879SoilMGLDDEVLKRYGLPKLTVKRALIKAYETVVLDQRR
Ga0306919_1147644223300031879SoilLMGFDDEVLKRYGLPKPMVERALLEVYQTVVLDQQR
Ga0306925_1173406813300031890SoilHFRQASFEEFKMLMTFDDEVLKRYGLPKPMVERALIKVYETVVLDQQR
Ga0318551_1018010933300031896SoilFEMLMALDDEVLKRYGLPKPMVKQALIKAYETVVLDQQR
Ga0318520_1034635133300031897SoilEFEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS
Ga0306923_1144072023300031910SoilMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS
Ga0306921_1101233643300031912SoilMLMAFDDEALKRYGLPKPMVDRALLEAYQTIVLDR
Ga0310912_1036150533300031941SoilMLMVDDEVLKRYGLPKPMVERALIKVYETVVLAQQR
Ga0310912_1130216923300031941SoilFAEFEMLMGLDDEALKRYGLPKPMVERALLEAYQTVVLDQQR
Ga0310916_1027687213300031942SoilAEFEMLMGLDDEALKRYGLPKPMVQRALIKVYETVVLGQQR
Ga0310916_1055473013300031942SoilFRQASFAEFKMLMAFDDEALKRYGLPKPMVDRALLEAYQTIVLDR
Ga0310916_1071963723300031942SoilMRVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS
Ga0310910_1008213653300031946SoilRQASFAEFEMLIGLDDEVLKRYGLPKPMVDRALLEAYQTVVLDQQRYRDHS
Ga0310910_1108270013300031946SoilFEMLMGFDDEILKRYGLPKPMVERALLEVYQTVVLDQQR
Ga0310909_1015356113300031947SoilMGLDDEVLKRYGLPEPMVDRALLEAYQTAVLDQQRNRDHS
Ga0310909_1041953343300031947SoilEFEMLMGVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRNHS
Ga0310909_1167251913300031947SoilMALDDEVLKRYGLLKSMVKQALIKVYETVVLDQQR
Ga0306926_1014423753300031954SoilQASFAEFEMLMALDDEVLKRYGLPKPMVKQALIKAYETVVLDQQR
Ga0306926_1017621123300031954SoilMLMALDDEVLKRYGLPKPMVKQALIKAYETVVLDQQR
Ga0306926_1080012733300031954SoilFDDELLKRYGLPKPMAERALIKVYETVVLGQQRYRDHS
Ga0306926_1137492633300031954SoilGVLKRYGLPKPMAERALIEVYETVVLGQQRYRDHS
Ga0306926_1229339913300031954SoilLDNEVLKRYGLPRPIVERALLEVYQTVVLDQQRYRGHS
Ga0306926_1263304913300031954SoilDQRFRGASFAEFEMLMGLDDEALKRYGLPKPMVERALLEAYQTVVLDQQR
Ga0318531_1030607713300031981SoilDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC
Ga0306922_1097642833300032001SoilLMALDDEVLKRYGLPKSMVKQALIKVYETVVLDQQR
Ga0306922_1163190613300032001SoilSFAEFEMLMVDDEVLKRYGLPKPMVERALIKVYETVVLAQQR
Ga0306922_1205301013300032001SoilLMVDDEVLKRYGLPKPMVERALIKVYETVVLGWDHS
Ga0318569_1023825413300032010SoilLMVDDEVLKRYGLPKPMVERALLEVYQTVVLDQQR
Ga0318549_1028916423300032041SoilSAEFEMLMVDDEVLKRYGLPKPMVERALIKVYQTVVLDQQRYRDHS
Ga0318545_1001550253300032042SoilEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR
Ga0318545_1016237813300032042SoilEMLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC
Ga0318558_1050684713300032044SoilVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS
Ga0318532_1017239713300032051SoilLMVDDEVLKRYGLPKPMVERALIEVYQTVVLDQQRWRDHC
Ga0318532_1032822233300032051SoilLMTFDDEVLKRYGLPKPMVERALIKVYETVVLDQQR
Ga0318514_1060876613300032066SoilQASFAEFEMLMGFDDEVLKRYGLPKPMVERALIEVYQTVVLDQQR
Ga0318553_1043323223300032068SoilMMGFDDEALKRYGLPKPMVERALLEAYQTVVLDQQR
Ga0306924_1009568163300032076SoilMGLDDEVLKRYGLPKPTVERALLEVYQTVVLDQQR
Ga0306924_1058936413300032076SoilAEFEMLMRVDDGVLKRYGLPKPMVERALIEVYETVVLGQQRYRDHS
Ga0318577_1015572213300032091SoilRQASFAEFEMMMGFDDEPLKRYGLPKPMVERALLEAYQTVVLDQQR
Ga0306920_10066432133300032261SoilMLMAFDDEVLKRYGLPKPIVERALIEVYETVVRGWDHS
Ga0306920_10115200033300032261SoilLDDEVLKRYGLPKSMVKQALIKVYETVVLDQQRNRDHS
Ga0306920_10327435223300032261SoilMLMTFDDEVLKRYGLPKPMVERALIKVYETVVLDQQR
Ga0310914_1024407713300033289SoilSFAEFEMLMGFDDEVLKRYGLPKPMVERALLEAYQTVMLDQQR
Ga0310914_1044169413300033289SoilSFAEFEMLMVDDEVLKRYGLPKPMVERALIKVYETVVLGWDHS
Ga0310914_1068815713300033289SoilFEMLMALDDEVLKRYGLLKSMVKQALIKVYETVVLDQQR
Ga0318519_1086594913300033290SoilMTFDGEILKRYGLPKSMVERVLIKVYQTVVLGQQRNRDH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.