Metagenome Family F037086

Overview

Basic Information

• Family ID: F037086
• Family Type: Metagenome
• Number of Sequences: 168
• Average Sequence Length: 41 residues
• Representative Sequence: MSDFKAKMHQIQFRLGLRPRPRWGSLQRSPDPLAGFKGPTS
• Number of Associated Samples: 65
• Number of Associated Scaffolds: 168

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 10.53 %
• % of genes near scaffold ends (potentially truncated): 64.29 %
• % of genes from short scaffolds (< 2000 bps): 55.36 %
• Associated GOLD sequencing projects: 52
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (94.048 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (47.024 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 21.74%
  β-sheet: 0.00%
  Coil/Unstructured: 78.26%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 168 Family Scaffolds
PF00078	RVT_1	1.19
PF06991	MFAP1	0.60
PF12796	Ank_2	0.60

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
All Organisms	root	All Organisms	5.95 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
cellular organisms	root	All Organisms → cellular organisms	5.95 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.95 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5.36 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.60 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	2.38 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.60 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	2.38 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.60 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.79 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.60 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	0.60 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.79 %
Hydrozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa	0.60 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.60 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.19 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	0.60 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.60 %
Hydroidolina	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina	0.60 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.19 %
Anthoathecata	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata	0.60 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	0.60 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.60 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.19 %
Aplanulata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata	0.60 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.60 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.60 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.60 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.60 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	0.60 %
Hydridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae	0.60 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Sedentaria	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria	0.60 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.60 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.60 %
Hydra	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra	0.60 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.60 %
Scolecida	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida	0.60 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.60 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.60 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.60 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.60 %
Capitellidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae	0.60 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.60 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.60 %
Caryophyllales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales	0.60 %
Capitella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella	0.60 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.60 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.60 %
Chenopodiaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae	0.60 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.60 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.60 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Betoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae → Betoideae	0.60 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.60 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.60 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.60 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Beta	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae → Betoideae → Beta	0.60 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.60 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.60 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.60 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Beta vulgaris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae → Betoideae → Beta → Beta vulgaris	0.60 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.60 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.60 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.60 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.05 %
Beta vulgaris subsp. vulgaris	subspecies	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae → Betoideae → Beta → Beta vulgaris → Beta vulgaris subsp. vulgaris	0.60 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.60 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.60 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.60 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001742|JGI24673J20094_10008333	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	1902
3300001742|JGI24673J20094_10018816	Not Available	1410
3300001746|JGI24672J20091_10033938	Not Available	908
3300003772|Ga0049094_10010370	Not Available	2819
3300003774|Ga0049095_10069905	Not Available	939
3300003853|Ga0049113_10235004	Not Available	580
3300004086|Ga0066191_10289741	Not Available	574
3300004630|Ga0049105_1026720	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4133
3300004630|Ga0049105_1295241	Not Available	722
3300004632|Ga0049107_10023900	Not Available	3778
3300004632|Ga0049107_10127095	Not Available	1805
3300004632|Ga0049107_10275408	Not Available	1081
3300004632|Ga0049107_10295725	Not Available	1021
3300004632|Ga0049107_10357717	Not Available	869
3300005170|Ga0071327_1340588	Not Available	591
3300005648|Ga0056131_1038451	Not Available	2677
3300005648|Ga0056131_1346498	Not Available	513
3300005649|Ga0056116_1033838	Not Available	3151
3300005652|Ga0056135_10067099	Not Available	1971
3300005653|Ga0056133_10280692	Not Available	946
3300005653|Ga0056133_10466077	Not Available	630
3300005871|Ga0056124_1015228	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4098
3300005871|Ga0056124_1016039	Not Available	4009
3300005871|Ga0056124_1023485	Not Available	3389
3300005871|Ga0056124_1276219	Not Available	533
3300005968|Ga0056130_1093110	Not Available	1447
3300005968|Ga0056130_1287402	Not Available	606
3300005979|Ga0056132_1115676	Not Available	1385
3300005984|Ga0056126_10428895	Not Available	515
3300006912|Ga0056114_1025777	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	4287
3300006912|Ga0056114_1070050	Not Available	2401
3300006912|Ga0056114_1086132	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2048
3300006912|Ga0056114_1121897	Not Available	1491
3300006912|Ga0056114_1150977	Not Available	1181
3300006912|Ga0056114_1221555	Not Available	721
3300008215|Ga0056108_1101007	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1873
3300008215|Ga0056108_1263618	Not Available	1014
3300010290|Ga0126333_1135589	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1208
3300010290|Ga0126333_1172620	Not Available	1016
3300010295|Ga0126334_10019060	Not Available	3354
3300010295|Ga0126334_10099748	Not Available	1593
3300010295|Ga0126334_10132726	Not Available	1337
3300010295|Ga0126334_10159011	Not Available	1182
3300010295|Ga0126334_10215457	Not Available	939
3300010295|Ga0126334_10413705	Not Available	527
3300010298|Ga0126325_10147478	Not Available	1243
3300010298|Ga0126325_10255919	Not Available	842
3300010298|Ga0126325_10256718	Not Available	840
3300010314|Ga0126331_1103946	Not Available	1476
3300010315|Ga0136654_1038118	Not Available	2479
3300010315|Ga0136654_1113264	Not Available	1416
3300010315|Ga0136654_1286637	Not Available	681
3300010377|Ga0126328_10066169	Not Available	1964
3300010377|Ga0126328_10292708	Not Available	707
3300010377|Ga0126328_10353604	Not Available	592
3300010378|Ga0126330_10074529	Not Available	1844
3300011190|Ga0126327_10244690	Not Available	815
3300011190|Ga0126327_10332017	Not Available	627
3300012273|Ga0126329_10195426	Not Available	1011
3300012273|Ga0126329_10386027	Not Available	578
3300027175|Ga0209146_1035631	Not Available	2671
3300027289|Ga0209787_1043572	Not Available	1759
3300027289|Ga0209787_1238594	Not Available	614
3300027318|Ga0209365_1052173	Not Available	1992
3300027318|Ga0209365_1125931	Not Available	1132
3300027318|Ga0209365_1156665	Not Available	935
3300027331|Ga0209569_1039812	Not Available	863
3300027331|Ga0209569_1120631	Not Available	603
3300027338|Ga0209052_1058091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Chenopodiaceae → Betoideae → Beta → Beta vulgaris → Beta vulgaris subsp. vulgaris	2049
3300027338|Ga0209052_1112303	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1276
3300027338|Ga0209052_1113384	Not Available	1266
3300027338|Ga0209052_1174507	Not Available	846
3300027338|Ga0209052_1177888	Not Available	828
3300027377|Ga0209363_1055240	Not Available	2626
3300027377|Ga0209363_1087287	Not Available	1872
3300027377|Ga0209363_1230324	Not Available	543
3300027382|Ga0209783_1065586	Not Available	1748
3300027382|Ga0209783_1129843	Not Available	1174
3300027382|Ga0209783_1156711	Not Available	1028
3300027389|Ga0209780_1034224	Not Available	4135
3300027392|Ga0209680_1000108	All Organisms → cellular organisms → Eukaryota → Opisthokonta	21235
3300027398|Ga0209782_1173122	Not Available	818
3300027500|Ga0209145_1112688	Not Available	1404
3300027500|Ga0209145_1187588	Not Available	851
3300027500|Ga0209145_1204561	Not Available	755
3300027519|Ga0209562_1197097	Not Available	892
3300027540|Ga0209791_1217815	Not Available	793
3300027544|Ga0209568_1164007	Not Available	1187
3300027549|Ga0209458_1069307	Not Available	1530
3300027551|Ga0209338_1041965	Not Available	2550
3300027551|Ga0209338_1051991	Not Available	2328
3300027551|Ga0209338_1164935	Not Available	1221
3300027551|Ga0209338_1278325	Not Available	795
3300027551|Ga0209338_1325401	Not Available	673
3300027551|Ga0209338_1388155	Not Available	538
3300027557|Ga0209679_1022410	Not Available	4434
3300027557|Ga0209679_1142320	Not Available	1486
3300027564|Ga0209428_1188723	Not Available	1045
3300027564|Ga0209428_1267384	Not Available	808
3300027584|Ga0209637_1147769	Not Available	1266
3300027584|Ga0209637_1175710	Not Available	1133
3300027585|Ga0209150_1342973	Not Available	590
3300027599|Ga0209786_1038592	Not Available	1861
3300027599|Ga0209786_1095292	Not Available	1289
3300027599|Ga0209786_1144327	Not Available	1055
3300027599|Ga0209786_1398480	Not Available	545
3300027602|Ga0209781_1343650	Not Available	576
3300027613|Ga0209122_1063437	Not Available	1708
3300027613|Ga0209122_1368611	Not Available	580
3300027615|Ga0209678_1250586	Not Available	824
3300027624|Ga0209789_10155306	Not Available	899
3300027626|Ga0209149_1142641	Not Available	1731
3300027632|Ga0209339_1214587	Not Available	1155
3300027658|Ga0209259_1246523	Not Available	943

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	67.26%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	32.74%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	67.26%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	32.74%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	47.02%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	32.74%
Marine Gutless Worms	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms	20.24%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated
3300001746	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2	Host-Associated
3300003772	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.2	Host-Associated
3300003774	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.3	Host-Associated
3300003853	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.1	Host-Associated
3300003906	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2	Host-Associated
3300004086	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.2 (version 2)	Host-Associated
3300004087	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.1 (version 2)	Host-Associated
3300004144	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1 (version 2)	Host-Associated
3300004630	Worm MetaG Olavius vacuus BAHAMAS.1	Host-Associated
3300004632	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1	Host-Associated
3300005170	Worm MetaG Olavius vacuus BAHAMAS.1 (version 1)	Host-Associated
3300005648	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.1	Host-Associated
3300005649	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2	Host-Associated
3300005652	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1	Host-Associated
3300005653	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1	Host-Associated
3300005871	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005979	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.2	Host-Associated
3300005984	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus manae LIZARD ISLAND	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300008212	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 1 HERON ISLAND	Host-Associated
3300008215	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1 BERMUDA.1	Host-Associated
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated
3300012887	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Olavius sp. 1 OAHU.JWI-45 metaG	Host-Associated
3300027175	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND (SPAdes)	Host-Associated
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027318	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius imperfectus BELIZE.2 (SPAdes)	Host-Associated
3300027331	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BAHAMAS.1 (SPAdes)	Host-Associated
3300027338	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND (SPAdes)	Host-Associated
3300027372	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius imperfectus BELIZE.1 (SPAdes)	Host-Associated
3300027377	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.3 (SPAdes)	Host-Associated
3300027382	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.1	Host-Associated
3300027389	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.2 (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated
3300027398	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1 (SPAdes)	Host-Associated
3300027495	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.1 (SPAdes)	Host-Associated
3300027500	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2 (SPAdes)	Host-Associated
3300027519	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2 (SPAdes)	Host-Associated
3300027520	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027540	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)	Host-Associated
3300027544	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2 (SPAdes)	Host-Associated
3300027549	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus manae LIZARD ISLAND (SPAdes)	Host-Associated
3300027551	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes)	Host-Associated
3300027557	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes)	Host-Associated
3300027564	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)	Host-Associated
3300027569	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.2 (SPAdes)	Host-Associated
3300027584	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)	Host-Associated
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated
3300027599	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.2 (SPAdes)	Host-Associated
3300027602	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.1 (SPAdes)	Host-Associated
3300027613	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)	Host-Associated
3300027615	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.1 (SPAdes)	Host-Associated
3300027624	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.2 (SPAdes)	Host-Associated
3300027626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)	Host-Associated
3300027632	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)	Host-Associated
3300027658	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24673J20094_100083334	3300001742	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLGLRPRPRWGSLQRSPDPLAGFKEA
JGI24673J20094_100188163	3300001742	Marine Gutless Worms Symbiont	MSDFKGKMHQIQFRLGLRPRSHWGSLQRSPDPLAGFKGAYF*
JGI24673J20094_101498101	3300001742	Marine Gutless Worms Symbiont	MSDFKAKMYQIQFRLGLCPRTRWGSLQRSPDLIAGLRG
JGI24672J20091_100339381	3300001746	Marine Gutless Worms Symbiont	MGSFKVKMHQNPFQLVLRPRPRWWSLRRSPDSLVGWE
Ga0049094_100103701	3300003772	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLGLRPRPRWGSLQRSPDSITGFKGPTSK
Ga0049095_100699051	3300003774	Marine Gutless Worms Symbiont	MSDFKAKMYQIRFRLVLRPRPRWGSLQRSPDPLAGFKGPTSK
Ga0049113_102350041	3300003853	Marine Gutless Worms Symbiont	MSDFKAKMHQIQFRLGFCPSSRWESLQRSPDPLAGFKGPTSKGR
JGI26667J51740_100605202	3300003906	Marine Gutless Worms Symbiont	MSDFKAKMYQIVCRLGLRPRLRWGSLQRSPDPLAGFRGPISKGR
Ga0066191_102897411	3300004086	Marine Gutless Worms Symbiont	VATRPEPHFEAKMQQIRFRLGLRPRSRWGSLQRSPDPLAGFKGPTSK
Ga0066190_101075433	3300004087	Marine Gutless Worms Symbiont	MSDFKAKMYQIQLRLGFSPRSRWGSLQRSPDLLAGLKRLTFKG
Ga0066190_101399111	3300004087	Marine Gutless Worms Symbiont	MSDFKAKMHQIQFRLGLCPKHCWGSLQRSPHPLGGFKGTTSKGRDGKG
Ga0066189_101325902	3300004144	Marine Gutless Worms Symbiont	MSYFKAKWTKFNFGWGSGSPRPRWGSLQRSPDPLAEFKGTYF*
Ga0049105_10267201	3300004630	Marine Gutless Worms Symbiont	MSDFKDTMHQIRFRLGLRPRPRWGSLQRSPDPLAGFKGPT
Ga0049105_12952411	3300004630	Marine Gutless Worms Symbiont	MSYFKAKMHQIQNRLGPCLRPRWGDYSAPPDPLAGYKGAYF*
Ga0049107_100239001	3300004632	Marine Gutless Worms Symbiont	MPDFNAKMHQNRFRLGLCPRPRWGSLQRSPDPLAGFKGAY
Ga0049107_101270953	3300004632	Marine Gutless Worms Symbiont	MPDFKMHRNRFRLGLRPRPRWGSLQRSPDPLAGFKGPTSKG
Ga0049107_102754082	3300004632	Marine Gutless Worms Symbiont	MSDFEVKMHQIRFRLGLRPRARWGSLQRSPDPLAGFKGPTSEGR
Ga0049107_102957251	3300004632	Marine Gutless Worms Symbiont	MQDSNTKMHQKRFRLGLCPRPRWGSLQRSPDPLAGFKGPTSKGR
Ga0049107_103577171	3300004632	Marine Gutless Worms Symbiont	MSDFMAKMNQSRIRLGLRPKPRWGSLQRSPDPLAGFKGPTSKGGEGRE
Ga0049107_103971201	3300004632	Marine Gutless Worms Symbiont	MSDFMAKMHHIRFRLGLRPKPRWGSLQRSPDLLAGFKGPTSLPTCLLLRG
Ga0071327_12358862	3300005170	Marine Gutless Worms Symbiont	MHQIRLRLGLRARLSWGSLQRSPDPLAEFKVAYFEGREGDGRGRER
Ga0071327_13065152	3300005170	Marine Gutless Worms Symbiont	MSYFKGEMHQIRFRLGLRPTHRWVSLQRYLRPLAGFKGRT
Ga0071327_13394091	3300005170	Marine Gutless Worms Symbiont	MSDFKAKMHQIRCQLGLRPRPRWGSLQQGPSDALAGFKGRTSKGK
Ga0071327_13405881	3300005170	Marine Gutless Worms Symbiont	MSNLKAKMHQNRFQLGVRFRPRWGSLQRSPDPLAGFKGPTSKE
Ga0056131_10384514	3300005648	Marine Gutless Worms Symbiont	MSYFKAKMHQIRFRLGRLPMTRWGSLQRSPGPLAG
Ga0056131_13464981	3300005648	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFPLGLCPRPRWGSLQRSPDPLAVFKGPTSK
Ga0056116_10338386	3300005649	Marine Gutless Worms Symbiont	MSDFKDTVHQIRFRLELCPRHQLESVQRSPDPLAGLKGTYF*
Ga0056116_11923584	3300005649	Marine Gutless Worms Symbiont	YFEAKMHQIRFRLGLRPRPRWGSLRRYGAPPDSVAGIQGTYF*
Ga0056135_100670995	3300005652	Marine Gutless Worms Symbiont	MPHFKAKMHQIRFQLELCPKPCWGSLQRSPDPLAGFKGPTSKG
Ga0056133_101417154	3300005653	Marine Gutless Worms Symbiont	MSYIKAKIHQIRFRLGLRPRPRWGSLQRSPNPLAGFKGPTS
Ga0056133_102806921	3300005653	Marine Gutless Worms Symbiont	MHQIQFWLGLRPRPRWGSLQRSPDPLAGFKGPTSKG
Ga0056133_104660773	3300005653	Marine Gutless Worms Symbiont	MSDFKAKMHQIQFRLGRWGSLQRSPDPLAGFKGAY
Ga0056124_101522811	3300005871	Marine Gutless Worms Symbiont	MSDFKAKMPQNRFRLGLRPARPRWGSLQRSPDPLAVFKGAYF*
Ga0056124_10160398	3300005871	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLGLRPRLRWGSLQRSPDPLAVFK
Ga0056124_10234856	3300005871	Marine Gutless Worms Symbiont	MPYFKAKMHEIRFRPGLRPRPHWGSLQRSPDPLAGFDGAYF*
Ga0056124_11303344	3300005871	Marine Gutless Worms Symbiont	MSDFQAKMHQIRFPLGLRPRPRWGSLQRSPDPLAA
Ga0056124_12762192	3300005871	Marine Gutless Worms Symbiont	MSDFKAKMHENRFRLGLRPRPRWGSLQRSPDPLAVFK
Ga0056130_10931103	3300005968	Marine Gutless Worms Symbiont	MSYFKAKMHQIQFRLGLRPRPRWGSLQRSPDPLAGFK
Ga0056130_11047591	3300005968	Marine Gutless Worms Symbiont	MADFEAKIHQIRCRLGLRPRPRWGSLQRSPDLLAGFKG
Ga0056130_12874021	3300005968	Marine Gutless Worms Symbiont	MLSYFKAKMHQNRFLLGLRPILLGLRPRPRWGSLQRSPDPLAGFKG
Ga0056130_13367831	3300005968	Marine Gutless Worms Symbiont	MSDFKAKMQQIRIPLELRPKPRLGSLQLFPRPIAVFKGPASEGRSR
Ga0056132_11156763	3300005979	Marine Gutless Worms Symbiont	MSHFRAEMHQIRFRLELRQRPAEGTRNASPDSVTGFKGPTSKGLRDGTG
Ga0056126_104288951	3300005984	Marine Gutless Worms Symbiont	MSNFKAEVYQIQFRQVLCPRPRWGSLQRSPDPLAGFKGP
Ga0056114_10257779	3300006912	Marine Gutless Worms Symbiont	MHQIRFWLGLRPRPRWGSLQRSPDPLAGFKGPTSK
Ga0056114_10700504	3300006912	Marine Gutless Worms Symbiont	MSYFKAKMHQIQFLLGLRPRPHWVSLQHSPDPLAGFKGA
Ga0056114_10861324	3300006912	Marine Gutless Worms Symbiont	MSAFKAKMYQIQFPLGICPRPRFGSSQRSPDPLAVLKGLHL
Ga0056114_11218972	3300006912	Marine Gutless Worms Symbiont	MSYFKAKMHQIRFRLVLRPRPRWGSLQRSPDPLAGFKG
Ga0056114_11509771	3300006912	Marine Gutless Worms Symbiont	MHQIRFRLGLRPRPRWGSLQRSPDPLAGFKGAYSKGRGKG
Ga0056114_12215551	3300006912	Marine Gutless Worms Symbiont	MSDFKAQMHQI*FPLGLRPRPRWGSLQRSPDPLAEFK
Ga0056121_10045292	3300008212	Marine Gutless Worms Symbiont	MSDFKAKMHQFRFPLGLRPRQRWGSLQRSPDSLAVFKGPTSKG
Ga0056121_11529021	3300008212	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLGLRPRPRLRSLQRSPRSIAVFKGPT
Ga0056108_11010073	3300008215	Marine Gutless Worms Symbiont	MSYFKAEMHQIRLKMHQIPRPRWRSLQRSPDPLAGFKGPTSK
Ga0056108_12636183	3300008215	Marine Gutless Worms Symbiont	MSDFKGKMHQIQFQLGLRPRPRWGSLQRSPDPLAGFKGPTSKGGEG
Ga0126333_11355892	3300010290	Marine Gutless Worms	MHQIRFRLGLRPRPHWGSLQRSPDPLAGLKGPASEGKEGK
Ga0126333_11726201	3300010290	Marine Gutless Worms	MSDFKAKMHQIRFRLVFFRRPRWGSLQRSPDSLPR
Ga0126334_100190603	3300010295	Marine Gutless Worms	MSYFKAKIYVIRFHLVLRPRPRWGSLQRSPDPLPGFK
Ga0126334_100997482	3300010295	Marine Gutless Worms	MSDFEAKMHKIRFSLALRPGPRWGSLQRSPDPLAVFK
Ga0126334_101327261	3300010295	Marine Gutless Worms	MSDFKAKMHQIRFRLVFFRRPRWGSLHRSPDSLPGFYGP
Ga0126334_101590111	3300010295	Marine Gutless Worms	MSDFKAEVHKIRFPLELCLRPRWGSLQRSPDTLAVFKGHGGRRGRGKGRG
Ga0126334_102154572	3300010295	Marine Gutless Worms	MSYFEAKMHQIRFLPRWGSLQRSPDPLAGFKGPSSK
Ga0126334_103264111	3300010295	Marine Gutless Worms	MSDFEAKIHQIPFPLGLSLRPRCGSLQRFPDPLAVFK
Ga0126334_104137051	3300010295	Marine Gutless Worms	MSDFTAKMHKIRFPLRFRPRPRWGSLQRSPDPLAVFK
Ga0126325_101474781	3300010298	Marine Gutless Worms	MLYFKAKTHQIRFRLGLRPRPHWGSLQRSPDPLAGFKGAYFYR
Ga0126325_101725262	3300010298	Marine Gutless Worms	MSYFKAKMHQIRFRLWLRPRPRWGAYSAPSDALAGFK
Ga0126325_102559191	3300010298	Marine Gutless Worms	MSYFKIKMHQIRFRLGLQGILQRFPRDPLAGFKGSGSK
Ga0126325_102567181	3300010298	Marine Gutless Worms	MSDFKAEVHKIRFPLELCVRPRWGSLQRSPDTLAVFK
Ga0126325_102637302	3300010298	Marine Gutless Worms	MSYFKGKIHKIPFRLGLCPRPRWGSLQRFPIPLAEFKGATSKG
Ga0126331_11039461	3300010314	Marine Gutless Worms	MSDFKAKMHQIRFRLAFFRRPRWGSLQRSPDSLPRFYGPTPK
Ga0126331_11677831	3300010314	Marine Gutless Worms	MSDFNARMHEIPFPLWLRSRLRSGSLRRTPDPLAVFKGPTSK
Ga0136654_10381183	3300010315	Marine Gutless Worms	MTCRQVSDFKAKMHQIRFRLWLRPRPRWGSLQRSPDPLAGFK
Ga0136654_11132642	3300010315	Marine Gutless Worms	MSNFKAKMHKIRFPLGLCPRPRWGSLQRSPDPLAVYK
Ga0136654_12866371	3300010315	Marine Gutless Worms	QMSDFKAKMHKIRFPLGLRPRPRWESIQRSANPVVVFKLAYF*
Ga0126328_100661691	3300010377	Marine Gutless Worms	MSYFKAKMHQNRFLLGRHPRPRWGSLQRSPDPLAGFKGPSSKGREGR
Ga0126328_101709251	3300010377	Marine Gutless Worms	MSDFKAKIHQIRFPLGLRPRSRWQSLQRSPSPLAVFEGPTSKGREG
Ga0126328_102927081	3300010377	Marine Gutless Worms	MPDFKAKMHKIRFPLGLRPGPRWGSLQRSPDPLAVFKG
Ga0126328_103169931	3300010377	Marine Gutless Worms	MSDFEAKIHQIPFPLGLSLRPRCGSLQRFPDPLAVFKEACF
Ga0126328_103536041	3300010377	Marine Gutless Worms	MQVSDFKAKMHQIRFRPGLRPRPHWGSLQRSPRPQAGFKGAY
Ga0126328_103777391	3300010377	Marine Gutless Worms	MSDFKSKIHQILFPLGLRPRPRWGSLQHSPDPLAVFKGATSKGRKGVE
Ga0126330_100745291	3300010378	Marine Gutless Worms	MSYFEAKMHQIRFRPRWGSLQRSPDPLAGFKGPTSKGKEGRGR
Ga0126327_102446901	3300011190	Marine Gutless Worms	MSYFKAKMHKIRFPLGLRPRPRWGSLQRSPDPLSGYKGAY
Ga0126327_103320171	3300011190	Marine Gutless Worms	MSYFKAKMHRNRFLLELRLRPRWGSLQRSPDPLAGFK
Ga0126329_101954261	3300012273	Marine Gutless Worms	MSDFKAEVHKIRFPLELCLRPRWGSLQRSPDTLAVFKGHGGRR
Ga0126329_102785403	3300012273	Marine Gutless Worms	MSDFKAKMHKIRFPLGLRPRPRWESIQRPANPVVVFKLAYF
Ga0126329_103133111	3300012273	Marine Gutless Worms	MSYFKAKVHQMPFRLGMRHRPRCGSLQRSPNPLAGFK
Ga0126329_103860271	3300012273	Marine Gutless Worms	MSYFKAKMRQIRFRLGRSPSPRWGSLQRSPDLLLVFKGAY
Ga0126335_10039851	3300012887	Marine Gutless Worms	MSDFKAKIHQIRFLLGLCPRPRWESLQHSPDPLPVVKGACSKQEGEE
Ga0126335_10130262	3300012887	Marine Gutless Worms	MSYFKANMHKIRFRLGFRLRPHWESLQRSPDPLAGAKGNFYF*
Ga0209146_10356314	3300027175	Marine Gutless Worms Symbiont	MLYFETKMHQIRFWLRLRLRPRWGSPQRSPDPLAEFKGSY
Ga0209787_10435722	3300027289	Marine Gutless Worms Symbiont	MSDFKAKMHQIXFPLGLRPRPRWGSLQRSPDPLAEFKGPTSKGREGK
Ga0209787_10988331	3300027289	Marine Gutless Worms Symbiont	MADFEAKIHQIRCRLGLRPRPRWGSLQRSPDLLAGFKGPYT
Ga0209787_12385941	3300027289	Marine Gutless Worms Symbiont	MPQIRFRLGLCPKPRWGSLQRSPDLLAGLMGPISKGREGKSKDEFVL
Ga0209365_10521731	3300027318	Marine Gutless Worms Symbiont	MHQNRWRLRLRPRPHWGSLQRSPDPLAGFNGPTSKAPI
Ga0209365_11259311	3300027318	Marine Gutless Worms Symbiont	MHQIRLEAGLRPDLLGILQRSPDPLAGFKGPTSIGRGGEKRG
Ga0209365_11566652	3300027318	Marine Gutless Worms Symbiont	MSDFKANMHQILFWLGLRPRPRWGSLQRSPDPLAGFKGAYI
Ga0209569_10398121	3300027331	Marine Gutless Worms Symbiont	MHQIFDFGWGCTLRPIPSWGSLQRSPDPLAVFKGPNSKGREGKGREGMK
Ga0209569_11206311	3300027331	Marine Gutless Worms Symbiont	MSDFKTKMHQIQFRLGLRPRPRWGSLQRSPDPVAGFKGREG
Ga0209052_10426523	3300027338	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLRVRPTPRWAYSASPDSLAVFKGPTSKGKEGEGK
Ga0209052_10580911	3300027338	Marine Gutless Worms Symbiont	MSFFKAKMHQIRFRLGLRPRPRWGSLQRSPDTLAGFE
Ga0209052_10728441	3300027338	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLGLRPRPRWGSLRRSTDPLAVFKGAYF
Ga0209052_10792671	3300027338	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLGLRPRPRWGSLQRSPKPLAVFK
Ga0209052_11123031	3300027338	Marine Gutless Worms Symbiont	MADFKAKMHKIGLSLALRLTPRWGSLQRSPDPLTVFK
Ga0209052_11133841	3300027338	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLGLRPRPRWGSLQRSPDPLAVFKG
Ga0209052_11745071	3300027338	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLRFRRRPRWGSLQRSPDPLAVFKGAYFYKG
Ga0209052_11778882	3300027338	Marine Gutless Worms Symbiont	MSDFKAKMHRNRFRLGIRPRPRWGSLQRSPDPLAVFKGPTSKRK
Ga0209052_12014881	3300027338	Marine Gutless Worms Symbiont	MQMSDFKAKMHQNRFRLGLRPRPRWGSLQRSPGPLAVFKGPTSK
Ga0209452_10343591	3300027372	Marine Gutless Worms Symbiont	MSDFKATMHQIXFPLGLLPTTRWGSLQRSPDHLAGFK
Ga0209452_12260461	3300027372	Marine Gutless Worms Symbiont	MLHFIANMHQIRFRLGLCPRPRWGSLQRSPDRLAKFKGPT
Ga0209363_10552401	3300027377	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLGLRPRPRWGSLQRSPDSITGFKGPTSKGG
Ga0209363_10872871	3300027377	Marine Gutless Worms Symbiont	MSYFTAKMHQIRFRLGLRPRPRWGSLQRSPDPLAGFRGAYF
Ga0209363_12303241	3300027377	Marine Gutless Worms Symbiont	MADFKAKMHQIQFRLGLRPRPRWGSLQRSPYALAG
Ga0209783_10655861	3300027382	Marine Gutless Worms Symbiont	MAKMYQIQFRLGLRPRPRWGSLQRSPDPLAGLRGPTSKGRGEE
Ga0209783_11298431	3300027382	Marine Gutless Worms Symbiont	MSDFKARLYQIQFRLGLRPRPRWGSLQRSPDPLSGLRG
Ga0209783_11567111	3300027382	Marine Gutless Worms Symbiont	MSDFKAKMHQIQFRLGLRPRPRWGSLQRSPDPLAGFKGP
Ga0209780_10342243	3300027389	Marine Gutless Worms Symbiont	MADFKAKMHQIQFRLGLRPRPRWGSLQRSPYALAGSKGAYLHGKGWE
Ga0209680_10001081	3300027392	Marine Gutless Worms Symbiont	MSYFKAKMHKIRFPLGLCPRPRWGSLQRSPDPLAVFKGLHLRGGEGGKGKGRG
Ga0209680_11691002	3300027392	Marine Gutless Worms Symbiont	MHQNQLLMGLRPRTRWGSLQRSPDTLAGFKRPTSKEGKG
Ga0209782_10220483	3300027398	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLGLRPRPRWGSLQRSPDSLAVFKGAYF
Ga0209782_11731221	3300027398	Marine Gutless Worms Symbiont	MSDFNAKMHQIQFRLGLRPRPRWGSLQRSPDPLAGFN
Ga0209788_10523471	3300027495	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFPLGLRPRPRWGSLQRSPGPLAVFK
Ga0209145_11126882	3300027500	Marine Gutless Worms Symbiont	MSYFKAKMHQIRFRLVVHLRLRLGSLQRFPRTLAGFK
Ga0209145_11874821	3300027500	Marine Gutless Worms Symbiont	MLDFKAKMHQIQFRLELRPRPRWGSLQHSPDNLAGLNRPTSK
Ga0209145_11875881	3300027500	Marine Gutless Worms Symbiont	MSDFKAKMYQIQFRLGLRPRPRWGSLEPDPLAGLRGLLLRGVE
Ga0209145_12045611	3300027500	Marine Gutless Worms Symbiont	MYQIQFRLGLRPRPLRGSLQRSPDPLAGLRGPTSKGRGEG
Ga0209562_11970971	3300027519	Marine Gutless Worms Symbiont	MSDFKAKMHQIQFRLGFRPRPRWGSLQRPTDSLAGFKGPTSKG
Ga0209562_12151911	3300027519	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLGLRPRPRWGSLSAPPDPLAAMRGPTSKGRGG
Ga0209681_12426811	3300027520	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFPLGLRPRPRWGSLQRSPKPLAVFKGPT
Ga0209791_12178151	3300027540	Marine Gutless Worms Symbiont	MSDFKAKMHPIRFRLGLCSRPRWGSLQRSPDPLAGFKGPTSKGRERQGE
Ga0209568_11640071	3300027544	Marine Gutless Worms Symbiont	MSYFEAKMHPIRFLLGLRPRPRWGSLQRSPGPLAGIAWGLLLKGGEER
Ga0209458_10693072	3300027549	Marine Gutless Worms Symbiont	MPYFKVKMHQIRFRLGLRPRPHWGSLQRSPDPLAGLRGPTSKG
Ga0209458_11451681	3300027549	Marine Gutless Worms Symbiont	MSYFKAKIHQIQFPLGLRPRPCWRSLQRSPDPLAGLRGPI
Ga0209338_10419652	3300027551	Marine Gutless Worms Symbiont	MSDFKAKMHQLRFRLWLRPRPHWGAYSAPPASLAGFEGAYF
Ga0209338_10519911	3300027551	Marine Gutless Worms Symbiont	MSDFKAKMHQIQFRLGVCPRPRWGSLQRSPDPLARFKEAYF
Ga0209338_11622961	3300027551	Marine Gutless Worms Symbiont	MSDFKAKMYQIQFRLGLRPRARXGSLQRSPDPLAGLRGPTSK
Ga0209338_11649351	3300027551	Marine Gutless Worms Symbiont	MSDFKAKMHQIQFRLGLRPRPRWGSLQRSPDPLAGFKGPTS
Ga0209338_12783251	3300027551	Marine Gutless Worms Symbiont	MAEFKAKMHQIQNRLGLRPRPHWGSLQRSPDPLAGFKGPTSK
Ga0209338_13254011	3300027551	Marine Gutless Worms Symbiont	MLDFNIKMHQIRFRLGLRPRPRWGSLQRSPDPLAGFKGPTSKGR
Ga0209338_13881551	3300027551	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLGLRPRPRWGSLQRSPDPLAGFK
Ga0209679_10224102	3300027557	Marine Gutless Worms Symbiont	MSDLKAKMHQIRFPLGLRTRPRWGSLQRSPDPLAVFKGAYF
Ga0209679_11423203	3300027557	Marine Gutless Worms Symbiont	MSDFQAKTHQIRFPLGLRPRPRWGSLQRSPDPLAVF
Ga0209679_12475991	3300027557	Marine Gutless Worms Symbiont	MSDFKDKMRQIRFPLGLRPRPRWESLQRSPDSLAVFKGPTSKGREGMGE
Ga0209428_11887231	3300027564	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLGLCPRPRWGSLQRSPDPLAGFKGAYF
Ga0209428_12265381	3300027564	Marine Gutless Worms Symbiont	MSHFKAKMHQIQFRLGHCPRPRWGSLQRSPNPLAEFF
Ga0209428_12673841	3300027564	Marine Gutless Worms Symbiont	MSDFKAKMHPIRFRLGLCSRPRWGSLQRSPDPLAGFKGPTSKGREGG
Ga0209364_11156011	3300027569	Marine Gutless Worms Symbiont	MHQILFRLGLHTRPHWGSLQQSPDPLAGFNGATSKGVDGREREREAEG
Ga0209364_12687722	3300027569	Marine Gutless Worms Symbiont	MHQNRFRPRSRWGSLQRSPDPIAAFKGPTSKGKEGEGKR
Ga0209637_11477691	3300027584	Marine Gutless Worms Symbiont	MLDFNVKMHQIRFRLGLCPRPRWGSLQRSPDPLAGFKGP
Ga0209637_11757101	3300027584	Marine Gutless Worms Symbiont	MSDFKGKMHQIQFRLGLRPRYHWGSLQRSPDPLAGFKGAY
Ga0209150_13429731	3300027585	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLELRPSPRWGSLQRSPDPLAGINGPTSN
Ga0209786_10385921	3300027599	Marine Gutless Worms Symbiont	MSYFKAKMHQIQFGWGSRTRWGSLQRSPDPLAGFEGPTSKGGEGKGR
Ga0209786_10952921	3300027599	Marine Gutless Worms Symbiont	MSYFAATMHQIRFRLGLRPRPRWGSLQRSPDPLAGFKGPTSKGRGREWGV
Ga0209786_11198351	3300027599	Marine Gutless Worms Symbiont	SHFKAKMHQIQFRLGLRPRPRWGSLQRYPDPLAEFKGAYL
Ga0209786_11443271	3300027599	Marine Gutless Worms Symbiont	MHQNRLRLGLRPRPRWGSLQRSPDPLAGFKGPTSKGRGALD
Ga0209786_13547091	3300027599	Marine Gutless Worms Symbiont	MSDFQAKMHQNRFRLGLRPRPRWDSLQRSPDPLAALK
Ga0209786_13973661	3300027599	Marine Gutless Worms Symbiont	MPPDVRFYHFKAKMHQNRFRLGLRPRPRWRSLQRSPRPLAGLKG
Ga0209786_13984801	3300027599	Marine Gutless Worms Symbiont	MLYFKAKMHQIRFRLGSRPRCGSLQRSPDPLAGFLGPTSKEVRGRDGREG
Ga0209781_13436501	3300027602	Marine Gutless Worms Symbiont	MHKISGPPGLRPGPHWGSLQRSPDPLAGFRGMAPGKGIGKGVGKGG
Ga0209122_10634372	3300027613	Marine Gutless Worms Symbiont	MSDFKAKMYQIQFRLGLRPRPRWGSLQRSPDPLAAFKGPTS
Ga0209122_11923431	3300027613	Marine Gutless Worms Symbiont	MHQIRFRLGLRPRPSWGSLMRSPDPVAGFRGPTSKGEGE
Ga0209122_12116651	3300027613	Marine Gutless Worms Symbiont	MSDFKAKMYQIQFRLGLRPRPRXGSLQRTPDHLAGLMGPTSKG
Ga0209122_13686111	3300027613	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLGFRPRWGSLQRSPDPVAGFKC
Ga0209678_11081141	3300027615	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLGLRPRPRWGSLQNSPGPLAGF
Ga0209678_12505861	3300027615	Marine Gutless Worms Symbiont	MQMSDFKVKMHQIQFRLGLRPRPRWGSLQRSPDPLAGGEGAG
Ga0209678_14300371	3300027615	Marine Gutless Worms Symbiont	MSDFKAKMYQIQFRLGLRPRPRWGSLQRSPDPLAAVRGPTSKGRGGDET
Ga0209789_101553061	3300027624	Marine Gutless Worms Symbiont	MSDFKTKMHQIRFRLGLRRRPRWGSLQRSPDPVAGFK
Ga0209149_11426411	3300027626	Marine Gutless Worms Symbiont	MSDFKAKMHQIRFRLGLRPRPRWGSLQRSPDPLAGFKGAY
Ga0209149_12094451	3300027626	Marine Gutless Worms Symbiont	MSDFKAKMHQNRFRLGLRPRPRWGSLQRSPNPLAGFKGPT
Ga0209339_12145871	3300027632	Marine Gutless Worms Symbiont	MLDFNIKMHQIRFRLGLLPRPRWGSLQRSPDPLAGFKG
Ga0209259_12465231	3300027658	Marine Gutless Worms Symbiont	MHQIQFWLGLRPRPRWGSLQRSPDPLAGFKGPTSK