Metagenome Family F037038

Basic Information
Family ID	F037038
Family Type	Metagenome
Number of Sequences	168
Average Sequence Length	37 residues
Representative Sequence	MDHVAVKLEQDLALMDEGNGEKQVKSRSMNQYDHVMI
Number of Associated Samples	56
Number of Associated Scaffolds	167

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	90.85 %
% of genes near scaffold ends (potentially truncated)	14.29 %
% of genes from short scaffolds (< 2000 bps)	72.02 %
Associated GOLD sequencing projects	56
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.35

Most Common Taxonomy
Group	Eukaryota (42.262 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (72.619 % of family members)
Environment Ontology (ENVO)	Unclassified (98.810 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (72.619 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 167 Family Scaffolds
PF00078	RVT_1	2.40
PF00190	Cupin_1	1.20
PF00098	zf-CCHC	1.20
PF04765	DUF616	0.60
PF00504	Chloroa_b-bind	0.60
PF01008	IF-2B	0.60
PF13912	zf-C2H2_6	0.60
PF00185	OTCace	0.60
PF13966	zf-RVT	0.60
PF06068	TIP49	0.60
PF13976	gag_pre-integrs	0.60
PF07727	RVT_2	0.60

COG ID	Name	Functional Category	% Frequency in 167 Family Scaffolds
COG0182	5-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunit	Amino acid transport and metabolism [E]	0.60
COG1184	Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family	Translation, ribosomal structure and biogenesis [J]	0.60
COG1224	DNA helicase TIP49, TBP-interacting protein	Transcription [K]	0.60

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	78.57 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	78.57 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	42.26 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	42.26 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	42.26 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	41.67 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	41.67 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	38.10 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	38.10 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	38.10 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	38.10 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	36.90 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	36.90 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	36.90 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	36.90 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	36.90 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	36.31 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	32.14 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	32.14 %
Unclassified	root	N/A	21.43 %

Name	Rank	Taxonomy	Distribution
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	22.62 %
Unclassified	root	N/A	21.43 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	5.36 %

Name	Rank	Taxonomy	Distribution
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	22.62 %
Unclassified	root	N/A	21.43 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	5.36 %

Name	Rank	Taxonomy	Distribution
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	21.43 %
Unclassified	root	N/A	21.43 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	2.98 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	2.38 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.60 %

Name	Rank	Taxonomy	Distribution
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	21.43 %
Unclassified	root	N/A	21.43 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	2.98 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	2.38 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.60 %

Name	Rank	Taxonomy	Distribution
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	21.43 %
Unclassified	root	N/A	21.43 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	2.98 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	1.79 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.60 %

Name	Rank	Taxonomy	Distribution
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	36.31 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	21.43 %
Unclassified	root	N/A	21.43 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	2.98 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1.79 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001977\|JGI24746J21847_1025038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	826	Open in IMG/M
3300009036\|Ga0105244_10256686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	814	Open in IMG/M
3300014486\|Ga0182004_10001123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	18876	Open in IMG/M
3300014486\|Ga0182004_10002376	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	14571	Open in IMG/M
3300014486\|Ga0182004_10002431	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	14464	Open in IMG/M
3300014486\|Ga0182004_10002433	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	14455	Open in IMG/M
3300014486\|Ga0182004_10002822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	13659	Open in IMG/M
3300014486\|Ga0182004_10002912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	13487	Open in IMG/M
3300014486\|Ga0182004_10003593	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	12356	Open in IMG/M
3300014486\|Ga0182004_10004169	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	11619	Open in IMG/M
3300014486\|Ga0182004_10005008	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10748	Open in IMG/M
3300014486\|Ga0182004_10005093	Not Available	10683	Open in IMG/M
3300014486\|Ga0182004_10006533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	9517	Open in IMG/M
3300014486\|Ga0182004_10006963	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	9222	Open in IMG/M
3300014486\|Ga0182004_10008545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8328	Open in IMG/M
3300014486\|Ga0182004_10008730	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	8227	Open in IMG/M
3300014486\|Ga0182004_10010688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	7386	Open in IMG/M
3300014486\|Ga0182004_10011014	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	7267	Open in IMG/M
3300014486\|Ga0182004_10011842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	6971	Open in IMG/M
3300014486\|Ga0182004_10012280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6837	Open in IMG/M
3300014486\|Ga0182004_10015769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	5873	Open in IMG/M
3300014486\|Ga0182004_10018087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	5394	Open in IMG/M
3300014486\|Ga0182004_10019626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	5125	Open in IMG/M
3300014486\|Ga0182004_10020135	Not Available	5029	Open in IMG/M
3300014486\|Ga0182004_10020801	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	4926	Open in IMG/M
3300014486\|Ga0182004_10024546	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4383	Open in IMG/M
3300014486\|Ga0182004_10025350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4278	Open in IMG/M
3300014486\|Ga0182004_10026036	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4191	Open in IMG/M
3300014486\|Ga0182004_10027133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	4064	Open in IMG/M
3300014486\|Ga0182004_10027133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	4064	Open in IMG/M
3300014486\|Ga0182004_10027812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3984	Open in IMG/M
3300014486\|Ga0182004_10028806	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	3875	Open in IMG/M
3300014486\|Ga0182004_10029610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3794	Open in IMG/M
3300014486\|Ga0182004_10033927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	3412	Open in IMG/M
3300014486\|Ga0182004_10043437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2782	Open in IMG/M
3300014486\|Ga0182004_10044034	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	2748	Open in IMG/M
3300014486\|Ga0182004_10044883	Not Available	2705	Open in IMG/M
3300014486\|Ga0182004_10046146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	2639	Open in IMG/M
3300014486\|Ga0182004_10047439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2573	Open in IMG/M
3300014486\|Ga0182004_10052923	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2331	Open in IMG/M
3300014486\|Ga0182004_10053841	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2296	Open in IMG/M
3300014486\|Ga0182004_10059674	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	2086	Open in IMG/M
3300014486\|Ga0182004_10060011	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	2075	Open in IMG/M
3300014969\|Ga0157376_12119096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	601	Open in IMG/M
3300015267\|Ga0182122_1059760	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	531	Open in IMG/M
3300015268\|Ga0182154_1003093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1181	Open in IMG/M
3300015268\|Ga0182154_1022425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	697	Open in IMG/M
3300015276\|Ga0182170_1071713	Not Available	515	Open in IMG/M
3300015277\|Ga0182128_1000257	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	2592	Open in IMG/M
3300015279\|Ga0182174_1028710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	691	Open in IMG/M
3300015279\|Ga0182174_1037442	Not Available	642	Open in IMG/M
3300015279\|Ga0182174_1054844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	576	Open in IMG/M
3300015279\|Ga0182174_1057052	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	570	Open in IMG/M
3300015281\|Ga0182160_1040352	Not Available	622	Open in IMG/M
3300015281\|Ga0182160_1070157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	531	Open in IMG/M
3300015281\|Ga0182160_1081357	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	507	Open in IMG/M
3300015282\|Ga0182124_1031063	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	664	Open in IMG/M
3300015282\|Ga0182124_1042887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	608	Open in IMG/M
3300015282\|Ga0182124_1078194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	511	Open in IMG/M
3300015285\|Ga0182186_1012342	Not Available	867	Open in IMG/M
3300015285\|Ga0182186_1026784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	698	Open in IMG/M
3300015285\|Ga0182186_1064425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	543	Open in IMG/M
3300015285\|Ga0182186_1067619	Not Available	535	Open in IMG/M
3300015285\|Ga0182186_1079153	Not Available	510	Open in IMG/M
3300015286\|Ga0182176_1031583	Not Available	687	Open in IMG/M
3300015286\|Ga0182176_1083831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	505	Open in IMG/M
3300015287\|Ga0182171_1008852	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	955	Open in IMG/M
3300015287\|Ga0182171_1077017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	525	Open in IMG/M
3300015288\|Ga0182173_1078436	Not Available	518	Open in IMG/M
3300015289\|Ga0182138_1079222	Not Available	522	Open in IMG/M
3300015291\|Ga0182125_1095640	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	500	Open in IMG/M
3300015294\|Ga0182126_1077417	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	537	Open in IMG/M
3300015295\|Ga0182175_1010675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	948	Open in IMG/M
3300015295\|Ga0182175_1016220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	846	Open in IMG/M
3300015295\|Ga0182175_1078638	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	539	Open in IMG/M
3300015296\|Ga0182157_1032055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	710	Open in IMG/M
3300015296\|Ga0182157_1067564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	573	Open in IMG/M
3300015298\|Ga0182106_1033941	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	700	Open in IMG/M
3300015298\|Ga0182106_1086076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	532	Open in IMG/M
3300015299\|Ga0182107_1100636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	508	Open in IMG/M
3300015300\|Ga0182108_1046118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	650	Open in IMG/M
3300015300\|Ga0182108_1082531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	545	Open in IMG/M
3300015302\|Ga0182143_1057626	Not Available	604	Open in IMG/M
3300015302\|Ga0182143_1076785	Not Available	554	Open in IMG/M
3300015302\|Ga0182143_1083285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	539	Open in IMG/M
3300015303\|Ga0182123_1085922	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	524	Open in IMG/M
3300015304\|Ga0182112_1053922	Not Available	617	Open in IMG/M
3300015304\|Ga0182112_1062357	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	591	Open in IMG/M
3300015307\|Ga0182144_1069090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	579	Open in IMG/M
3300015307\|Ga0182144_1096842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	521	Open in IMG/M
3300015308\|Ga0182142_1008385	Not Available	1078	Open in IMG/M
3300015314\|Ga0182140_1081830	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	562	Open in IMG/M
3300015321\|Ga0182127_1055536	Not Available	648	Open in IMG/M
3300015321\|Ga0182127_1065760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	616	Open in IMG/M
3300015321\|Ga0182127_1069796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	605	Open in IMG/M
3300015321\|Ga0182127_1089252	Not Available	561	Open in IMG/M
3300015323\|Ga0182129_1030500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	748	Open in IMG/M
3300015323\|Ga0182129_1045341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	667	Open in IMG/M
3300015342\|Ga0182109_1084415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	723	Open in IMG/M
3300015342\|Ga0182109_1135865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	608	Open in IMG/M
3300015342\|Ga0182109_1149013	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	587	Open in IMG/M
3300015343\|Ga0182155_1007371	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1527	Open in IMG/M
3300015343\|Ga0182155_1106940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	661	Open in IMG/M
3300015343\|Ga0182155_1122206	Not Available	630	Open in IMG/M
3300015343\|Ga0182155_1161806	Not Available	569	Open in IMG/M
3300015343\|Ga0182155_1226185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	501	Open in IMG/M
3300015344\|Ga0182189_1079965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	742	Open in IMG/M
3300015344\|Ga0182189_1137396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	611	Open in IMG/M
3300015345\|Ga0182111_1091924	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	731	Open in IMG/M
3300015345\|Ga0182111_1157099	Not Available	598	Open in IMG/M
3300015346\|Ga0182139_1077093	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	780	Open in IMG/M
3300015346\|Ga0182139_1173587	Not Available	576	Open in IMG/M
3300015346\|Ga0182139_1185289	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	561	Open in IMG/M
3300015346\|Ga0182139_1207896	Not Available	537	Open in IMG/M
3300015346\|Ga0182139_1214043	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	530	Open in IMG/M
3300015346\|Ga0182139_1244403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	503	Open in IMG/M
3300015347\|Ga0182177_1071932	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	802	Open in IMG/M
3300015347\|Ga0182177_1133334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	639	Open in IMG/M
3300015347\|Ga0182177_1159272	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	598	Open in IMG/M
3300015347\|Ga0182177_1182092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	568	Open in IMG/M
3300015347\|Ga0182177_1204854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	542	Open in IMG/M
3300015347\|Ga0182177_1206155	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	541	Open in IMG/M
3300015347\|Ga0182177_1217901	Not Available	529	Open in IMG/M
3300015347\|Ga0182177_1224529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	523	Open in IMG/M
3300015351\|Ga0182161_1149899	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	634	Open in IMG/M
3300015351\|Ga0182161_1201365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	564	Open in IMG/M
3300015351\|Ga0182161_1266558	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	502	Open in IMG/M
3300015355\|Ga0182159_1112735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	817	Open in IMG/M
3300015355\|Ga0182159_1140204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	747	Open in IMG/M
3300015355\|Ga0182159_1158711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	709	Open in IMG/M
3300015355\|Ga0182159_1159590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	707	Open in IMG/M
3300015355\|Ga0182159_1231531	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	604	Open in IMG/M
3300015355\|Ga0182159_1308674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	532	Open in IMG/M
3300015355\|Ga0182159_1314481	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	527	Open in IMG/M
3300015361\|Ga0182145_1048074	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	799	Open in IMG/M
3300015361\|Ga0182145_1187835	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	508	Open in IMG/M
3300017409\|Ga0182204_1067756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	599	Open in IMG/M
3300017410\|Ga0182207_1072978	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	676	Open in IMG/M
3300017417\|Ga0182230_1071528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	621	Open in IMG/M
3300017417\|Ga0182230_1093097	Not Available	553	Open in IMG/M
3300017420\|Ga0182228_1067985	Not Available	635	Open in IMG/M
3300017420\|Ga0182228_1101359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	549	Open in IMG/M
3300017424\|Ga0182219_1001371	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2807	Open in IMG/M
3300017424\|Ga0182219_1012397	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1086	Open in IMG/M
3300017424\|Ga0182219_1031466	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	800	Open in IMG/M
3300017425\|Ga0182224_1013668	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1075	Open in IMG/M
3300017425\|Ga0182224_1166741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	500	Open in IMG/M
3300017427\|Ga0182190_1116099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	568	Open in IMG/M
3300017430\|Ga0182192_1097457	Not Available	614	Open in IMG/M
3300017430\|Ga0182192_1122987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	567	Open in IMG/M
3300017436\|Ga0182209_1018595	Not Available	1002	Open in IMG/M
3300017436\|Ga0182209_1163012	Not Available	513	Open in IMG/M
3300017438\|Ga0182191_1145455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	544	Open in IMG/M
3300017442\|Ga0182221_1141534	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	533	Open in IMG/M
3300017442\|Ga0182221_1162636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	510	Open in IMG/M
3300017442\|Ga0182221_1168808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	504	Open in IMG/M
3300017443\|Ga0182193_1152075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	551	Open in IMG/M
3300017443\|Ga0182193_1156027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	546	Open in IMG/M
3300017443\|Ga0182193_1175036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	524	Open in IMG/M
3300017682\|Ga0182229_1057696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	660	Open in IMG/M
3300017683\|Ga0182218_1091830	Not Available	590	Open in IMG/M
3300017684\|Ga0182225_1127119	Not Available	523	Open in IMG/M
3300017685\|Ga0182227_1038796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	831	Open in IMG/M
3300017685\|Ga0182227_1091324	Not Available	584	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	72.62%
Roots	Host-Associated → Plants → Roots	25.60%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.19%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	72.62%
Unclassified	Host-Associated → Plants → Roots → Unclassified	25.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.19%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	72.62%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	25.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.19%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	72.62%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	25.60%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.60%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24746J21847_10250382	3300001977	Corn, Switchgrass And Miscanthus Rhizosphere	MDRVAVKLEQDLAPMDDXNGEEQVXSRXMNQYDHVMI*
Ga0105244_102566862	3300009036	Miscanthus Rhizosphere	MDRVSVKLEQDLAPMDDGNGKEQVKSRSMNQYDHV
Ga0182004_100009068	3300014486	Root	VTVKLEQNLAPMDQGNGEEQVRSRSMNQYGHMMI*
Ga0182004_100011234	3300014486	Root	VTVKLEQDLAAMDQGNCEERVRSRSMNQYNHVMI*
Ga0182004_1000237611	3300014486	Root	VTVKLEQDLAPMDQGNSEVQVRSRSMNQYSHVMI*
Ga0182004_1000243112	3300014486	Root	VTVKLEQDLAPTDQGNDEEQVRSRSMNQYNHVMI*
Ga0182004_1000243315	3300014486	Root	VTVKLKQDLAPMDRGSSEEQVKSRSMNQYDHLTI*
Ga0182004_1000282219	3300014486	Root	VTVKLEQDLAPMDQGNGEEQVRLGSMNQYGHVLT*
Ga0182004_100029122	3300014486	Root	VTVKLEQDLAPIDQGNDEEQVRPRSMNQYSHMMI*
Ga0182004_100035939	3300014486	Root	VTVNLEQDLALLDQDNGEEQVRLRSMNHYGHVMI*
Ga0182004_100041692	3300014486	Root	VTVKLEQDLAPTDQGNDEEQVRSRSTNQYGHVMI*
Ga0182004_100050088	3300014486	Root	VTVKLEQDLAPMNQGNGEEQVRSGSMNQYDHMMI*
Ga0182004_100050934	3300014486	Root	VTVKLEQDLVSMDRGNGEKQVMSRSMNQYGHVMI*
Ga0182004_100065332	3300014486	Root	VTVKLEQELAPMDRHNGEEQVSSRLMNQYGYMMI*
Ga0182004_100069638	3300014486	Root	VTVKLEQELALMDRGNGEEQVRLRSMNQYGHVMI*
Ga0182004_1000854512	3300014486	Root	MTVKLEEDLARMDQGNSEEQVRTRSMNQYDHVMI*
Ga0182004_100087306	3300014486	Root	VTIKFEQDLAMMDQCNSEEQVRSRSMNQYGHMMI*
Ga0182004_100106889	3300014486	Root	VTVKLEQDLASMDQSNGEEQVRSRSINQYGHVMI*
Ga0182004_1001101411	3300014486	Root	VMVKLEQDLVPMDQHNGEEQLRSKSMNQYGHIMI*
Ga0182004_100118421	3300014486	Root	VTVKLEQDLAPMDRGNSEGQVRSRLMNQYSYVMI*
Ga0182004_100122809	3300014486	Root	VTVKLEQDLASMDRSNGEEQVRSRSMNQYNHVMI*
Ga0182004_100157695	3300014486	Root	MTVKLEQDLTPIDRGNSEEQVRSRLMNQYSHVMI*
Ga0182004_100180871	3300014486	Root	VTVKLEQDLPPMDQSNSEEQVRSRSMNQYGHVMI*
Ga0182004_100196266	3300014486	Root	VMMKLEQDLALMDQGNDEEQVRSRSMNQYGHVMI*
Ga0182004_100201353	3300014486	Root	VMVNLEQDLASMDRGNGEEQVRSRSMNQYDHMMI*
Ga0182004_100208017	3300014486	Root	VTVKLEQGLAPMDRHNVEEQVRSRSMNQYVHVMI*
Ga0182004_100245462	3300014486	Root	VTVKLQQDLAPMDQGNGEEQVRLRSTNQYGHMMI*
Ga0182004_100253502	3300014486	Root	VTVKLEQYLAPMDQGNGEEQVMSILMNQYGHVMI*
Ga0182004_100260367	3300014486	Root	VTVKLEQDLAPMDHDNNEEQVRSRLMKQYSHVMI*
Ga0182004_100271332	3300014486	Root	VTVKLEQDIALMDQGNDEEQVRSRSMNQYGHVMI*
Ga0182004_100271334	3300014486	Root	VTVKLEQGLASVDQGNGKEQVRSRSMNQYGHVMI*
Ga0182004_100278122	3300014486	Root	VTVKLVQDLALIDQCNIEEQVRSRSMNQYGHVMI*
Ga0182004_100288062	3300014486	Root	VMVKLEQDLALMDQGNDEEQVRSRSMNQYSHVMI*
Ga0182004_100296103	3300014486	Root	VTVKLEQDMAPVDRCNGEEQVKSRSMNQYGHVTI*
Ga0182004_100339272	3300014486	Root	VTVKLEQDLVPMNRRNGEEQVRSRSINQYGHVLI*
Ga0182004_100434372	3300014486	Root	VIVKLEQDLVLMGQGNGEKQVRSRLMNQYGHMMI*
Ga0182004_100440341	3300014486	Root	VTVKLEQDLALMDRDNGEEQVRSRSMIQYGHMMI*
Ga0182004_100448831	3300014486	Root	VTVKLEQDLAPMNPRNSEEQVKSRSMNQYGHVMI*
Ga0182004_100461465	3300014486	Root	VTVKLEQDLAPIDQCDSEGQVRSRSMNQYNHVMI*
Ga0182004_100474392	3300014486	Root	VTVKLEQDLASMDRDNGEEQVRSRSMNQYGHMMI*
Ga0182004_100529235	3300014486	Root	VTVKLEQDLVPMDQGNDEEQVRSKSMNQSGHMMI*
Ga0182004_100538413	3300014486	Root	VTVKLEQDLAPMDQGNDEEQVRSRLMNQYGHMMI*
Ga0182004_100596742	3300014486	Root	VTVKLEQDLVPMNRRNGEEQVRSKSMNQYGHMMI*
Ga0182004_100600113	3300014486	Root	VTVKLEQDLVSMDQGNSEEQVRSRSMNQYGHMMI*
Ga0182004_100776801	3300014486	Root	SEGPRVTVKLEQDLALMDQGNGEEQVRSRSMNQYSHVMI*
Ga0157376_121190961	3300014969	Miscanthus Rhizosphere	MDHVAVKLEQDLALMDEGNGEKQVKSRSMNQYDHVMI*
Ga0182122_10597601	3300015267	Miscanthus Phyllosphere	MDRVAANLEQDLTPMDEGNGEKQVKSRSMNQYDHVMI*
Ga0182154_10030931	3300015268	Miscanthus Phyllosphere	GFGAMDLVTVKLEQDLAPMDEGNGEKQVRPRSINQ*
Ga0182154_10224252	3300015268	Miscanthus Phyllosphere	MDCMAVKLEQDLTPMDKGNGEKQVKSRSMNQYDHVMI*
Ga0182170_10717131	3300015276	Miscanthus Phyllosphere	MDRVAMKLEQDLTPMDEGNSEKQVKSRLMNQYDHVMI*
Ga0182128_10002573	3300015277	Miscanthus Phyllosphere	MDRMAVKLEQDLPLMDEDNGEKQVRSRSMNQQVHVMI*
Ga0182174_10287102	3300015279	Miscanthus Phyllosphere	MDRVAVKLEQDLASMDEGNGKKQVKSRSMNQYDHMMI*
Ga0182174_10374422	3300015279	Miscanthus Phyllosphere	MDRVAVKLEKDLAPMDEGIGEKQVKSRSMNQYDHVMI*
Ga0182174_10548441	3300015279	Miscanthus Phyllosphere	MDRVVVKLELDLTLMDKGNGDKQVRSRLMNQQDHVMI*
Ga0182174_10570522	3300015279	Miscanthus Phyllosphere	MDRVAVKLEQDLAMMDEGNGKKQVRSRSMNQQGHVML*
Ga0182160_10403521	3300015281	Miscanthus Phyllosphere	MDRVAVKLEQDLALMDEGNGEKQVKSRSMNQYDHMM
Ga0182160_10701571	3300015281	Miscanthus Phyllosphere	MDRVAVKLEQDFTPMDEGIGEKQVKSGSMNQYDHVMI*
Ga0182160_10813571	3300015281	Miscanthus Phyllosphere	MDRVAVKLEQDLTPMDEGNGEKQVKSRSMNQYDNVMI*
Ga0182124_10310632	3300015282	Miscanthus Phyllosphere	MDRVAMKLEQDLASMDEGNGEKQEKSRSMNQYDHVMI*
Ga0182124_10428871	3300015282	Miscanthus Phyllosphere	MDHMAVKLEQDLVSMDKGNGEKQVKSRSMNQYDHVMI*
Ga0182124_10781941	3300015282	Miscanthus Phyllosphere	MDRMAVKLEQDLASMDEGNDEEQVRSRLINQQGHMMI*
Ga0182186_10123421	3300015285	Miscanthus Phyllosphere	MNRVAVKLEQDLASMDEGNSEKQVKSRSMNQYDHVMI*
Ga0182186_10267841	3300015285	Miscanthus Phyllosphere	MDRVAVKLEQDLMPMDEGNGDKQVKSRSMKQQGHMMI*
Ga0182186_10644251	3300015285	Miscanthus Phyllosphere	MGHLAVKREQDLAPMDEVNGEEQVKSGSMNQYGHMMI*
Ga0182186_10676191	3300015285	Miscanthus Phyllosphere	MDRVVVKLEQALVSMDEGNSEKQEKSRLMNQYDHMMI*
Ga0182186_10791531	3300015285	Miscanthus Phyllosphere	MDRMAVKLEQDLAPMDEGNDEKQVKSKLMNQYNYVMI*
Ga0182176_10315831	3300015286	Miscanthus Phyllosphere	MDRVALKFEQDLTAINEGNGEKQVRSISMNQQGHVMI*
Ga0182176_10838312	3300015286	Miscanthus Phyllosphere	VVVKLEQDLAPMDEGNCEKQVRSRSMNQQDHMVI*
Ga0182171_10088521	3300015287	Miscanthus Phyllosphere	MDHVAVKLEQGLAPMDEGNGEKQVNSRSMNQYDHVMI*
Ga0182171_10624691	3300015287	Miscanthus Phyllosphere	VSRRLRSEGPRVTVKLEQDLAPMDRCNGEEQVRSRSMNQ*
Ga0182171_10770171	3300015287	Miscanthus Phyllosphere	MDRVTVKLEQDLALMDKGNGEKKVRSRSMNQQGHMMI*
Ga0182173_10784361	3300015288	Miscanthus Phyllosphere	MDRVAVKLEQDLTSMDEGNGKKQVRSRSMNQQDHVMI*
Ga0182138_10792221	3300015289	Miscanthus Phyllosphere	MDRVAMKLKQDLASMDEGNGEKEVKSRSMNQYDHVMI*
Ga0182125_10956401	3300015291	Miscanthus Phyllosphere	MDRVAVKLEQDLASMDEGNGEKQVKSRSMNQYDYVMI*
Ga0182126_10774171	3300015294	Miscanthus Phyllosphere	MDYMAVKLEQDLALMDEGNGENKVRSRSMNQQGHMII*
Ga0182175_10106752	3300015295	Miscanthus Phyllosphere	MDCVAVKLEQDLAPMDEGNGEKQVKSRLMNQYDHMMI*
Ga0182175_10162203	3300015295	Miscanthus Phyllosphere	MVRVAVKLKQDLAPMDEGNDEKQVKSRSMNQYDHVMI*
Ga0182175_10786382	3300015295	Miscanthus Phyllosphere	MDRVAVKLEQDVADEGNGEKQVKSRSMNQYDHMMI*
Ga0182157_10320551	3300015296	Miscanthus Phyllosphere	MDRVVVKFEQNLAPMDEDNVEKQVRSRSMNQQGHVII*
Ga0182157_10675641	3300015296	Miscanthus Phyllosphere	MAVELEQDLMPMDKGNGEKQVKSRLMNQYGHVMI*
Ga0182106_10339412	3300015298	Miscanthus Phyllosphere	MDRVTVKLKQDLTPMDEGNGEKQVKSRLMNQYDYLMI*
Ga0182106_10860761	3300015298	Miscanthus Phyllosphere	MDRVAVKLEQDLASMNEGNGEKQVKSRSINQYDHMMI*
Ga0182107_11006361	3300015299	Miscanthus Phyllosphere	MNRMAVKLEQDLALMDEGNGEKQVKSRSMNQYDHIMI*
Ga0182108_10461181	3300015300	Miscanthus Phyllosphere	MDHMAVKLKQDLASMDEGNGEKQVKSRLMNQYDHVMI*
Ga0182108_10825311	3300015300	Miscanthus Phyllosphere	MDHVMVKLEQDLAPMDEANGEKQVKSRSMNQYNHVMI*
Ga0182143_10576262	3300015302	Miscanthus Phyllosphere	MNRVAVKLEQDLTLMDEGNGEKQVSSRSKNQQGYVII*
Ga0182143_10767851	3300015302	Miscanthus Phyllosphere	MDRVGVKLEQDLALMDEGNGEKQVKSRLMNQYEHVMI*
Ga0182143_10832852	3300015302	Miscanthus Phyllosphere	VAVKLKQNLAPMDEGNGEKQVKSRSMNQYDHVMI*
Ga0182123_10859222	3300015303	Miscanthus Phyllosphere	MDSVVVKLEQNLAPMDEGNGEKQVRSRWMNQQGHMMI*
Ga0182112_10539221	3300015304	Miscanthus Phyllosphere	MDRVVVKLEQDLVLIDEGNGEKQVRSRSMNQQVHVMIQSGSYHL*
Ga0182112_10623573	3300015304	Miscanthus Phyllosphere	MDRVTVKLKQDLALMDEGNGEKQVKSRSMNQYDHVMI*
Ga0182144_10690902	3300015307	Miscanthus Phyllosphere	MDRVAVKHEQDLAPMDEGNGEKQVKPRSMNQYDHAMI*
Ga0182144_10968421	3300015307	Miscanthus Phyllosphere	MDRVVVKLEQDLALMDKGNGEKKVRSRSMNQQGHVVI*
Ga0182142_10083852	3300015308	Miscanthus Phyllosphere	MDRVAVKLEQDWSSMDEGNGEKQVKSRSMNQYDHVMI*
Ga0182140_10818301	3300015314	Miscanthus Phyllosphere	MIDRVVVKLEQDLMPMDEGNGEKQVKSRSMNQYDHMMI*
Ga0182127_10555361	3300015321	Miscanthus Phyllosphere	MDRVAVKLEQDLVPMDEGNDEKQVRSRSMNQQSHMM
Ga0182127_10657601	3300015321	Miscanthus Phyllosphere	MDRVAVKLEQDLMPMDDGDSEEQVKSRSMNQYDHVMI*
Ga0182127_10697961	3300015321	Miscanthus Phyllosphere	AMDRVAVNLEQDMAPMDEGNGEKQVRSRLMNQQGYVMI*
Ga0182127_10892522	3300015321	Miscanthus Phyllosphere	MNREAVKLEQDLVPINEGNGKKQVESRSMNQYDDVMVRSGSYYY*
Ga0182129_10305001	3300015323	Miscanthus Phyllosphere	MDCVVVKLEQDLASMDEDNGEKQVRSRSMNQQGYVMI*
Ga0182129_10453412	3300015323	Miscanthus Phyllosphere	MDLVVVKLDQDMALMDKGNGEKQVRSRLMNQQGHVMI*
Ga0182109_10844152	3300015342	Miscanthus Phyllosphere	MDHVAVKLEQDLAPMDNGNSEKQMRSRSINKQGRLMI*
Ga0182109_11358651	3300015342	Miscanthus Phyllosphere	MDRVTVKLEQDLVSMDEGNGEKQVKSRSMNQYDHVMI*
Ga0182109_11490131	3300015342	Miscanthus Phyllosphere	MDRMAVKLEQDLAPIDEGNGEKQVKSRSMNKYDHVMI*
Ga0182155_10073711	3300015343	Miscanthus Phyllosphere	MDHVSVKLEQDLAPVDEGNGEKQVKSRSMNQYGHVII*
Ga0182155_11069401	3300015343	Miscanthus Phyllosphere	MDRVAVKLEQDLVSMDEGNSEKQLKSRSMNQYDHVMI*
Ga0182155_11222061	3300015343	Miscanthus Phyllosphere	MDHVAVKLEQDLALMDEGNGEKQVRSRSMNQQGQVMI*
Ga0182155_11618061	3300015343	Miscanthus Phyllosphere	MDRVAVKLEQDLTPMDENNGEKQVRSRLMNQQTHVMI*
Ga0182155_12261852	3300015343	Miscanthus Phyllosphere	MDRVAVKLKQDLTPMDEGNGEKQVKSRSMNQYDHVMR*
Ga0182189_10799651	3300015344	Miscanthus Phyllosphere	VAVKLEQDLASMDECNGEKQVKSRSMNQYDHVMI*
Ga0182189_11373961	3300015344	Miscanthus Phyllosphere	MDCMAMNLEQDLAPMDEGNGEKQVRSGSMNQQDHVMI*
Ga0182111_10919241	3300015345	Miscanthus Phyllosphere	MDHVAVKLEQDLVPMAEGNGKKQVKSRSMNQYDHVMI*
Ga0182111_11570991	3300015345	Miscanthus Phyllosphere	MDRVAVKLKQYLAPMDEGNGEKQVKSRSMNQYDHMMI*
Ga0182139_10770932	3300015346	Miscanthus Phyllosphere	MDRVVVKLEQELASMDKGNSEKQVRSRSMNQQGRVMI*
Ga0182139_11735871	3300015346	Miscanthus Phyllosphere	VKGKLSDDLAPMDQNNGEEQVKSRSMNQYDHVMI*
Ga0182139_11798292	3300015346	Miscanthus Phyllosphere	VSVKGKLSDYLAPMDRGNDEEQVKSRLMNQYGHMMI*
Ga0182139_11852891	3300015346	Miscanthus Phyllosphere	VKGKLSDDLAPMDRGNGEEQVKSRSMNQYDHMMI*
Ga0182139_12078961	3300015346	Miscanthus Phyllosphere	MDHVVVKLEQDLAPMDEDNSEKQVKSRSMNQYDHVMI*
Ga0182139_12140431	3300015346	Miscanthus Phyllosphere	MDRVVVKLEQDLALMDEGNGEKQVMSRSMNQYDHVMI*
Ga0182139_12444031	3300015346	Miscanthus Phyllosphere	MDRVAVKLEQDLTPMDEGNGEKQVKSISMNQYNHVMI*
Ga0182177_10719321	3300015347	Miscanthus Phyllosphere	MDRVTVKFEQDLAPMNEGNGEKQVKSRSMNQYDHV
Ga0182177_11333341	3300015347	Miscanthus Phyllosphere	MDRVAVKLEQDLEPMDKDNGEKQVKSRSMNQYDHMMI*
Ga0182177_11592721	3300015347	Miscanthus Phyllosphere	MDRMALKLEQDLTSMDEGNGEKQVKSRSMNQYDHMML*
Ga0182177_11820921	3300015347	Miscanthus Phyllosphere	RVAVKLEQDLTPMDKGNGEKQVKSRSMNQYDHVMI*
Ga0182177_12048542	3300015347	Miscanthus Phyllosphere	MDRVVVKLEQDLALMDKGNGEKKVRSRSMNQQGHMMI*
Ga0182177_12061551	3300015347	Miscanthus Phyllosphere	MDCMAVKLEQDLGLMDEGNGEKQVKSRSINQYDHVMI*
Ga0182177_12179011	3300015347	Miscanthus Phyllosphere	MDRVAVKLEQDLVPMDEGNGEKQVKSRSINQYDHMMI*
Ga0182177_12245292	3300015347	Miscanthus Phyllosphere	MDHVAVKLEQDLAPMDEGNGEKQVMSRSMNQYDRVMI*
Ga0182161_11498991	3300015351	Miscanthus Phyllosphere	MDRVAIKLEQDLAQMDNDNGEKQVKSRSMNQYDHAMI*
Ga0182161_12013651	3300015351	Miscanthus Phyllosphere	VGGLGAMDHVEVKLEQDLVSMDVGNSEKQVRSISMNQQTHMMI*
Ga0182161_12665581	3300015351	Miscanthus Phyllosphere	MDHVAVKLEQDLALMDEGNGEKQVRSRSMNQQGHAMI*
Ga0182159_11127352	3300015355	Miscanthus Phyllosphere	VAVKLEQDLAPMDEGNDGKQVRSRLMNQQGHMMI*
Ga0182159_11402042	3300015355	Miscanthus Phyllosphere	MNHVAVKLEQDLAAMDEGNGEKQVKSRLMNQYNHMMI*
Ga0182159_11587111	3300015355	Miscanthus Phyllosphere	MDHVAVKLEQDLAPMDEGSGEKQVKSRTMNQYDHVMI*
Ga0182159_11595901	3300015355	Miscanthus Phyllosphere	MDHVAVKLKQDFAPMDEGNSEKQVKSRSMNQYDHVMI*
Ga0182159_12315313	3300015355	Miscanthus Phyllosphere	MDHVTVKLEQDLAPMDDGNSEEQVESRSMNQYDHVMI*
Ga0182159_13086741	3300015355	Miscanthus Phyllosphere	MDRVAVKLEQDLAPMDEDNGEKQVKSRLMNQYDHKMI*
Ga0182159_13144811	3300015355	Miscanthus Phyllosphere	MDHVAVKLEQDLASMDEGNSEKQVKSRLMNQYDHMMI*
Ga0182145_10480741	3300015361	Miscanthus Phyllosphere	MDRVAVKLEQDLTPMDKDNGEEQVKSRSMNQYGHMMI*
Ga0182145_11878351	3300015361	Miscanthus Phyllosphere	MDHMAVKLKQDLALMDEGNDEKQVKSRLMNQYDHMMI*
Ga0182204_10677561	3300017409	Miscanthus Phyllosphere	AMDRVAMKLEQDLAPMDEGNDEKQVKSRSMNQYDQVMI
Ga0182207_10729781	3300017410	Miscanthus Phyllosphere	MDDMAVKLEQDLTPMDEDNGEKQVKSRSMNQYDHVMI
Ga0182230_10715281	3300017417	Miscanthus Phyllosphere	MDRMTVKLEQDLVLMDEGNGEKQVRSRSMNQYDHVMI
Ga0182230_10930972	3300017417	Miscanthus Phyllosphere	MDRMAVKLKQDLAPMNEGNGEKQVKLRSMNQYDHMMI
Ga0182228_10679851	3300017420	Miscanthus Phyllosphere	MDRVAVKLEQYLAPMDEGNGEKQVNSRSMNQYDHVMI
Ga0182228_11013592	3300017420	Miscanthus Phyllosphere	MDRVAVKLEQDLASMDEGNGEKQVKSRSMNQYDHMMI
Ga0182219_10013712	3300017424	Miscanthus Phyllosphere	VIDRVAVKLEQDLALMDEGNGEKQVKSRSMNQYGH
Ga0182219_10123971	3300017424	Miscanthus Phyllosphere	MDHVAVKLEQDLALMDEGNGEKQVKSRSMNQYNHVMI
Ga0182219_10314663	3300017424	Miscanthus Phyllosphere	MNRMVVKLEQDLASMDEGNGEKQVKLRSMNQYDHVMI
Ga0182224_10136681	3300017425	Miscanthus Phyllosphere	MDRMAVKLEQDLAPMDEDNGEKQVKSRSMNQYDNVMI
Ga0182224_11667412	3300017425	Miscanthus Phyllosphere	AMDRVAVKLKQDLVPMDEGNSEKQIKLRSMNQYDHVMI
Ga0182190_11160991	3300017427	Miscanthus Phyllosphere	MDRVVVKLEQDLALMDEGNYEKQVRSRSMNQQGHMMI
Ga0182192_10974571	3300017430	Miscanthus Phyllosphere	MDRVAVKLEQDLASMDEGNSEKLVRSRLINQQGHMMI
Ga0182192_11229871	3300017430	Miscanthus Phyllosphere	RGFGAMDHVVVKLEQDLALMDEGNGEKQVRSRSMNQYSHIMI
Ga0182209_10185951	3300017436	Miscanthus Phyllosphere	RVAVKLEQDLAPMDDGNGEKQVKSRSANQYDHMMI
Ga0182209_11630121	3300017436	Miscanthus Phyllosphere	MDRVAVKLEQDLVLIDEDNGEKQVRSRSMNQQGHMMI
Ga0182191_11454551	3300017438	Miscanthus Phyllosphere	DHVAVKLEQDLVPMDEGNGEKQVKSRSMNQYDHVMI
Ga0182221_11415341	3300017442	Miscanthus Phyllosphere	MVRVAVKLEQDLASMDEGNGEKQVKSRSMNQYDHVMI
Ga0182221_11626361	3300017442	Miscanthus Phyllosphere	MDRLVMKLEQDLASMDEGNGEKQVEPRSMNQYDHMMI
Ga0182221_11688081	3300017442	Miscanthus Phyllosphere	MDHVAVKLKQDLAPMDEDNGEKQVKSRSMNQYDYVMI
Ga0182193_11520751	3300017443	Miscanthus Phyllosphere	MDHVAVKLEQDLVPMDKGNGEKQVMSRSMNQYDHVMI
Ga0182193_11560271	3300017443	Miscanthus Phyllosphere	MDRVAVKLKQDLASMDEGNGEKQVKSRLMNQYDHVKI
Ga0182193_11750362	3300017443	Miscanthus Phyllosphere	MDRVAVKLEQDLALMDEGDSEKRVKSRSMNQYDHVMI
Ga0182229_10576961	3300017682	Miscanthus Phyllosphere	MDCVAVKLEQNLAPMDGGNGEKQVKSRSMSQYDHVMI
Ga0182218_10918301	3300017683	Miscanthus Phyllosphere	MDRVEVKLEQDLVPTDEGNGENQVRSRLMNQQGRMMI
Ga0182225_11271191	3300017684	Miscanthus Phyllosphere	MDCMAVKLEQDLASMDEGNDEKKVRSRSMNQQGHAMI
Ga0182227_10387961	3300017685	Miscanthus Phyllosphere	MDHMVVKLEQDLAPMDKGNGEKQVKSRLMNQYDHVMI
Ga0182227_10913241	3300017685	Miscanthus Phyllosphere	MDRMVVKLEQDLALMDEGNGEKQVRSRSMNQQGHI

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.35
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.35
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F037038

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Host-Associated	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign